Flavobacteriales bacterium HTCC2170 uid51877

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|305664403|ref|YP_003860690.1| rhodanese-like domain protein [Flavobacteriales bacterium HTCC2170]
    MADITQEEWRTKLKADSNAFVLDVRTKAEIEEGYIANAINIDIYLGQGFLQELDKLDKTKNYYVYCRSGNRSRQACAVMK
    SIGFENTYNLEGGMMAWQGEVEQ

    >gi|305664443|ref|YP_003860730.1| hypothetical protein FB2170_16466 [Flavobacteriales bacterium HTCC2170]
    MMKKIVLVLFVGLLGFSLTAQDTAAKIEFKTETVDYGEITKGSDGVRVFEFTNTGDAPLIISKVSSSCGCTIPKKPEAPI
    LPGKTGEIQVKYDTNRVGPIRKAVTVISNADTPTKVLKIKGEVKANVEGTK

    >gi|305664490|ref|YP_003860777.1| NADH:ubiquinone oxidoreductase, Na translocating, E subunit [Flavobacteriales bacterium HTCC2170]
    MLEHIELFFRSIFIDNMVFAVFLGMCSYLAVSKKVATAVGLGAAVIFVLAVTVPLNWLLDQYLLRDGALAWLGPEYADYN
    LSFLSFILFIATIATMVQLVEIVVEKFSPSLYNSLGIFLPLIAVN
    CAILGGSLFMQSREIASLGLAFNYGVSSGIGWFLA
    ILAIAAIREKIRYSNVPAPLRGLGITFIITGLMGIGFQSFGGMLTGGGEEAAPVKEKTTAEKLEKVDKKENNKEIDEKEI
    SYNDAINK

    >gi|305664491|ref|YP_003860778.1| NADH-ubiquinone oxidoreductase [Flavobacteriales bacterium HTCC2170]
    MALLSKKDANLILDPLADNNPITIQVLGICSALAITAELKASVVMAISVLFVLGIGNVVISLMRNIIPSKIRIIVQLIVV
    ATLVIIVDQVLKAFAYELSKTLSVFVGLIITN
    CIIMGRFEAFALANGPWKSFLDGIGNSLGYGVILIIVGFFRELLGSGT
    LFGYPVLGNPITKTGLYATGYENNGFMIIPPAALIVVGIIIWIQRSRNKALIEDN

    >gi|305664668|ref|YP_003860955.1| probable Mip protein [Flavobacteriales bacterium HTCC2170]
    MNTLNPLKEEEANENSKAIFSNLKSKIGMVPNLYATMGVSDKLLGGYLTFVDTLKSGEFSNKEYEAIALATSQANNCAYC
    LSAHTAIGKMNGFSEEETLELRSNSIADNKLNVLVTLVSEFIESKGHPTENTTSRFFEVGYTKAAFAELIAAISMTTITN
    YVYHNGGFEIDFPKAQGIENLQTV

    >gi|305664701|ref|YP_003860988.1| hypothetical protein FB2170_00310 [Flavobacteriales bacterium HTCC2170]
    MSKLNIESKKVENAKPIASEILKNTNKTMGFIPNMYSGMANNPALLDAYVHSYKTFRQNSGFNSIEQEIIFLSVAYENEC
    DY
    CMAAHSFVADKASKVPAEITEAIRSNGIINDKKLKALSSIARLVTKNRGHISREEINSFLDSGYTENHVLGVITGVGV
    KTFSNYFNHVAETKLDTPFKSRAWSKTIK

    >gi|305664737|ref|YP_003861024.1| thioredoxin, putative [Flavobacteriales bacterium HTCC2170]
    MKLGKKQWLNIALLIGVGLFLFTPVGFHARVFVGRLLSTSASVIKPELQMPIENYDWQLVNDKGQNFNFKSTKNKVVVIN
    FWATW
    CPPCIAEMPSFQNLYDDYSDKVDFMFVAKDKAEKVSAFMIKKDYNLPVYYSKDEAPSLLTSKTIPTTYVLDKEGR
    IVVAETGVADWNSNKIRKLLDELIRK

    >gi|305664738|ref|YP_003861025.1| thiol:disulfide interchange protein tlpA [Flavobacteriales bacterium HTCC2170]
    MMIISKKTLLNILLIAFVLAFFVTPLGHFGKVFLNQIFAGTPVIIEESSRQQLQSYNWKLKDPNWDYFNLDRSKGKVLFV
    NFWASWRLP
    CEAELKGIQKLYNDYGDKVDFYIITNEEKAPVEEFMRLKKFDFPLTYLIIGEPAPFEILEPPASYIIDKNG
    FIVVKEKDIASWDTGKIRELLDNLIK

    >gi|305664772|ref|YP_003861059.1| peptide methionine sulfoxide reductase [Flavobacteriales bacterium HTCC2170]
    MAVSKFKNHQQSLKLKSSMYKITLLAFAILFSISCESKVKNSIKDTAKSNVEKPVKLSLNDLQEYEVAYFASGCFWCVEA
    IYEDVIGVKEVISGYSGGTESNPTYEQVGRGLTSHAEAVKVFYNPKEIDFKTLVKVFFGSHDPTTLNRQGPDHGPQYRSI
    AFYSNESEKKIIEEYIAQLKNEEVYSSPIVTQVEKFVKFYDAEDYHQDYERLNPNNPYIINISIPRYKRFQAKYPELMKK
    SGH

    >gi|305664830|ref|YP_003861117.1| hypothetical protein FB2170_00955 [Flavobacteriales bacterium HTCC2170]
    MKQNVSFIKKFSIFLFVGLISATVYGQDVKWLSWNEAVELTKTEKNPKKVFIDVYTDWCGWCKKMDKDTFQNPEVATYMA
    ANFYMVKMDGEGKEPIDYNGKTFKFIPSGRKGYHELAAALMQGKLSYPTTIFLDEKMNMLSPVPGYQKPDPFLNIARYFG
    DDIYLEKDWKTYSGQGK

    >gi|305664844|ref|YP_003861131.1| hypothetical protein FB2170_01025 [Flavobacteriales bacterium HTCC2170]
    MKRAILGLSLLSMMAFVSCKENASSKVKTDNVAVAAERDEASKQIPVMEFEKSEHDFGTIEQGTPQETVFTFTNTGNAPL
    VITNATSS
    CGCTVPNPPKDPIAPGAKGELLVKFNGAGQNQVTKTITVIANTAKGSEMLKIKAFVNPKGAAPLGPVK

    >gi|305664852|ref|YP_003861139.1| hypothetical protein FB2170_01065 [Flavobacteriales bacterium HTCC2170]
    MANTPSNMLPLGTKAPAFDLMDTVSGKILSLSSLKGEKGTVIMFICNHCPFVIHINPEISKMAKTYQEVGISFVAISSND
    VVNYPQDAPHLMKQTAITEGYIFPYLYDESQEVAISYEAACTPDIYLFDDNLNLFYRGQLDDSRPGNGLPVTGKDLRSAI
    EALIHGKEANTIQKPSIGCNIKWFKK

    >gi|305664854|ref|YP_003861141.1| Peroxidase [Flavobacteriales bacterium HTCC2170]
    MATIRLGDNAPDFTADSSMGTINFYDYLGESWGILFSHPADFTPVCTTELGTAAKFKDEFDKRNVKMLALSVDGADSHNE
    WIKDINEVQHTTVNFPIIADEDKKVSDMYDMIHPKADNNLTVRSVFIIAPDKTVKLMLTYPASTGRNFYELLRVVDSLQL
    TAYHKVATPANWEHGQDVVVSPAIPTNEAREMFDKGVEEIKPYLRMTPDPTS

    >gi|305664899|ref|YP_003861186.1| putative thioredoxin disulfide isomerase [Flavobacteriales bacterium HTCC2170]
    MKKLTFILVMLCSIVGAAQNWESSFEQALLLSKQEKKPIILVFSGSDWCAPCIKLERDIWQSEEFKTYADEHYVLYKADF
    PRKKVNRLSDEIKGQNDKLAKKYNPNGHFPLVTVLNSNEEVLGNTGYKKLSPDQYMSLLNSFVK

    >gi|305664940|ref|YP_003861227.1| putative peptide methionine sulfoxide reductase MsrA [Flavobacteriales bacterium HTCC2170]
    MHQFRIASSKRRITRIRMRELTKIAFGGGCHWCTEAVFQSLIGVVNVEQGYVASYGEHGSFSEAVIVLFNDEVITLQILI
    EVHLHTHKSTSEHSMREKYRSAIYTFSKEQSQEAKNILQKFQYEFDHQLVTKVYPFSEFKASSEAIQNYHQKNPEKPFCK
    KYINPKLIFIRDKFSNQVNKNFIITN

    >gi|305664957|ref|YP_003861244.1| hypothetical protein FB2170_01597 [Flavobacteriales bacterium HTCC2170]
    MEYILQPWPWYVSGPLITLVMLLMFYFGKTFGMSSNLRTLCSIGGAGKYADFFKFDWKAQRWNLVVVLGAIIGGFVAVQF
    LSDGSTIQVSDATIQDLNALGFNNVGENILPSELYSWDAVLSLKGISILVIAGFLVGFGTRYAGG
    CTSGHAISGLSNLQK
    PSLIAVIGFFIGGLIMTHFILPLIFTA

    >gi|305665049|ref|YP_003861336.1| thiol:disulfide interchange protein tlpA [Flavobacteriales bacterium HTCC2170]
    MGMLNSCKDADKKSTTVVRMDKSIEEAVVSSNGYEDLEGNPVDLSDYKGKRILLNFWATWCRPCVEEMPSLLKAEEILEK
    ENYVVLLATDQSVKIINSFKERKGFEFTYIRYTGAFADLGIKALPKTFVYNEEGKKVDEISGALEWDSPETIERLKSLD

    >gi|305665066|ref|YP_003861353.1| metallo-beta-lactamase superfamily protein [Flavobacteriales bacterium HTCC2170]
    MNIEQIYTGCLAQGAYYIESNGEVAIIDPLREVEPYIERARTDNAKIKYIFETHFHADFVSGHVTLSRQTGAPIIYGPTA
    NPSFEAIIAEDNQEFKLGELTIKVLHTPGHTMESTTYLLKDEEGKDHAIFSGDTLFLGDVGRPDLAQKAANMTQEDLAGI
    LFDSLRTKIMPLANDIIVYPAHGAGSACGKNMMKETVDTLGNQKKMNYALRTDMTRQEFIDEVTEGLLPPPKYFPLNVKM
    NKEGYEDIDDVLKRGNVALSPEAFEAVANETGALVLDVRHQNEFVKGHIPRSIFIGLNGDFAPWVGALIADVKQPILLVA
    PTGKENETVIRLSRVGFDGTLGYLKGGFDSWKEAGKEDDTITSLSATEVKEQINKKGISVFDVRKESEYKSEHVIDALNT
    PLDVINKHLAEFPKEQEFLVH
    CAGGYRSVIAASILKSRGIHNFIDVAEGFKAIKTAGIEVTNYVCPTTL

    >gi|305665168|ref|YP_003861455.1| hypothetical protein FB2170_02675 [Flavobacteriales bacterium HTCC2170]
    MRKYIILPLLLLFAVGCSQIKEKHITEVSQEELDKVVLVDVRTPKEYSQGHLENSILIDWMGDSFVEEFEKIDKEKTVYL
    Y
    CRSGRRSADATKYLDSMGYKNVFNLTGGYIAWAEKSK

    >gi|305665226|ref|YP_003861513.1| YpmQ [Flavobacteriales bacterium HTCC2170]
    MKKYTYVWVSLVILVFGIIFIPKIVDRIKSDSVVENDRVNLKSNEDGLAYLYLNGKKKRVPSFQFVNQDSLVITDKDYLG
    KVYVVEFFFTS
    CPSICPIMTKNLVDLQEEFKISNDFGVASFTITPEYDTPRVLKEYAEEHGITNLDWHLMTGSQESIYEL
    ANKGFNIFVSEMPDAPGGFEHAGLFALIDKKGFLRSRVDEFGNPIIYYRGTITESQGENSEGEKEQISILKEDIDKLLKE


    >gi|305665308|ref|YP_003861595.1| hypothetical protein FB2170_03390 [Flavobacteriales bacterium HTCC2170]
    MIKKLRTHTLSFGYMLFFFALIVSCKDNKAQNENHAFTNDLVKETSPYLLQHAHNPVNWKPWSDEIFEEATKEDKLVIIS
    IGYSS
    CHWCHVMEEETFEDEKVAEIMNNDFISVKVDREERPDVDQVYMTAVQLMSGNAGWPLNVIVLPNGKPLYGGTYHT
    NAQWSQVLEKINNLYKDDPTKANEYADMVSKGIQDVNLIEPSEENSEISLDILKEGVTQWKPNWDLERGGNMGPEKFMLP
    GSLDFLLDYAELSNDESVRSYIKTTLDQMAKGGIYDHIAGGFYRYSTDPNWNIPHFEKMLYDNAQLISLYSKAYTIFKDP
    VYKQIVLETVAFLQKEMKNTTGGYFAALDADSEGEEGKYYVWTNEELRSTINNNQELFSKYYSTEISTKMEGDKIVLRKN
    QNDEVFASENEISIEKLQELNKEWKKKLVEVRADRVKPRIDDKIIVSWNALLINGYVDAFKAFGETRFLVEAESIFTTIH
    ENAYSDNQLVHSFKKGSNRTEGFLEDYSFLANASLNLYSASMNPDYLNFAQQLIKTTQKRFKDDDSDFYKFNSSNSLIAK
    IIKNDDGVIPSPNAVMAHNLLTLGHIEYNKDYAAHSKNMLISIQPLLQESLTSYTQWAALQLKNVYPFFEIAVVGNNADK
    MRKELHQKHIPNTLIVGSKKESNLPLFEDRYVEEGTYIYVCRDNTCKLPVDNVSDAIEQLENF

    >gi|305665419|ref|YP_003861706.1| thioredoxin [Flavobacteriales bacterium HTCC2170]
    MALEITDATFDEVVLKSDKPVVVDFWAAWCGPCRMVGPIIDEVSTEYDGKAVVGKVDVDANQEFAAKYGVRNIPTVLVFK
    GGEIVNRQVGVSPKKVYTDAIDALL

    >gi|305665490|ref|YP_003861777.1| thiol:disulfide interchange protein [Flavobacteriales bacterium HTCC2170]
    MKKLFFIISLFIGITLYGQHSISGSLSPANEYKWLIAYRLKPGTQVYVAQSEVKEGAFKLDLPANSEPGTYRIVYAVPQD
    EFYFDVIYNGKEDIEVAFSQHTGVSFLTSKENILFNMYFKEINDLEQQIVDYYTQGSQNRNNLKNASLKINEVQKSYEEK
    TMGLMANKFITSNHVFIPQIDDSVYDYVKGKKDNYFNGMDVTNPMLQASGFLTNKLANYVFTALPLKTMTPQETEDVIME
    NVRSVDSKLQTVDDKYKLHLFYSLWSQAAASGKNNVSDFIYTEYLKELASSQNNEEIISNIDVHNRLRPGAIAPNLEWHK
    ENEKKTLSELNGADNYVLVFWSST
    CGHCLRELPSLHEEFASNEKVKVIAVGLEEDELNWKREIKKLNQFEHVIALGKWDS
    EYAALYAVNQTPTYFILDSEKRIIAKPEDNKDVIEFIANN

    >gi|305665571|ref|YP_003861858.1| hypothetical protein FB2170_04710 [Flavobacteriales bacterium HTCC2170]
    MTHNKLIVHILTFLFGVFSISQLVAQNDEKVNWITFEELDDSLAIKPKKVFINFYADWCTPCHKMDQSTYKNTEVITTLN
    KEYYAVRMNVETNDTINFGNKTYINKNKNRPNPLHQIPLLMAARKDKAFSLPAIVLLNEKFEATARYFQYMDSSQLLSIL


    >gi|305665671|ref|YP_003861958.1| methylated-DNA--protein-cysteine S-methyltransferase [Flavobacteriales bacterium HTCC2170]
    MDTAFIHTPLGITKVEGDENGLTSITVLNSETPISTVIPESLEDSVYQLQEYFKGDREAFSLTLNPNGTEFQKKVWKALE
    QIPFGKTVSYLELSKTLGDVKAIRAVAAANGKNPLWIVVP
    CHRVIGSDGSLTGYAGGLHRKKWLLDHESPVKQQSLF

    >gi|305665685|ref|YP_003861972.1| scaffold protein for iron-sulfur cluster assembly [Flavobacteriales bacterium HTCC2170]
    MIQVSETAKQRVISLMTEEGFDASKDYVRVGVKSGGCSGLSYELDFDNKINETDKVFEDNAVRILVDKKSFLYLVGTVLE
    YSGGLNGKGFVFNNPNAQRTCGCGESFSL

    >gi|305665711|ref|YP_003861998.1| hypothetical protein FB2170_05425 [Flavobacteriales bacterium HTCC2170]
    MTFNADGTFLWVIMPFDPRFEEMTTFIMKTRTILIIGVLFGLGTLNTWAQEINQKSTDTNGREKLLGVINEEGLKQNSFA
    QWYKTNYDNYVVDSEVLTIIEKRLKKYEILAFMGTW
    CGDSRREIPRFYKILDSIDFPMENLTMVGVDNARENYKNSPTGE
    ERGHDIIKVPTFIILKDGKEVNRIVETPKVSLEKDLKAIVQNASYIPNYKIVPVD

    >gi|305665724|ref|YP_003862011.1| hypothetical protein FB2170_05490 [Flavobacteriales bacterium HTCC2170]
    MQLYNTLSAKERESLIEQAGQERLTISFYQYAHIGNLSIFRNHLFINWNEIDVLGRIYVANEGINAQLSVPAENFDSFKN
    HLDSISFLKDVRLNIAIEQDNKSFLKLKVKVRKKILADGLNDETFDVTNIGIHVNAVKFNELIEDSNTVLVDMRNHYESE
    IGHFKNAITPDVDTFRDSLDIIEKDLEDFKENKKLVMY
    CTGGIRCEKASAYYKHKGFKNVYQLEGGIIEYARQANDQNLE
    NKFIGKNFVFDHRRGERISEDIIAQCHQCGKACDTHVNCANEACHLLFIQCEECAKKMSDCCSQECKNVSALPFEEQKRL
    RKGKTASNKIFKKGRSEVLKFKK

    >gi|305665760|ref|YP_003862047.1| carboxymuconolactone decarboxylase [Flavobacteriales bacterium HTCC2170]
    MANSYYDPTDLRKFGKITEWSEELGTKFFDYYGKVFEEGALSAREKSLIALAVSHVVKCPYCIDAYTKDGLQKGITKEEM
    MEAVHAGAAIESGATLVHGVQMMNKYNKISM

    >gi|305665761|ref|YP_003862048.1| hypothetical protein FB2170_05700 [Flavobacteriales bacterium HTCC2170]
    MALKSLKARHDELAKTNKQLDILNGGIFEEGELPYFKDKIANTGNFPLRPKKLEVLQINVGYMCNQVCEHCHVDAGPDRK
    EIMTRETMHLCLEVIRNTGAHTLDLTGGAPEMNPDFRWFVEEAAKAGIKDFIVRSNLTIIRANKKYHDLPEFFKKHNVHV
    VSSMPHYTRGKTDKQRGDGVFDKSIKALQELNSVGYGMPDSNLKLDLVYNPSGAFLPGDQMAMEKDFKKALNEDFEIQFH
    NLFAITNLPIARFLDYLIASDNYEDYMYALVEAYNPTAVENVMCTNTISVSWDGWLYDCDFNQMLDLKVASKIKHIKDYN
    EDILNDRNIIISQHCYGCTAGAGSS
    CQGTVT

    >gi|305665928|ref|YP_003862215.1| Alkylhydroperoxidase AhpD core [Flavobacteriales bacterium HTCC2170]
    MSTFNVPKREEVSTKNKSIFDNLEKAVGFVPNLYATYAHSENALENYLNLSNAKTSLSAKEKEVVNLAVSEVNNCIYCLS
    AHTAIGKMNGFSDNQILELRAGRASFDKRLNALASLAKNITETRGATNNVIVQDFLSSGWTKENLIDTIVLVGDKTISNY
    LHKTTNVPVDFPVAQPLDLIEA

    >gi|305665961|ref|YP_003862248.1| thiosulfate sulfurtransferase SseA, putative [Flavobacteriales bacterium HTCC2170]
    MNNFLVNVEWLNTHLKEPNMVVLDASQPSSPSEPISIPGARVFDLKNTFSDTSSEYPNTFPLVEQFERESRRLGINKKSK
    VVVYDNRGIYFSPRVWWMFKVMGHENVAVLDGGLPEWEQQGFKTETRKTIKYAIGDFTASLQPNVLKNFDFVLKNIDQEE
    SLVVDARSAGRFNGTAPEPRKGLRSGSIPKSMNIPYETLLENGKFKNKEGLLEIFGKKELGDQPLVFS
    CGSGVTACIVLL
    ATELAGLNNEKGVFDGSWTEWAQRTDS

    >gi|305666006|ref|YP_003862293.1| hypothetical protein FB2170_06980 [Flavobacteriales bacterium HTCC2170]
    MNKIYHLSTCDTCKRILKELQPLEGFQLQDIKTEAITKIQLEEMHKLSGSYESLFSKRARLYKEKGLAAKELMETDYKEL
    ILEHYTFLKRPVVLFNDQIFVGNSKKVVQAAKETIHS

    >gi|305666281|ref|YP_003862568.1| hypothetical protein FB2170_08389 [Flavobacteriales bacterium HTCC2170]
    MSYLEATNDLYKEAALTPDVGLCCTTNPIWQFPGLSIPKIMQEMNYGCGSTVSAQDLVNNPKVLYVGVGGGMELLQFSYF
    SRQKGGVTGVDVVDEMLEASKQNFKLAEEENDWFKSEFVNLVKGDALNLPVEDESIDVAAQNCLFNIFKTEDLKKAISEM
    YRVLKPHGRLVMSDPTCEQPMNETLRNDDSLRAL
    CLSGSIPIKDYVKALTDAGFGTIEIRSRKSYRVLSPNHYPTDELVF
    IESIEIAAIKDPMPKDGPCIFTGKTAIYYGDEEYFDDNAGHVLMQNQPLAI
    CDKTARQLAQASDQIHISESTWHYNGGGC
    C

    >gi|305666284|ref|YP_003862571.1| hypothetical protein FB2170_08404 [Flavobacteriales bacterium HTCC2170]
    MNNETVPYLENSKAVNENGITFLDTREINEFETSHIKNAIWVGYDSFDSQIINDSVPDKTTPIVVYCSIGVRSEDIGEKL
    QEMGYSNVRNLYGGIFKWKNDGYPVFDQENKETEKVHAYDKLWGKLLTKGEKVYE

    >gi|305666303|ref|YP_003862590.1| hypothetical protein FB2170_08504 [Flavobacteriales bacterium HTCC2170]
    MKLNIKDTFNTELPADPILENSRRQVRGACFSLVTPRRTSNPKLLHVSNDMLQKIGLTEKDVKNNSFLKVFTGNEVLPNT
    KPYAMCYGGHQFGNWAGQLGDGRAINLCEVEHNSEHWALQLKGAGETPYSRTADGLAVLRSSIREYLCSEAMFHLGVPTT
    RALSLALTGDQVLRDVMYDGNPAYEKGAVVCRTSPSFIRFGNFEILAARNEISTLKKLTDYTIEHFFTHLGKPSKEVYLQ
    FFKEVADSSLKMVIEWQRVGFVHGVMNTDNMSILGLTIDYGPYGWLEGYDPDWTPNTTDRQFKRYRFDNQPDIVLWNLYQ
    LANALYPLIEETETLDLILTDYRSSFTKDYQNMMRSKLGLFKSKNDDSILIKELEDILQLSETDMTIFFRNLGNYEVGKP
    DEGIKVISDAFYKLSDVNESIRKKWDDWFLRYDNRLKLGVEVTQIERKEKMDSINPKYVLRNYMAQMAIDNADKGNYSLI
    EEIYTLLKKPYSEQPKYKKWFAKRPEWARHKVG
    CSMLSCSS

    >gi|305666305|ref|YP_003862592.1| hypothetical protein FB2170_08514 [Flavobacteriales bacterium HTCC2170]
    MKNDIKYGIDGFKAHEFGVNQWIDEEGKITSPIKLSDFEGKFKVIYCFQSWCPGCHSRGFPALQEMSKALKSNKNVTFLA
    VQTVFEGHDENTYDKITEIQRKYEIEIPFGHDPGDEGSGNISKIMRHYRTGGTPWFIFIDQRNNVVFNDFHLNVEKAIAF
    LKTIH

    >gi|305666306|ref|YP_003862593.1| methionine-S-sulfoxide reductase [Flavobacteriales bacterium HTCC2170]
    MSNKNLKTATLGGGCFWCIEAIFNEIRGVEKIVSGYTGGTAPGKPTYKEVCSGLTGHAEVVQITFDQSFVSYEDLLIIFM
    TSHDPTTLNRQGGDSGTQYRSVIYYHNDNQKEIANAVSKEIAPYYENVIVTEISPLGVFYEAEDYHQDYYKNNSSQGYCS
    AVITPKLAKLRKMHADKLKEISA

    >gi|305666307|ref|YP_003862594.1| Peptide methionine-R-sulfoxide reductase, MsrB protein (PilB protein) [Flavobacteriales bacterium HTCC2170]
    MFFRLKEGLHKLLNEKSSLIKKQFNKFFKKERKHTMLTWKEVINFAVKGNPKPDRRVEKTNEEWQEILSPEQFRVTRNKG
    TEAPHSGTLCSIHESGKYNCVCCDNPLFDSTIKFESGTGWPSFTQPVKQNAIKYEKDTAFGMVRVEVMCNTCDAHLGHVF
    PDGPEPSGLRY
    CINSESMKLEPAAADKKERI

    >gi|305666469|ref|YP_003862756.1| rhodanese-like protein [Flavobacteriales bacterium HTCC2170]
    MNHERYSRQIILKDFGPNAQHKLSESKVLVVGAGGLGVPVLTYLNAMGVGTLGIVDADTVSITNLHRQVLYDENEVGKHK
    ANVAHRKLSAQNSSTKIRTYNEFLNRDNALKIIKGYDVVVDASDNFPTRYLINDACVILNKPFVYGALHAFEGQISVFNF
    NNGPTYRCLFPKMPNADEIPN
    CNEHGVLGVIPGIVGNLQALEVIKVLTGVGEVLSGKLLLYSGLNQSIQKIKFTLNLENV
    KINRLHDNYNLACGVKVDSVEANQFKTLLHSENIQSIDVRTMAEYSQFHLDNTVNLPLDEIEQWKHTISYNRPIYLV
    CQS
    GVRSTKGLLILQEHEPNAILINVVGGLNSLKIHANKY

    >gi|305666621|ref|YP_003862908.1| NADH-ubiquinone oxidoreductase [Flavobacteriales bacterium HTCC2170]
    MAEQINQKQNFLKGIVKDNPVFVMLLGMCPTLGVTSSAFNGLGMGIATLFVLLMSNIVVSLIKSQIPAKVRIPAFIIVIA
    SFVTIVEMVLEAFIPFLFEQLGIFIPLIVVN
    CLILGRAEAFASKNNLASSIVDALGMGIGFTIALTLLGAVREIFGSGSL
    FDIRFVPEDANTLILFILPPGAFIALAYLTLLFNRISTKNT

    >gi|305666622|ref|YP_003862909.1| electron transport complex protein RnfA [Flavobacteriales bacterium HTCC2170]
    MEYILILIAAVFVNNIVLSQFLGICPFLGVSNKVSTSVGMSGAVLFVMTIATLATYLLHEFVLVPSGMDYLRTITFILVI
    ASLVQMVEIILKKVSPALYQALGVFLPLITTN
    CAVLGVAILALGLENGSLLKAVFFAIANSIGFALALIVFASIREHLEL
    ANIPKGMKGVPINLLVAGLLSLAFLGFTGLV

    >gi|305666849|ref|YP_003863136.1| cyclopropane-fatty-acyl-phospholipid synthase [Flavobacteriales bacterium HTCC2170]
    MKEEQELKNIVKERYAKIAEQGKAENASSCCGATTPSNKVYNIMMDDYTETDGYVEDADLGLGCGLPTEFAKIKKGDTVI
    DLGSGAGNDCFVARHETGSEGKVLGIDFTPIMIEKARINAEKLGYNNVEFREGDIDAMPVSDEVADVIVSNCVLNLVPNK
    NKVIGEMFRVLKPGGHFSVSDIVLVGNLPEALKADAEMYAG
    CVAGAIQKEDYLKIIEDKGFMNLKVQKEKPIVIPNDILE
    KYLSPEETKAFNNGGTGIFSITAYAEKPGEKQEKPKVNLSELQDDSCCSPSSGCC

    >gi|305666886|ref|YP_003863173.1| hypothetical protein FB2170_11511 [Flavobacteriales bacterium HTCC2170]
    MKKISLYLVALLMVPALLLVSCDRGDDITDENSVAAFTLLKDHIVSNDLDIDNILTNPDGEKFVVAAPADADLDAFLSKY
    HIIDIRKNTDFLTNHIQGAKNVPFTDILTEAASTSKPVLVV
    CYTGQTACYATGLMRLYGYSHTRALKWGMSGWNGTTSGP
    WNNNIGNDADGHSNWTFGNAPTPEVFADPVISSFSTDGAQILMERVEQVVAAGFKTVSGGEVLSSPSNYFINNYFSEADY
    TGFGHIDGAYRILPLTFADGGHSNLDPDPNAQVVTYCYTGQTSAVMTACLRVLGYDAYSLTFGMNGMFNSNQAFTKNQWG
    ADSNPKSLPLVN

    >gi|305666887|ref|YP_003863174.1| rhodanese-related sulfurtransferase [Flavobacteriales bacterium HTCC2170]
    MKKKSILIVALLFFSAAISSSFKNANRDNNPPGEFEILLEYLETNASYLQGDGFPIIMADEVRKNLKNPKQHIIDIRTDS
    WFEYGHIKNAANVASSDLLDYFKTKINPEEFEQIVLV
    CYSGQSAAYFTSLLRLAGYDNAYSMKWGMSSWREDFAEGTWLK
    NTSNDFATNLEVDEKVKEEKGEHPTLNTGKTDAKEILNVRLEELFAVPYKEYIIKSEDLFADPSNFYIINYWDEAKCDGH
    IPGSLHYHPNASITKDLITLPIDEKVVVYEETGQKAAYVVAYLNVLGYDAGNLAYGENGFMNTLLKKTGGDAFTKKEINM
    FPVIE

    >gi|305666891|ref|YP_003863178.1| hypothetical protein FB2170_11536 [Flavobacteriales bacterium HTCC2170]
    MGPLIPNEYLSYEWNIVIALLIGLVFGFILESSGFSSSRKLAGVFYGYDFAVLKVFFTAAIVSVIGLYYMDYLGWVDMSM
    LYVHPTYIWGAIVGGAIMGLGFITGGF
    CPGTSLCAVAIGKLDAWVYVLGIMVGVLIFSEAFGGFESLYNDSYLGNITLAE
    SLELPASWIIFAVTIMALVAFFIADIIRKRVSKIFY

    >gi|305666892|ref|YP_003863179.1| hypothetical protein FB2170_11541 [Flavobacteriales bacterium HTCC2170]
    MKKVIEDNRHVYWNPYFGGFLLGLLIIFTFYMTGRGLGASGVMKSSVVTIVDQVSHEHAKNNAYFSRFIEEGKSPMNNWL
    VFETIGILAGAFLSGSLAGRIGFRIQHSPKITSRRRLVFALIGGVLFGLGAQIARG
    CTSGAALSGMAVLSTGGFITMLAI
    FGTAYLFAYFFRKNWI

    >gi|305667069|ref|YP_003863356.1| Dihydrolipoyl dehydrogenase [Flavobacteriales bacterium HTCC2170]
    MTQYDVAVIGSGPGGYVAAIRCAQLGMKTAIIEKYSTLGGTCLNVGCIPSKALLDSSHHYEDAVKHFEDHGIEIPGEIKV
    NLQKMIARKQGVVDMTTKGIQFLMDKNKIDVYEGLGSFKDATHINIAKNDGETETIEAKKTIIATGSKPSTLPFITLDKE
    RVITSTEALKLNEIPKHMIVIGGGVIGLELGQVYKRLGADVSVVEFMDRIIPTMDAGLSKELMKSMKKQKVKFHLSHKVK
    SVERKGDEVIVKADNKKGEEVTLKGDYCLVSVGRRPFTDGLNAEAAGVKLDDRGRVEVNNHLQTNVPNIFAIGDVVRGAM
    LAHKAEEEGTMVAEYMAGQKPHIDYNLIPGVVYTWPEVAAVGKTEEELKEAGINYKTGQFPMRALGRSRASMDVDGFVKI
    LADATTDEVLGVHMIGARCADLISEAVTAMEFRASAEDIARMSHAHPTYSEAVKEAALAATENRALHI

    >gi|305667073|ref|YP_003863360.1| putative thioredoxin peroxidase [Flavobacteriales bacterium HTCC2170]
    MAFVGKKFPNLEVNAMNEMGDTFKLNVLEEAQKNNKKVLLFWYPKDFTFVCPTELRAFQASLKEFENRNTIVIGASCDTA
    EVHFAWLNTAKDNGGIEGVTYPLLADSNRNLASTLGILDITNERYDEETGVVTVDGDNVTYRATYLIDEEGTVFHEGINH
    MPLGRNVNEYMRLIDAYTHVQEKGEVCPANWEEGKDAMTADRKGVADYLATHSN

    >gi|305667074|ref|YP_003863361.1| thioredoxin [Flavobacteriales bacterium HTCC2170]
    MLLELEKDNLNEIIAENKNVIVQYSASWCGNCRIMKPKFKKESTLNKDMTFVLADAEKFSESRKLAKVDNLPTFAIFTGG
    EFKNQVQTNKYDVLKELISEVTSN

    >gi|305667076|ref|YP_003863363.1| thiol peroxidase [Flavobacteriales bacterium HTCC2170]
    MATVTLKGNEIHTIGNLPSVGSSAPAFDLTMTDLSSRSLSDYEGRKLVLNIFPSIDTGTCAASVRQFNEEAAELENTIVL
    CISKDLPFAQTRFCGAEGIENVVMLSDYKDGNFGKSYQVELTDGPLQGLLSRSVVVVNENGNVVYTEQVTETVEEPNYKA
    ALEALMDA

    >gi|305667098|ref|YP_003863385.1| bacterioferritin comigratory protein [Flavobacteriales bacterium HTCC2170]
    MNTLKVGDKVPEFISKDQDGNEVKFSDFKGKKLIVFFYPKASTPGCTVEACNLRDNYGELQAQGFELLGVSADSEKRQTN
    FRNKYNFPFPLLADEDHTVLNIFGVWGRKKFMGREYDGIHRKSFVMNEEGIVIKVIDKVKTKDHAAQLLD

    >gi|305667115|ref|YP_003863402.1| protein disulfide isomerase [Flavobacteriales bacterium HTCC2170]
    MKKVLILFILPIFLNAQADFEVVNEPHWLTDYDKALKVAKKDKKNILLYFTGSDWCPPCKMLKTDLFDTDEFKSISKDYV
    LLYIDIPRNKDLLSSSQLKHNKELVKKFNKKSVFPLLNITDAKGKSLDKYSGYSMNGEIKYHLRLLNKYK

    >gi|305667121|ref|YP_003863408.1| arsenate reductase [Flavobacteriales bacterium HTCC2170]
    MIKIYHNPRCTKSRQGLQALESSGEQFEIIKYLDTIPTKEELKKVLKSLNMPAELLVRKNEAIWKENFRGKELSEDEIIE
    AMIKYPKLIERPIVIKGNKAVIGRPTEKIHALLKQ

    >gi|305667163|ref|YP_003863450.1| hypothetical protein FB2170_12976 [Flavobacteriales bacterium HTCC2170]
    MQSQEFSTRDLKSIKNSSVVHKRHLVLHEKYQKNPATAWITDSAEVNGINLQDPFRTKVSINNEMKVPFRIGVHKAVGGD
    HDFPNPGDLLCASLAS
    CFESTVRMISNKLGIELFETKVRATAQVDVRGTLMIDKSVPVGFQSMHIDVLIIAKNTNEKLLH
    KLIEGAKRS
    CIVYQTIKKGIPITLNADVKIKN

    >gi|305667198|ref|YP_003863485.1| phenylalanyl-tRNA synthetase beta subunit [Flavobacteriales bacterium HTCC2170]
    MLKYGLLGAILFLFFSCGKPKDVTLKEGIWLAELAVQDNEVLPFNFELKKSDEGHMFAEVFNAEEVIKVEEITINNDSIV
    IRTPVFEGYIAGKFTETTITGDFIKESLDRVVPFKATYGEKERFTTKQEPKANISGIWETEFSANTEDSYAAKGIFMQTG
    SKVTGTFRTNTGDYRYLDGVIDGDTMRISAFDGAHAFLFKAKVTDSSLVGTFYSGNHFQEPFVAKRNEGFELPSSDSLTF
    LKPGFDKFTFSFSDSSGSVVSLNDNRFKNKVVIVQVMGTW
    CPNCLDETKFLVNYLEKSNSTNVEVVALAFEYAKTKEKAF
    KSINRLKAAIGVKYPILLAQYGTSNKSKAQEKLPMLNHVLSYPTTIFIDKKGDVRKIHTGFNGPATGEKYETFSKEFDDL
    VREMSEE

    >gi|305667386|ref|YP_003863673.1| OsmC-like protein [Flavobacteriales bacterium HTCC2170]
    MNLQKVNFKNKNGESLIGRLELPVNQHPHNYAIFAHCFTCNKNLSAVRNISKALISSGFGVLRFDFTGLGESEGDFSDTN
    FSGNVEDLVVAADFLKKNYKTPSLIIGHSLGGAAAIYAASQVESIKAVAVIGAPSNPRHVKHLLQNSVEEIENSGKAIVN
    LSGRDFTIKKQFLDDLEHKTLPETLKKLRKPVLILHSPQDTTVEIKNAEELYIAARHPKSFVSLDGADHLLTGKDDSTYV
    GEVISGWAKRYLNINSLESRPTTKHQVVASLDYEDGFTTQMKVGSHFMVADEPISFGGNDFGPSPYELVSAGLSA
    CTAMT
    LQMYAKRKNWQITNVEVHTTYSKTHAKDCEDCESPSAKIDTFNKEIKIEGDLNNKQLERLLQIADKCPVHKTLHSDTQII
    SKLIL

    >gi|305667422|ref|YP_003863709.1| alkylhydroperoxidase AhpD family core domain protein [Flavobacteriales bacterium HTCC2170]
    MSWIKTISYAKATAQLKSIYKRVKGPDNNIDNVLMLHSLRPHTLLGHMTLYKSVLHHTGNTLPKWYLESIGVYVSYLNDC
    AY
    CVEHHSAGLKRLLNDDEKYYRFMESIENDKLKSFFDPTYFSGMAYVKKLTLSPNKILKHDFTTLQDVGFSDGEILEIN
    QVTSYFNYVNRSVLGLGVNTKGDIIGLSPKENDNPENWNHT

    >gi|305667448|ref|YP_003863735.1| thioredoxin reductase [Flavobacteriales bacterium HTCC2170]
    MSEKVERVKTLIIGSGPAGYTAAIYASRADLKPLLYTGMEPGGQLTTTTEVDNFPGYPEGIDGPTMMVQLQQQAERFGTE
    VRIGMITAVELSTEVGGIHKAIVDNDKTIEAETIIISTGATAKYLNIPSEQRLRGGGVSA
    CAVCDGFFYKGQDVAIVGAG
    DTAAEEASYLANICNKVTMLVRKDYMRASKAMQHRVNSLPNLEVKYNTEVDEVLGEQVVEGLRMVNNQTNEKEDIAITGL
    FVAIGHKPNTDIFKGKIDMDDTGYIVTKGKSTKTNLPGVFACGDAQDKEYRQAVTAAGTGCMAALDAERYLAAIEAPEEV
    A

    >gi|305667462|ref|YP_003863749.1| thioredoxin C-2 [Flavobacteriales bacterium HTCC2170]
    MKSSFKKLISSDIPVLVDFFAEWCGPCKMLAPILKDVKEELGDTVKIVKIDVDKNQSIASKYNVRGVPTMLLFKNGKQVW
    RQSGVLQKNDIIEIIQSQN

    >gi|305667561|ref|YP_003863848.1| Heavy metal transport/detoxification protein [Flavobacteriales bacterium HTCC2170]
    MKATIIVQNLKCGGCARTITNKVSELENISDVQVFPNTSTVSFAYEDSSDAIRVKDKLKDLGYPSIDSKNTIASKAKSFV
    SCATGKMSK

    >gi|305667562|ref|YP_003863849.1| hypothetical protein FB2170_14993 [Flavobacteriales bacterium HTCC2170]
    MSFLSSLFGGSALNSDKFEILDTEAFRAAIKQKKVQLVDVRTPREYKGGHIGKAINIDFFQGGSFKQAFEKLDKNKPVYL
    Y
    CRSGSRSKKAAQKILDMGFEMVYDLKGGFMAWS

    >gi|305667563|ref|YP_003863850.1| metallo-beta-lactamase superfamily protein [Flavobacteriales bacterium HTCC2170]
    MLLYGNQNEHNFTVKFYSHFTMRIEQIYTGCLAHAAYYIESKGEAAIFDPLREVQPYIDRANKDNAKVKYVFETHFHADF
    VSGHLDLKKKTGAQIVFGPTANPNYDALIAEDNQIFELGDYKIKVLHTPGHTMESTTYLLIDENDKQHGIITGDTLFIGD
    VGRPDLAQHVVSELTEEKLAGHLFDSLRNKIMPLDDKLIVYPNHGAGSACGKMMSKETTDTLGHQKKVNYALRADMTKDE
    FIKELLTGLTAPPGYFPQNVLMNISGYESLDAIIERGQKPLSPEAFEIAANETGALMLDTRNPDDFAKGYVPNSINIGLN
    GNFAQWVGEMIPDVKQEILLITYPDKEEEAMTRLSRVGYDHTIGFLKGGFKNWKGSKKRFETIARITSDVYAKAYHAEMP
    LVFDVRKKSEYDSEHVKGSINIPLNEINKHLQEFPKEVPFVVY
    CAGGFRSMIAASILKQRGWDDFVDVTEGYAGISKTNI
    DRTDYVCPTTML

    >gi|305667634|ref|YP_003863921.1| methionine sulfoxide reductase B [Flavobacteriales bacterium HTCC2170]
    MVGCKGNAQEKTSTKKDETTYKVSKSDSEWKQELTDLQYYVLRKAGTERAWTSSVLDNKKTGVYVCAACNTELFKSEHKY
    DSGSGWPSFDREIEGNVAYDVDYDIGYERTEEHCATCGGHLGHVFNDGPSKTTGLRH
    CVNGASLKFIPSGKQ

    >gi|305667636|ref|YP_003863923.1| dihydrolipoamide dehydrogenase [Flavobacteriales bacterium HTCC2170]
    MKYYHLVLYFCTSNLKTKNIDMSNFDVIVLGSGPGGYVTAIRASQLGLKTAIVEKENLGGVCLNWGCIPTKALLKSAQVF
    EYLQHAGDYGLKADGVDKDFDAVVKRSRGVAEGMSKGVQFLMKKNKIEVINGFGTLKSGKKLSVKDAEGKETEYSANHII
    IATGARSRELPSLPQDGKKIIGYREAMTLDHQPKKMIVVGSGAIGIEFAYFYNAMGTEVTVVEYLPNIVPVEDIDVSKQL
    ERSFKKNGIKIKTSAEVTSVDTSGDGVKATVKTAKGEEILEADIVLSAVGIKTNIENIGLEAVGIATDRDKILVNDYYQT
    NIPGYYAIGDVTPGQALAHVASAEGILCVEKIAGMHVEALDYGNIPGCTYCTPEIASVGLTEQQAKDAGHDIKVGKFPFS
    ASGKAQASGTSDGFVKVIFDAKYGEWLGCHMIGAGVTDMIAEAVVARKLETTGHEVLKAVHPHPTMSEAVMEAVADAYDE
    VIHL

    >gi|305667683|ref|YP_003863970.1| thioredoxin-related transmembrane protein [Flavobacteriales bacterium HTCC2170]
    MKRFLIALLIGIFILNTSCNTKEKDPNATIEVFETYSELQTLIDDNEDGVTVLNFWSTTCAPCIKEMPHFNELETAYQSE
    GLKIILVNLEKTKRLDSHIYPFVKKHKINPEVVVLTDQNYRIWTDNIDTSWYGALPATLILKGDKRNFRFGSYETYEDLK
    ADVDKVMLQ

    >gi|305666242|ref|YP_003862529.1| HI0933-like protein [Flavobacteriales bacterium HTCC2170]
    MFDVIIVGGGASGFFAAINIAEADPSLKIAILEKGKEVLQKVRISGGGRCNVTNGEPDPLELVKNYPRGEKELLGPLYTY
    GSQDAIHFFESRGVKLKIEKDNRVFPVSNSSQTIVDCFLNEAERLDIKILRQSSVTAIEILSNNDYNWKITTIKSTYICK
    KVLMAAGSSPKIWKLMNSLGHKIIPPVASLFTFKIKDERISGIPGVSSYVKVDILPKHRFRPEITLKLKSEQAEKTLLSA
    EGPLLITHWGLSGPAILKLSAWGAILLNDFKYHFPIRINWLPDYHKGSIFSLLMEIKEIEAKKTVLRTKAVEIPRRLWTN
    LVKASGIAKDEKWADVTKEKLQNLAHELTSGKYMVEGKSTFKEEFVTAGGIDLKEINFKTFESKLHKNLFFAGEVINVDA
    ITGGFNFQNAWTSGYIAAQGIANNET