Flavobacterium johnsoniae UW101 uid58493

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|146297795|ref|YP_001192386.1| alkylhydroperoxidase [Flavobacterium johnsoniae UW101]
    MKSRIVIPNVAPEAYNALLNLEKYISSTSLTPVHKELIKIRASQINGCAYCINMHSADARKHGISEQRIYLTSAWREADV
    YTEEEKAILALTEQVTLISNHVSDEVYQNAARLFDEKYLAEIILAIITINSWNRLAITTGLRAV

    >gi|146297964|ref|YP_001192555.1| thioredoxin reductase [Flavobacterium johnsoniae UW101]
    MSDTIEKIKCLIIGSGPAGYTAAIYAARANMNPVLYQGMQPGGQLTTTNEVENFPGYVDGVTGPEMMIQLQEQAKRFGAD
    IRDGWATKVDFSGGIHKVWINDSIELHCETVIISTGASAKYLGLPSEQHYLNMGGGVSA
    CAVCDGFFYRNQEVVIVGAGD
    SACEEAHYLSKLCKKVTMLVRSEKFRASKIMEERVRKTENIEILMNHDTLEVLGDNNVVHAIKALNKTTGETIEIPATGF
    FVAIGHKPNTDIFKDYITLDETGYIINTPGTSKTNVEGVFVAGDAADHVYRQAITAAGTGCMAALDAERYLASQE

    >gi|146298031|ref|YP_001192622.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MSLKIGDIVPNFTAKDSHGEVFESKNVLGRKPLVIYFYPKDNTPGCTTEACSFRDQYEDFKDLGAEVIGISADSVKSHHK
    FANKHQLPFILLSDEDKRLRHLFGVKNNLFGLIPGRVTFIIDRNGVVIYIFDSMNAAKHIPKALEIIKELVL

    >gi|146298034|ref|YP_001192625.1| methionine-R-sulfoxide reductase [Flavobacterium johnsoniae UW101]
    MKSKNLIFSLCFLIPLFVFQACGQNTKKQPAKTAVMENKISKPGNPYYSNTDTTKLNVSNAEWKKVLPEDVYAVMREADT
    ERPFTGKYWNTDEKGTYYCASCGNLLFRSTAKFSSSCGWPSFFEQENKKSIVFKDDNSLGMERTEALCGRCGGHLGHIFD
    DGPEPTGKRY
    CMNSIALDFVPDTK

    >gi|146298035|ref|YP_001192626.1| peptide methionine sulfoxide reductase [Flavobacterium johnsoniae UW101]
    MKNIFLICLLAFSLNGISQNKKANLETITLGGGCYWCVEAVYENLDGVKSVVSGFSGGKTANPSYEEVCTGTTGHAEVVQ
    ITYDKNITDINEIFKVFFTVHDPTTLNRQGADVGTQYRSVIFYKNDEQKKAAESIIAELNKAKVYNNPIVTKVEPFKVFY
    KAEDYHQNYYANNKNQPYCKMVIQPKLEKFEKVFKDKLKKK

    >gi|146298048|ref|YP_001192639.1| alkylhydroperoxidase [Flavobacterium johnsoniae UW101]
    MSDLVQEFNDYRSKMNEKLLADNNKIVKRIFNLDTNAYAPGALDVKTKELLGLVASAVLRCDDCVKYHLETSYKEGISKE
    EMMEAMGIATLVGGTIVIPHLRRAYEFWEALEEAGK

    >gi|146298503|ref|YP_001193094.1| arsenate reductase and related [Flavobacterium johnsoniae UW101]
    MNKIYYLASCDTCRKIIKSLPKNNLVFHDIKQDPITEAELEEMYKLSGSYEALFSKKAQLYKSMGLKDKALTEADFKKYI
    LEHYTFLSRPVFIIDGKIYIGNSQKNVAEVINVLS

    >gi|146298634|ref|YP_001193225.1| rhodanese domain-containing protein [Flavobacterium johnsoniae UW101]
    METQIKHYENKLAFEMDPSDLFDALNNGEKVIALDARKAFGFEAEHIPNAINIPHREMSAETTKHLDKDVLYVTYCDGIG
    CNASTKGALNMTKLGFKVKELMGGIEWWKFDGYATEGSKGIKTGLKIECAC

    >gi|146298638|ref|YP_001193229.1| methylated-DNA--protein-cysteine methyltransferase [Flavobacterium johnsoniae UW101]
    METVYINSPLGITKIVGDEAGIAAISVSDVGTNEVSKKIPKVLKDAVSQLEEYFEGKRTNFDLKLNPQGTEFQQKVWKSL
    LEIPYGKTVSYMDQTKKLGDIKAIRAVASANGKNPLWIVVP
    CHRVIGTNGSLTGYAGGLSRKKWLLEHESPSKQQSLF

    >gi|146298667|ref|YP_001193258.1| rhodanese domain-containing protein [Flavobacterium johnsoniae UW101]
    MQLYNTLSAEERAIMIDDAGKQRLTLSFYAYAKIQDPQKFRNDLFLAWNALDALGRIYVAHEGINAQMSVPAENFEAFRE
    TLEAYDFMKGIRLNVAVEQDDHSFLKLTIKVRHKIVADGLNDETFDVTNIGVHLKAKEFNEILDDPNTIVVDFRNHYESE
    VGHFKGAITPDVETFRESLPIINEQLKDHKDDKNLVMY
    CTGGIRCEKASAYFKHQGFKNVYQLEGGIINYAKQLKEEGLE
    SKFIGKNFVFDNRLGERITDDIISQCHQCGKPCDNHTNCENDGCHLLFIQCDDCKTAMENCCSTECLEIIHMPLVDQVRL
    RTGKQVGNKVFRKGKSENLKFKHSGELPETALATAQTRGGAERSGAKPADIRQKIKVKKVLLGKAEHYYVKAQVGQFTIE
    NQELNSGDKILISGPTTGDQEMVLNRIIVNGAETQTAKIGDKVTFEVPFRIRLSDKLYKIIN

    >gi|146298691|ref|YP_001193282.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Flavobacterium johnsoniae UW101]
    MKRNDFDVIIIGGSYSGLSAAMSLGRSLRQVLVIDSGLPCNKQTPHSHNFITQDGEKPAVISAKAKLQVEIYKTVQFFNG
    LAVKAFKTDKGFEIITKSGDVFTSRKVLFATGVKDLLPEINGFAECWGISVLH
    CPYCHGYEVKNEKTAIIANGEMGFEYA
    KLISNWTKDLRLCTNGKSELTSEQTQILKNHDVQIFEEQIESFENQEGYVQNIVFKNQDKVEIKAIYARPPFEQHCAIPE
    TLGCDLNEQGLLKVDAMQKTNISGIFASGDCTTPMRSVAIAVSTGSFAGAVINKELIDEDF

    >gi|146298945|ref|YP_001193536.1| iron-sulfur cluster assembly accessory protein [Flavobacterium johnsoniae UW101]
    MIKVSDTAKKKIIDLMTDDGFDAASDYVRVGVKSGGCSGLSYDLKFDKTKGEDDKIFVDNDIQIAVEKKSFLYLAGTILE
    FSGGLNGKGFVFNNPNASRTCGCGESFSL

    >gi|146299009|ref|YP_001193600.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKKLFVTGLLIFSALNVIGQAKNQIKFTAKIDNRNSDTLVIKGRNNFKQVIPIDKKGIFAATFEAPKGFYMFSDGTESSN
    IYLKPDSEVNLTMNAKEFDETIVYKGKGVNESNFLAQQSLKDEKFQNEAFAKEAAEFTSLLENKKKTDFENLEKSDLDPE
    FKTALKMSFESFNQYAVQEYERTANARKMVGKPSPQFDYENFKGGKTKLSDLKGKYVYIDLWATW
    CAPCRAEIPYLQKIE
    EKYHGKNIEFVSISIDKAKDNEKWKKFVTDKKLGGVQLFADKDWESEFVVNYGVMGIPRFILLDPNGNIVSSDATRPSDP
    KLQDQLNTLLN

    >gi|146299103|ref|YP_001193694.1| thioredoxin [Flavobacterium johnsoniae UW101]
    MALAITDATFDEVVLKSDKPVMVDFWAAWCGPCRMVGPIIDQLSDEYAGKVVVGKVDVDANQEFAAKYGVRNIPTVLVFH
    NGEVVGKQVGVAPKQTYADSLDALL

    >gi|146299182|ref|YP_001193773.1| hypothetical protein Fjoh_1422 [Flavobacterium johnsoniae UW101]
    MKRILLIAFFVVGAFAGQAQELKWYTDVKEAITISNKEQKPMLMFFTGSDWCGWCIRLQNEVLKTAEFKKWAADNVVLVE
    LDYPRGVPQTPELKSQNNELQQAFGIQGFPTVFFTSAEAKDGKINFKGLGKTGYVAGGPSAWLTVAEGIVHPKKS

    >gi|146299255|ref|YP_001193846.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MKVTLNRVNDAFHFKVKNERGHIVDVDSRAEFGGSDLGASPMELVLMGVAGCSAIDMISILKKQRQEITSFNAEVEGTRV
    QIEEAKPFKEIDVVFYLEGEINPEKAKKAAQLSFEKYCSVAKTVEPTATIKYKVVLNSEAL

    >gi|146299301|ref|YP_001193892.1| heavy metal transport/detoxification protein [Flavobacterium johnsoniae UW101]
    MKFTKIIASLAIAGLVFVSCKKEEDKNLANIKPLETTARQQKAIAAENVQTASFKIEGMTCAMGCAKTIEKELSNLDGVE
    KAAVDFDKKTATVTFDKTVQNQESLTKIVQETGDGKTYKVSDFKS

    >gi|146299335|ref|YP_001193926.1| methylated-DNA--protein-cysteine methyltransferase [Flavobacterium johnsoniae UW101]
    MNTQETINYNRIAEAIDYIKANFKEQPNLDEVAEKVHLSPFHFQRLFSDWAGTSPKKFLQYTSLEHAKKLLKENQATISE
    TAFETGLSGTSRLHDLFVNIEGMTPAEYKNGGKNLEINYSFAESPFGNIIVASTQKGVCFMAFAEDEITGFTALKDKFPN
    AQFSKKLDLSQQNALFIFQNDWSRLSEIKLHLKGTDFQLKVWETLLKIPMGQLSTYGSIAHQIQKPNASRAVGTAIGSNP
    VAFLIP
    CHRVIQSSGTFGGYMWGNTRKTAIIGWEGAQVNSQL

    >gi|146299357|ref|YP_001193948.1| UBA/THIF-type NAD/FAD binding protein [Flavobacterium johnsoniae UW101]
    MSIIQEFLRYNRQTILPEIGDEGQEKLKKARVLVIGAGGLGCPILQYIATAGVGFIGIMDFDTIEIHNLHRQILYTENEI
    GKHKSIIAKDVVSKLNPLIEAIAINEKLTVENAAKIIQQYDIVVDGSDNFSTRYLVNDTCVELNKPLVYGSILKFEGQIA
    VFNHNGSKNLRDLFPEMPDPKDVPN
    CNLNGVLGTLPGIIGNMMAHETLKLILELPTLKNELIIFNTLNWNFTKLNF

    >gi|146299423|ref|YP_001194014.1| electron transport protein SCO1/SenC [Flavobacterium johnsoniae UW101]
    MFKNKSYIGISFIILIFGIYAVPKIVDRIKNGDVVKGNRLDNVGSKSSKDAKLLTIGPAPKFELTNQDNVKISNETYKGK
    VYVLEFFFTT
    CPSICPKMNMSMLEIEKTFFGNPNFGIVSITIDPVHDTPQVLKDHAKLLGVKSASWNFLTGDKATIMDLS
    NKGFNLYAGENSKVNGGFEHSGLFALIDKDGNIRCRKDEFGNPNIYYDGLDKKGVRDIQQDIKILLEE

    >gi|146299482|ref|YP_001194073.1| hypothetical protein Fjoh_1722 [Flavobacterium johnsoniae UW101]
    MKKIILFAMLAVAGITASNAQTTKKASAKAAKVAKIEGAGMAFESETIDYGTIAHNADGKREFVFVNNGTKPLIITNAQG
    S
    CGCTVPTSPKEPIAPGAKGVIGVKYATDRVGAFTKTVTITSNAEGQPTKVLTIKGTVLPDPVKS

    >gi|146299770|ref|YP_001194361.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MNTIKYKITALCICLFMVSNTQAQKKKTAAPVAASYTIEGNVTGLEEGTTVKLIPGGTHSSELPVAETTLKDGKFTFTGK
    LKEPRYFYISFGKNKGIIPVMAENSKIKITASGSVSNDEGQYIKFKDIAVTGSKSHDFYTKETAFKAELDKDYAAYHVGI
    DELSNKVGKARKEGNKKALDSLYGTEQWKVFEAKEKAFFTKVEKTTLDLIAKHKETWWGPFFMMTNYSYFTPEQKPLYDQ
    FSETAKKSYYGQILDKDLNPKSLIGTSIANFSLKDKDGKPYAAKDITAGKKYILVDFWASW
    CGPCRKEIPNLKTAYSEYS
    GKGFEILSISIDKDEKAWQKALGQENMQWHNLLDDDKVSKSFNVKAIPATYLVDSKGVIISDNLRGAELEAKLKELLKS

    >gi|146299771|ref|YP_001194362.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKSTILKSSLIVLALASVTTSCSKKEGYTINGTIAGLDKGMVYLENTDEKGNKQIADSAQIKEGGTFTFEGKVSEPLLYT
    LKLKGEDYGAFFLLENEDIKIEAKKDSIFKAKISGARQNDIYKSYYDNEFKKIQNIAGPVYKLSDSLTQNGKVKLTAEQQ
    TMMDKKWKDLAAFADDLTDKYIRKNKDKVGAALIINDRIVSYGTPEQVKMYYAVLSPDVQKSIYGKQLKEAIDLNEKTAV
    GVTAPEFSQTDIDGKVVNLSDYKGKYVLVDFWASW
    CGPCRKENPNVVLAYKTYHEKGFDVLGVSLDDKKNLWQKAIEKDG
    LTWTHVSDLKGWQNEAAVLYGVKMVPTNYLIGPDGKIVAKNLREAELQSKLKEIFSKS

    >gi|146299773|ref|YP_001194364.1| cytochrome c biogenesis protein, transmembrane region [Flavobacterium johnsoniae UW101]
    MKNSILTFLLLLSASMFGQMYNPVKWSASVEKISDKEYILKAKAVIQSGWHLYGQYIEEGGPSPTAFTFKNTPKKFELVG
    KTTEEKGHETIDKIFDMKIKYFEDKAFFTQKIKLISDVSSITADVDFMVCDDSNCLPPTTEELTFKIPADKKLAFAEETP
    AVKKDSAVAEDVTFVKAVDKPEKTAVNPVKKEESRGLLSIFIIAFLSGFAALLTPCVFPMIPMTVSYFTKQSKTKAAGIR
    NAMIYGFSIVIIYVLLGSIVTAVFGADSLNALSTNVWFNLIFFVLLVVFACSFLGAFEIMLPNALANKVDSQADRGGLIG
    IFFMALALAIVSFSCTGPIVGTLLVEAASKGGIAPIVGMLGFSIAIALPFSLFAAFPGWLNALPKSGGWLNTVKVVLGFL
    ELALAFKFLSNADLVLQLHWLEREVFLAIWIAVFGALAFYLFGKITLPHDSPLNHISVGRLSFGLIVLTFTIYLIPGLWG
    APLKLISGFPPPMYYSESPDGLGAKNTAETTKSALPEGAEYGPQNIITFHDYDKGMEFAKKAGKPVLLDFTGYA
    CVNCRK
    MEELVWSDAKVLGVLNNDVVLISLYVDDKKELPESEQYVSETTGKKIKTIGNKWSDLQIKTYKANAQPFYVIVDHASNSL
    TETSAYNPDIEEYYKWLQSGIKNFKK

    >gi|146299870|ref|YP_001194461.1| redoxin domain-containing protein [Flavobacterium johnsoniae UW101]
    MASITLGGNPVHTSGELPAVGSKLADFKLVQNDLSVASLSTFAGKKLVLNIFPSVDTGTCATSVRTFNASASGLENTTVL
    CISRDLPFAQKRFCGAEGLENVVNLSDFQTGAFGKANGLEIVDGPLAGLHSRAIIVVDADGTITHTEQVAEIANEPNYEA
    ALAAL

    >gi|146299872|ref|YP_001194463.1| thioredoxin domain-containing protein [Flavobacterium johnsoniae UW101]
    MLIDLNEDTLADLVAKNEKVVVQYSASWCGNCRIMKPKFKKLATENEAVTFVLVDAENSPESRKLANVSNLPTFATFVNG
    QLVGETQTNKQEVLIDLVNAIV

    >gi|146299873|ref|YP_001194464.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MSLVGKKFPSIAVDAISEMGDNLKINIFEEAVNNNKKVLLFWYPKDFTFVCPTELHAFQAALPEFEKRNTIVIGASCDTN
    EVHFAWLNTPKNNGGIEGVTYPILADTNRNLANILGILDIESTSYSEDTDSVIIEGSNVTYRATYLIDETGKIFHESVND
    MPLGRNVNEYLRMVDAYTHIQTKGEVCPANWEAGKEAMSADRISTAEYLSAN

    >gi|146299889|ref|YP_001194480.1| dihydrolipoamide dehydrogenase [Flavobacterium johnsoniae UW101]
    MSSFDVVIIGSGPGGYVSAIRCAQLGFKTAIVEKYNSLGGTCLNVGCIPSKALLSSSHHYAEIAHFADHGIEVSGDVKIN
    LEKMIARKQAVVDQTVGGINYLMEKNKITVFNGLGSFVDATHIAVAKADGTSETIEAKYTVIATGSKPSSLPFIKIDKER
    IITSTEALALKEVPKHLVIIGGGVIGIELGQVYLRLGAQVSVVEFMDRIIPGMDSSLSKELTKVLKKQGMKFYVSHKVKS
    VERNGDAVVVQAENAKGETITLEGDYSLVSVGRRPYTDGLNADKAGVKISDRGQVEVNDHLQTSVPNIYAIGDVVRGAML
    AHKAEEEGVMVAEILAGQKPHIDYNLIPGVVYTWPEVAAVGQTEEQLKAAGVKYKSGSFPFKALGRARASADLDGFVKIL
    ADEKTDEVLGVHMIGARTADLIAEAVTAMEFKASAEDISRMSHAHPTFAEAVKEAALAATENRALHV

    >gi|146299895|ref|YP_001194486.1| cytochrome c biogenesis protein, transmembrane region [Flavobacterium johnsoniae UW101]
    MNFNQNHRAILSRSIWNKITAFLLLFFFTLAGNAQILEPVKWTSKIEKKGNNAVLIFDGTIEKDWHMYSQFTPDGGPLAL
    EISFKNQKGNYELVGKAKEGKTRTAYNDVFGVDETFFEGKAHIEQEIKIINPNLKTVDVDFDFQVCKEVCINSSKKFSIA
    VPSTFKIDEALPVVSEAKLDETKTAALAVDTIKKETAAAEDQTVKAENEAKEDIPAPAPARSLWSIFFIAFLSGFAALLT
    PCVFPMIPMTVSFFTKQSKSRAKGIRNAIIYGLSIIAIYVILGLIVTKIFGADALNALSTDVWFNLIFFVILIIFATSFL
    GAFEIMLPNSWANKADQQADKGGLIGILFMALALAIVSFSCTGPIVGTLLVEAASNGGIAPVVGMLGFSSALALPFMLFA
    MFPGWLNSLPKSGGWLNTVKVVLGFLELALAFKFLSNADLVLQLHFLEREVFIAIWIAIFGALTLYLFGKITLPHDSPTH
    HISVGRLYLGLLTLVFTMYLIPGLWGAPLKLISAFPPPPQYSESPFGVGGSGNGAVSSESIKGLPEGAELGPHGIMVFHD
    YEDGLAYAKEIKKPIMLDFTGYA
    CVNCRKMENNVWSEPTILPILKNDVVLISLYVDDKRELPKEEQFVTKSADKIITVGD
    KWTDFMISKYKTNTQPLYVITDLEGNNLNASKPTISYVSADEYLHWLKEGISNFK

    >gi|146299950|ref|YP_001194541.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MARTPSNMIPLGTIAPEFYLKDTNSNNVYSFEDLKGSKGTLVIFMCNHCPFVLHVINEIVMIANDYRVQGLGIIAISSND
    IIKYPEDSPELMTDFALQHKIDFPYLFDETQETAKAYEAACTPDFYLFDNQNKLFYRGQLDDSRPGNGIPLSGTDLRNAI
    DALIYNRILNEIQKPSIGCNIKWK

    >gi|146300078|ref|YP_001194669.1| periplasmic binding protein [Flavobacterium johnsoniae UW101]
    MKQLKDQLGALHSFETAPKRIISLVPSQTELLYDLGLEEKIIGITKFCVHPFHFKSTKKIVGGTKKIHFEKIKLLEPDII
    ICNKEENTEEIVNQLKEI
    CPVWVTNIISIEDNFQMISDFGQLFNCRTEAQKWNDKLTFALSDFKKYIQDIEIKKAAYFIW
    KDPYMVAGNDTYINELLKLNHFKNIYEDKGRYPEIELKKMRLEGDPDIVFLSSEPYPFKEEDAFEIGRFTHHAKTIFVDG
    EMFSWHGSRLLKAFSYFKLLHERLKN

    >gi|146300195|ref|YP_001194786.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MTTLKAGDKAPNFSGTDQDGKTHKLADYAGKKLVVFFYPKASTPGCTAEACDLRDNFERFKANNYELLGVSADSQKAQSK
    FKDKYEFPFPLIADEDKAVINAFGVWGPKKFMGKEYDGIHRTTFVIDEKGIIEEVIEKVKTKEHASQILK

    >gi|146300239|ref|YP_001194830.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MNDLAHQIETLNIELLKQVPQEILGAFQKSIQDLKSLNIEINSLKVGDKIPDFSLKNAVNDTITSDCILRNGKMIIAFYR
    GSW
    CPYCNLELRTLQENLLRITAKNTTLVAISPQSSDNSLTLKEKHNLQFEVLTDLHNAYAKQLGITFQLQDFVIPHYQT
    LGINLEDFNKDQENTLPVPAVFAVNENGIIIYKFLDVNYMNRIDIEELINVL

    >gi|146300291|ref|YP_001194882.1| copper-exporting ATPase [Flavobacterium johnsoniae UW101]
    MSEQSCFHCGLEIPKDEEINFDEKTFCCTGCKTVYEIFSLNDLTCYYDFEKSPGATPQDIKGKYDFLDNESILAKVLEFQ
    ESNTSIVSLNIPHIH
    CSSCIWILENLNRLNSGISSSQVNFPEKRVRITFNSEIVSLKEIAYLLSSIGYEPYISLENYETG
    KTKVDRSLTYKLGVAFFCFGNIMLLSFPEYFEMKEFWLDSYKPFFRLLIFVLALPSFFYSASGYYVSAYKSIKSGMLNID
    IPIALGIIVMFIRSTYDMLMDHGPGFFDSLASLVFFMLLGKMFQIKTYSFLSFERDFKSYFPIAVTRINSDASEESVPIY
    DVLKGNRLLIRNQELIPVDGILISEKAEIDYSFVTGEAVPITKKSGDKVFAGGKQIGKVIEMEVLHSVSQSYLTQLWSNE
    VFQKKVQQKHKTITDAISRYFTPILLLIAFAGFGYWIFIDANTAFNVFTAVLIVACPCALALTAPFTFGNILRIMGKQKM
    YLKNALVIEQLDKVDTIVFDKTGTITTNKKSNIIYEGTNISDDNYLLIKNVLRGSNHPLSRMLYDFLPENKRIKIDDFQE
    ITGKGILAVVEGKEIKIGSSSFVESPVAEVSEIERTALHIKIDNLYLGKFVFQNQYREGLEKLFATLSKEYNIKVLSGDN
    DGERNTLEEILPNNTELVFNQKPEQKLEFIKGLQSQGKNVMMVGDGLNDAGALAQSNVGISVSENVNVFSPACDAILDAG
    VFSKLNYFLKLSHKSILIIKMSFTLSLLYNVVGLAFAVTGNLNPLVAAIIMPLSTITIVSFVTIMSNYFSKSNLD

    >gi|146300307|ref|YP_001194898.1| methionine-R-sulfoxide reductase [Flavobacterium johnsoniae UW101]
    MIKWADVIHFTNKGNPTPDKRVEKTEEEWKQLLTPEEYQVTRLKGTERSFSSEMCSLFDPGIYECKCCGTVLFDASEKFE
    SGTGWPSFTQPIKENAIGYHADKSYGMIRVEVVCNVCDAHLGHVFPDGPPPTGLRY
    CINAISLSKIKE

    >gi|146300341|ref|YP_001194932.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MKFTRKANANWKGTGMEGKGTISTQSTTLDNAQLSFKTRFADGVGTNPEELVAAAHSGCFTMQLSFLLNEAGFTADDLST
    EATVTFEDGSITLIHLDLKGKVPSISAEEFEKTAAKAKEI
    CPISKLLNTTITLSASLVS

    >gi|146300378|ref|YP_001194969.1| rhodanese domain-containing protein [Flavobacterium johnsoniae UW101]
    MAVKLSSIINTDELLKLNPSEIILIDARAGINAEENYNKEHLKGARYVDLNKDLAAVEDPANGGRHPLPSFSKFSEVLSK
    LGISPSSHIIIYDDKNASNAASRFWWMLRAAGHEKVQVVNGGLQEAVKAGFPVSSEIETFEAAEKYPVSEWKLKTADIEE
    VEKVRNNSENIVIDVRDKNRFDGLTEPLDLIAGHIPGAVNVPFSENLDENGLFKPAEILAEKYNSVLKNKPSENIIVH
    CG
    SGVTACHTLLAMDYAGIEIPKLYVGSWSEWSRNDREMATKERQ

    >gi|146300468|ref|YP_001195059.1| DSBA oxidoreductase [Flavobacterium johnsoniae UW101]
    MKIEIWSDIMCPFCYIGKRQLETALQQFPDNDFEIEWKSFQLDPTITPEPGKDVYTYLAERKGMTVEQSKEMHKGVAERA
    KSVGLEYNFDKAVISNSLEAHRIIQLAKTKKLGDEIEEIFFKAYFTEGRDLNDGPTLIELAEKAGLDKNDVLEVLKSDNL
    YLKEVEHDIEEAQQIGVQGVPFFVFDRKYAVSGAQPVEAFVQTIKEGLK

    >gi|146300530|ref|YP_001195121.1| thioredoxin-related protein-like protein [Flavobacterium johnsoniae UW101]
    MRFLYLLFLFVSLQAVQAQNQFSVEGISYKTALENAKTEGKPVFVMLYADWCPHCNQMKKEVFSDQKVMDFLNKNYVCVW
    KNIEKEEGIALKNKFKTTSLPSFLFLDSNETLLYALKGEMKTPEFLAEAGYALNPKFQLPNLEKDFLADTGNATKFFNYL
    NTLKKGKDRTELSIPTHIYLQTKSDEQLISETNWRVIANGVTDINSREFQYVLKHQKEFVAVASQNRVDRKIESIVNELL
    RPLVDNLDTINYYKQREVAKSIKLQKTDSIVFKYDLTLAERTEKWNFYKKVTLEDTEKLAWNDASFLKEIGQTYLKHIDD
    KESLKKSISWVQHSLELNDSYDGTLLVSKLYNKIKDKKSALKYAKDAKAIGKEMGWNTKDVDALLAELNSK

    >gi|146300543|ref|YP_001195134.1| hypothetical protein Fjoh_2793 [Flavobacterium johnsoniae UW101]
    MKNLKINNRFTAELPADPDLTNETRQVKNTAFSYVNPTKPSNPKLIHASEETAALVGISKEEIHSEEFLNVFSGKEILPE
    TQPYAMCYAGHQFGNWAGQLGDGRAINLTEVENNNTFYTLQLKGAGKTPYSRTADGLAVLRSSIREYLCAEAMYHLGVPT
    TRSLSLILSGDQVLRDILYNGNPAYEKGAVVCRVAPSFIRFGSFEMLAARNELKNLKQFVEYTIKHYFPEITGEPKEQYL
    QFFKKVADTTREMILHWQRVGFVHGVMNTDNMSVHGITIDYGPYGWLENYDPNWTPNTTDSQNKRYRFGNQPQVAHWNLY
    QLANAIYPLINETEGLEKILESFMDDFILDYKEMFLNKLGLFTSTETDNDLIDNLEAVLQLTETDMTIFFRNLSSVKKTD
    SVEKAIEKIQFAFYKIEEVSGEILDAWKKWFSVYLDRLNAEVLSDEVRLQKMNLINPKYVLRNYMAQLAIDAADKEDYSL
    VNELYTLLQKPYDEQPEYQKWFAKRPDWATSKVG
    CSMLSCSS

    >gi|146300544|ref|YP_001195135.1| peptide methionine sulfoxide reductase [Flavobacterium johnsoniae UW101]
    MGNLSTATFGGGCFWCVEAVIQRLKGVEIIKSGYSDGFIKNPAYREVCTGRTGHAEVIQVTFDSDIISYHDLLTVFMTSH
    DPTTLNRQGGDSGTQYRSIILYHDEAQKEIAEKVFEEVQPVYADQIVTQLKPFEVFYEAEDYHQNYYNNNQEAGYCQFVI
    DPKVQKLKKMYADKLIS

    >gi|146300693|ref|YP_001195284.1| glutathione peroxidase [Flavobacterium johnsoniae UW101]
    MKKILFIACSAIFFISAQAEAQTSKNKLSKSDKAMAKETIYQFKVEDLSGDTFDFASLKGKKILIVNTASKCGLTPQYKD
    LEAVYKEYKDKGFVIVGFPANNFASQEPGTNKEIETFCQQNYGVTFPMMNKVSVKGDDMCDVYKFLTQKSKNGLQDSEVE
    WNFQKYLINEKGELVKVIKPRTLVTEPEVINWIKS

    >gi|146300834|ref|YP_001195425.1| heavy metal transport/detoxification protein [Flavobacterium johnsoniae UW101]
    MKTENKMIGAGFFTALAASLCCITPILALVAGTSGIASAFSWLEPMRPYFIGLTVIIIGLSWYQKLKTKKLIDCNCDREE
    NTKFVNSKMFLVIITVFAALLLSFPYYSSIFYPNTEKKVLVVKKTSTQKAEFRISGMT
    CASCEKHVNHEVNKLIGIINSN
    VNYTNGNAIVEFDNSKTTINEIEKAINSTGYTVTNKKLK

    >gi|146301125|ref|YP_001195716.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKKTLLVLGFLCCVITSSKAQVVGTDIGDIAPEIDLPDTKGNNEVLSSLRGSLTLIDFWASWCGPCIKEQPLLQKLYAAY
    PDKFSIYSVSMDTKKPLWLAAIAKGKLPWIQVSDLKYWKSPVVGDYMLQSVPLNFLVDKNGIIIAKNIHGKELEDKVNSL
    LAIQ

    >gi|146301233|ref|YP_001195824.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MDTISAKIDTRLYRTEITSASGNVLISDEPQQLGGKNLGLNPTELLASSLASCTLITLRMYINRKQWNVEEINIKIDFER
    DSERNCTSFTRKIEVIGEIDDTQRQRLETIANS
    CPIHKTLTHSIEIKTTLI

    >gi|146301245|ref|YP_001195836.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKQIALIFIAFITFSCSQAQKTSFSKEALSEKLLTLDGGQVTFKNILKKYKGKTLVIEVWASWCGDCVKAMPKLKELQAN
    NPDVSYLFLSADKTADKWKAGIEKHELKGDHFMMNDGMKGVFGKAIDLDWIPRYIVIDKTGKIVLYRAIETDFDKINETL
    KSLK

    >gi|146301475|ref|YP_001196066.1| alkylhydroperoxidase [Flavobacterium johnsoniae UW101]
    MQKRLNIKQAAPDALKAMIGLESYLSKISISKTAKELIKIRASQINGCAYCINIHTQDAVKNGETNQRIFLLSAWREAGD
    IFTEEEKAVLAITEEITLIHQQGLSDQTYSSAVHFFSEKQIADIITAVITINLWNRVVLSTRLPIGQSLA

    >gi|146301496|ref|YP_001196087.1| hypothetical protein Fjoh_3757 [Flavobacterium johnsoniae UW101]
    MKLITLLLLVTVLPINWEPDFNNAKKTAKEKHELILLNFSGSDWCGPCIATRRDYFENPAFTAMADQNLVLVNADFPRKK
    KNTGTPEQVKRNEALAEIYNKEGSFPLTLLLDAEGRVIKTWHGKPEKTPEEWTAEIKAICDSRK

    >gi|146301532|ref|YP_001196123.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MFKPALLLFLVSISLSAQKLGNRTAFELRGAGKGLSIDKIYLVYEVGDKRIYDSVKIDNSKFILKGNIDYPIRATLCNNR
    EFSMSKSNSIELFLEPAIMEIKLDFYDFSTAEMKGSKTQDEYSQLQKVKNVVFSKRDSISLLIRSYFDRITAASDPQIKL
    ELEHQLEILEKLSDENKIAEMEIDFNFIRQNPSSFTAPSLLYYRLAKKEGLLHSETIISLADGLSKEVKESPLGVRLFKR
    ISDFKNSKVGSIAPDFILKDYNGQIVSLGSFREKKYVLIDFWASW
    CGPCRQDLPFLKDAYEKYKDMGFEIISISRDNNLN
    SWRKAIVDEKIGFWKHISVAENQTKMEDNYLVTAIPVKILINKRGEIIRRWKGGGDENKMQLKKILEETFDRD

    >gi|146301681|ref|YP_001196272.1| redoxin domain-containing protein [Flavobacterium johnsoniae UW101]
    MLKKIINIKLLVLVFCAFTLQVTSQETKLRLTGMADVPIPGAVLKMTYDAKGGPLENIKDINGYAYVFNDYRWEIEDLKM
    KKNGAVWNVEFTVPKNCAFMAFKFYGNTDNGLVTDTGQDTGYLLVAFKEPKVKMPGADLAWATFRNKDFNGQFGGYFKEF
    TINGDATEYWLKKEVADNGNRFPEFFDTYFKVLKVQKPEKFQELGSRFLGDFTKNMKGMPEEVYLKVHNIYAYELKDKAK
    ADSIENVIVKQFPKGAFLRFKAYQKIMPIADAAERNKVITQFLADFPYTTDVPDSQKYFYDNIVKMQFGYYFENKDYKSV
    LALIPTMNFANLNDAYHQNISKALYLKVVDPAVIETMAVPMIKLMQEKVNDMSYMQGIYWSPNQATENAKTQLNNELVIQ
    IRMYDMLKKYKEVLETFELLPFQKRYEKASINDIHVRALEALNKPITEVLKNAAKANTLSEGLTAKLKEAFIKEGKKEAD
    FPAYLEQLKKENNSEEKITLMNPVPAPAIKVQSADGKTKELVLNSGKIIVIDFWATW
    CGPCKKAFPAMQQLVNNFKEDKQ
    VEIYFISTQETKEGYKKEAAAYLKEKGLKLDTYFDLVKKGGGTNNASFSNYAAIFKSSGIPRKVVIKNGQIRFTSEGYSG
    NPGQLVDELTNVINALKNE

    >gi|146301729|ref|YP_001196320.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKKILLGFALFLGAVQTQAQESNLQLKGTVVDTVAQYVYLQKFHNKMFTTIDSVKVKDGNFSFKTKVKTPELYGLSVNTE
    SSPLYIFLEKEPITVKLSPKKYYTASVVEGSASQDLFETYKKSKDAEISKFITEHPKSIVSAYVLYRNWSYRLTPEQITQ
    NIALLDKSLQNTTYVKELKELAVVLDGLAVGKKAPDFTANDPNGKPVRLYDNLKGYTLVDFWASW
    CGPCRRENPNIVAAY
    KEFHDKGFNIVGISLDKKKENWIKGIQDDNLTWTHVSDLLFWNSAVAKLYGVGAIPGNYLVDSKGIIVAKNLHGEELQST
    LKSLLESKI

    >gi|146301742|ref|YP_001196333.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MSTKVLYTGKTHTTGGREGASQSSDEQLNIKLSAPGLSRPGTNPEQLFAAGWSACFIGALGIAASKLGVRLPAETAVDAE
    VDLCVTDGEYSLQARLNISLPGIDLETAETLASQAHHT
    CPYSKATRGNINVEINIL

    >gi|146301764|ref|YP_001196355.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MKFTRRANANWKGTGMEGKGTISTQSTTLDNAQLSFKTRFEQGVGTNPEELIAAAHSGCFTMQLSFLLSEAGFVPEDLDT
    TAKVTFEDGTITLIQLELTGKVPGISEEDFQKTAQKAKEI
    CPISKLLNTEITLAVTLN

    >gi|146301880|ref|YP_001196471.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacterium johnsoniae UW101]
    MKKIILLLTLAFSAFLAQAQTGTTLKAGDTAPDFKLKNVDNKEVSFGTFKDAKGYIVVFTCNTCPYAVGYEQRIIDLDKK
    IKPQGYPVIAINPNDPEASTADTFSKMQDLAKEKKYPFPYLFDPGQKITDEYGAKRTQHVFIVSKTAKGNVVEYVGAIDN
    DPEGTKADKVKYAEDVIASLKTGQKPAVTQTKEIGCTVKRKAKA

    >gi|146301881|ref|YP_001196472.1| redoxin domain-containing protein [Flavobacterium johnsoniae UW101]
    MKIKSFLYLFLFGVFSISAYSQNVKLLNIDQLNERIKNGKDSTYVVNFWATWCAPCIKELPHFEKLSAEHKSEKLAVLLV
    SLDFKSKLASNVVPFVKRKNLKNEVFLLNESSPQEFIDRIDPNWSGSIPATLFIKNDKRKFVESEFTYEQLLTEYKKL

    >gi|146302195|ref|YP_001196786.1| hypothetical protein Fjoh_4466 [Flavobacterium johnsoniae UW101]
    MKKILLILHVMVMSHAFGQTAIENAKQQAKEQHRLILLNFSGSDWCVPCIKMHKTIFENGTYKQMADSLLVYVNADFPRK
    KKNQPLSQTIKENEALADKYNPGGAFPFTLLLDADGKIIKTWEGLPKEGVDGFTNEIITLYKKVKK

    >gi|146302278|ref|YP_001196869.1| redoxin domain-containing protein [Flavobacterium johnsoniae UW101]
    MQKFISLITLLLIFTISTAQNKFGNPEVDPIQIQKTFQDWSAYNKKIMLSRDFTALDASSKEISKESFLDQLANGNFIPV
    RLKSEAAIYIYKLFKIQPKSDTSIKATINQIGFDAYKNYKMEGTAFPKFSFKDLDGNLVTNESMKGKIIVIKCWYIH
    CTP
    CIREFPQVNKLVSAYKDRKDIVFMSLAEDSPEQLKTFLARKPLLYSVIPNMKDYMNEALQLNSFPTHFILNKEGMIAKVL
    PNFESLEVALAKESKL

    >gi|146302366|ref|YP_001196957.1| UBA/THIF-type NAD/FAD binding protein [Flavobacterium johnsoniae UW101]
    METSNRYNRQMILPEIGEGGQDKLAKAKVLVIGAGGLGAAILPYLAAAGVGEIGIVDDDVIEISNLHRQVIYKSSAVGKS
    KAKEAKQMISELNPLVKVKAISEKLSGKNVLSLFEKYDIVVDATDSISIKYLINDACLVTNKPMVYGSIFRFQGQVSVFN
    YENGPTYRCLYPDENSNALN
    CEDAGVIGVSVGIIGMFQANEVLKMILGIGEVLSGKILVYNVLNNEQQKYDFDKSDFQPI
    SRETFEEKYNKWEVEEVRFESVLDEINQDEVLFLDVRNIDESPKITLQNQFQIPLMHLEKEIEKLNKNQTIYIF
    CQSGIR
    SKIAVELLQKHQFKNVKSIAGGALAMKQLLQEIKI

    >gi|146302376|ref|YP_001196967.1| rhodanese domain-containing protein [Flavobacterium johnsoniae UW101]
    MKNNKIKNSITALILLFAITAFSQNKSSNTVSLDIFYSKIQAEKKPQIIDARGPEEFALNHINGAVNFNLESKNYAEQVA
    KLDKSKPVFTYSIGAGRSVWLADELLKNGFKEAYSLEGGIANWIGNGKPFYASSKSKLTLTEYTKIVADNKTVLVDIGSK
    Y
    CSACTKVKPVLETIKTQYGENLKIVEIDLETSPQVIADLKTIKVFPTLILYQNGKIVFKKDGFNDLKKDVDVALASK

    >gi|146302403|ref|YP_001196994.1| dihydrolipoamide dehydrogenase [Flavobacterium johnsoniae UW101]
    MKYDVIVLGSGPGGYVTAIRASQLGFKVAVVEKENLGGVCLNWGCIPTKALLKSAQVFDYLKHASDYGLKVSEFDKDFPA
    VIQRSRGVAEGMSKGVQFLMKKNKIDVIEGFGKLKPGKKLDVTDKDNKVTEYSADHIIIATGARSRELPNLPQDGVKVIG
    YRQAMTLPTQPKSMIIVGSGAIGVEFAHFYNSMGTDVTIVEFMPNIVPVEDEDVSKQMERSMKKAGVKIMTNSSVEKIDT
    TGNGVKATVKTAKGEEILEADIVLSAVGIKTNIENIGLEEVGIAVDRDKILVNAYNETNIPGYYAIGDVTPGQALAHVAS
    AEGINCVEKIKGLHVDPIDYGNIPGCTYATPEIASVGLTEKQARDKGYELKIGKFPFSASGKAKAAGAADGFVKVIFDAK
    YGEWLGCHMIGAGVTDMIAEAVVARKLETTGHEVLKSIHPHPTMSEAVMEAVADAYGEVIHL

    >gi|146302511|ref|YP_001197102.1| arsenate reductase [Flavobacterium johnsoniae UW101]
    MIQIYHNPRCGKSRNCLAFVEDTKQEYEIIPYLTETPSFDDLKELLKKLNLKPAELVRTKEKIWIENYKGKNLTEDETIQ
    AMVDNPILIERPIVVKDGKAIIGRDLDKVASFLD

    >gi|146302597|ref|YP_001197188.1| rhodanese domain-containing protein [Flavobacterium johnsoniae UW101]
    MNLSQEDWVNQLAADENAVILDVRTEDEFNDGYIENALNIDINKGQAFIYEIEELDKNKNYYVYCRSGARSAKACQIMNE
    LGIENAYNLLGGILDWEGETVQP

    >gi|146302608|ref|YP_001197199.1| beta-lactamase domain-containing protein [Flavobacterium johnsoniae UW101]
    MKIEQIYTGCLAQGAYYITSNGEAAIIDPLREIQPYLDRLERDGVKLQYIFETHFHADFVSGHVDLSKETGAPIVYGPNA
    ACEFDCISAKDGQEFKVGKVTIKVLHTPGHTMESTTFLLIDENGKDHAIFSGDTLFIGDVGRPDLAQKASGMTQDQLAGI
    LFHSLRDKIMTLADDVIVYPAHGAGSACGKNMSKETVSTIGNQKATNYALRADMTEAEFIKEVTDGLLPPPAYFSMNVAM
    NKQGYESFETVLHNGMKSIKAEEFEAVAEETGALILDTRKSGDFAKGFIPQSINIGINGDFAPWVGTLIGDVKQPIILVT
    EAGLEEETVTRLSRVGFDSIIGHLEGGFEAWEKAGFEIDTVNRISAEEFAGKFNIKEDKVIDVRKETEYEAEHIEDAYSK
    PLAYINDWVKDINPNEHFFLH
    CAGGYRSMIAASILQARGFRNFSEVDGGFGAISKTNIPKSDFVCQSKILK

    >gi|146302695|ref|YP_001197286.1| hypothetical protein Fjoh_4968 [Flavobacterium johnsoniae UW101]
    MKIIKISMLALALGLMSFSAIAPVQSIVNEKEIEGTTASTIVWKAETIDVGQIPQGTPKAIVYEFKNTGKTSVVITQVQG
    S
    CGCTATDYIKEPILPGKSAKVTATYNAANKGAFTKTVTVTTSAETAPKILTLKGTVI

    >gi|146302744|ref|YP_001197335.1| peroxidase [Flavobacterium johnsoniae UW101]
    MSTLRLGDIAPDFHAETTQGPINFHEWLGDSWGVLFSHPADFTPVCTTELGTVANYVPEFTKRNTKVIALSVDGLDSHKE
    WIKDINETQNTEVNFPIIADEDKKVANLYDMLHPNASDKFTVRSVFVIGPDKKIKLTLTYPASTGRNFDELLRVIDSLQL
    TANYSVATPANWKDGEDVVIAPAIPDSDIPAKFPKGHKPIKPYLRLTPQPNK

    >gi|146300135|ref|YP_001194726.1| OsmC family protein [Flavobacterium johnsoniae UW101]
    MTSKVTYLGDLRTKSIHIQSGSEIISDAPLDNNGKGEAFSPTDTVANALASCMMTIMGIKARDLEVDFTGSTAEVTKIMN
    AEPRRIGAIEIVFQMKSNADEKSKTILERAAMT
    CPVFLSLSSEIEKNVTFNWE

    >gi|146298334|ref|YP_001192925.1| hypothetical protein Fjoh_0571 [Flavobacterium johnsoniae UW101]
    MKSTVAKALFNSYSYAEYRKLVTDLLSEGKSTGSQQSESLTNYSKLNEARMNRLEKTITISEVAISKLRHLDNHYIWLVI
    SEGW
    CGDAAQILPILNKMAHESDKKIDLRIVLRDENDELMNQYLTNNGRAIPKVIVICKEAGIVRADWGPRPKGATELME
    THKREVGPIDEKIKTDLQLWYLADKGISVQSELVEIMENIKYNRL