Flavobacteriaceae bacterium 3519 10 uid59413

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|255534202|ref|YP_003094573.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacteriaceae bacterium 3519-10]
    MLKVGDRLPEFEGVNQDGETINSNDFAGKKLVVFFYPKANTPGCTAQSCDLNNHFSMLNKEGYQLLGVSADSVKAQKKFH
    QKFGFQYPLLADEKREVIEKFGVWQLKKFMGREFMGIVRTTFIFDENGICTRVIEKVKTKEAAKQILEG

    >gi|255534214|ref|YP_003094585.1| methionine-R-sulfoxide reductase [Flavobacteriaceae bacterium 3519-10]
    MSFSFMKILLSILALISMQMCSQVKQPQIKPIMENSTLKDNPYYSRTDRTKLTVSNSEWKQILSPDLYAIAREADTERPF
    TGKYNEFDELGDYYCAVCGNHLFRSDSKFSSTCGWPSFFEADKEGTAYNRDSSHGMERIEVVCKRCDSHLGHVFNDGPPP
    TGTRY
    CMNSVSLEFVGDSEKK

    >gi|255534218|ref|YP_003094589.1| probable iron binding protein from the HesB_IscA_SufA family [Flavobacteriaceae bacterium 3519-10]
    MIKVSDHAKEKAIQLMTEDGFRPFEDYIRVGVKSGGCSGLEYVLKFDNQRTDSDQIFEDNGIKIIVEKKSILYLAGTVLE
    YSGGLNGKGFIFNNPNANRTCGCGESFSL

    >gi|255534257|ref|YP_003094628.1| Metallo-beta-lactamase superfamily protein [Flavobacteriaceae bacterium 3519-10]
    MKIEQIYTGCLAQGAYYIVSGTEAAIIDPLRETKPYIERLQKDGVTLTYIFETHFHADFVSGHLDLSKKTGAPIVYGPTA
    EPDFDAIIAKDNQIFEVGKIKIKVLHTPGHTLESSTYLLIDENGKETAIFSGDTLFLGDVGRPDLAQKSAHMTQEELAGM
    LYDSLQSKIIPLADDITVYPAHGAGSACGKNMQKETVDTLGNQKKTNYALNQPDKESFVREVLDGLSAPPKYFGMNVALN
    KGGYDSFENILEKGNTPVSVTDFEKIAEESGALILDTRSAADFHKGFVPNSINIGLKGDFAPWAGAMIVDVLQPILLVCD
    TGTEEEVITRLSRVGFDNVLGYLEGGFDAWKTSAKETDTVKRISPEKFAAEFNEDSKVIDVRKETEYDAEHVDNAFRRPL
    AEINEWVNSLNNDEHFYVH
    CAGGYRSMIAASILNSRGIRNFTEIDGGFNKIKETSVPKSNFVCADKTL

    >gi|255534259|ref|YP_003094630.1| thioredoxin C-2 [Flavobacteriaceae bacterium 3519-10]
    MSQKFHELINSERPVLIDFFATWCGPCKVQSSVLTTVKENIGDLARIVKIDVDQFPAIAAEYGVRGVPTLAVFRNGEMLW
    KESGVHDVNTLTGLLKDFAAS

    >gi|255534373|ref|YP_003094744.1| hypothetical protein FIC_00208 [Flavobacteriaceae bacterium 3519-10]
    MKNLVKLLPVVAVLSLASCKKDQSADQLVTTEEAVVVDQPTADATVPTVDGATAQAVSGPLTTLALSESAFAFGKVKKGE
    QVEHVYEVTNTGTNPLIISQVKPG
    CGCTVPDYTKDPILPGQKGKITLKFDSGQFDGLVNKQAEVFANVEKAPVIIGFSAD
    VQPN

    >gi|255534449|ref|YP_003094820.1| thiol:disulfide interchange protein tlpA [Flavobacteriaceae bacterium 3519-10]
    MTFIKKNIFSIIAIAFVAVLYLFPSVKLKIKDLFFPVAAIENAVTLQDSDYDLQLKGINVASTNLKNLKGDKLVFLNFWG
    TW
    CPPCREEWPTIEKLYQARKDKIDFVLIAMQDEEEKVVKFMKENNYTAPVYIAQSPISKNILPKAFPTTFLLTKDGRIL
    LKEDSSKDWNSKSVNDFIDNVTK

    >gi|255534452|ref|YP_003094823.1| PPO candidate 1 [Flavobacteriaceae bacterium 3519-10]
    MAQTASNMLELGTKAPFFELPNPSNSNEIQSLENLKGEKGTLVIFMCNHCPFVQHVIDILAELYEDYQDKGIEFIAINSN
    DAEKYPADAPDKMAEFQVERKFDFPYLFDESQAIAKAYNAACTPDFFFFDDKLDLIYRGQMDDSRPGNNKEVTGEDLIVA
    FENLLADAPQEETQLPSIGCGIKWKA

    >gi|255534561|ref|YP_003094932.1| Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase [Flavobacteriaceae bacterium 3519-10]
    MKFKSFFLFCILFLFQGFTAQIKNPVKFKYNINALPNNEYEAVLTATIDSNWKIYSKDLPPDSGIPTEMIVRSKEGLQLI
    GGVMEVGKKKDEFSEAFGVQIVYYENRAQFKQKFKLKNGSVPANVVAEITYMTCDDRICLAPNTLEFEQKITPTATGASV
    IEPEEEVLKTTAVTDSAVATESDTVLNVAPSITAEKQEGLKVSTIDFANPLTDCGLETQSNSENFWTYLLLGFFGGLIAL
    LTPCVFPMIPLTVSFFTKGSFNKSKGKRDAIMYGFFILLIFVLLSIPFHIIDGIAGNIFNQISTSVWLNVTFFLIFLFFA
    GSFFGYYDITLPSSIANKSSKAEDAGGVIGIFFMALTLVIVSFSCTGPILGSLLGSAVTGSANVPMLLTFALAGFGLSWA
    IVFGLLALFPQALQSLPKSGGWMNTVKVVLGFIELGLALKFLSKADLVSKTFFLKRELFIALWILIALGLVLYLFGKIRF
    PHDDKKPTISLTRKIIGFLGIGFIIYLLQGLIPGERPKLQHLSGILPPINVSYLHKAEDGILGMHPSHDYFEALEIAKKE
    NKPLLVDFTGYG
    CENCRKMEEFVWSEPDILPILQNDIVLASLYVDDREALPESEQTSVDMGNGQKKKIKTIGDKWSLFQQ
    INFNNNSQPHYVLLSPDGKVINTPVSGYMSKEDFKSFLTCGIEYFKQTKKQ

    >gi|255534668|ref|YP_003095039.1| hypothetical protein FIC_00519 [Flavobacteriaceae bacterium 3519-10]
    MKKVFYLKTCDTCLKILKKYSLKDWELREIKINPVTEEEIEEMYKLAGSYEALFSKKSNQIKLREIDPKSLGEEDYKELI
    LDHYTFLKRPVFMTDKEIFIGSEKKTVEALRGYFAEQG

    >gi|255534799|ref|YP_003095170.1| dithiol-disulfide isomerase [Flavobacteriaceae bacterium 3519-10]
    MKVDIWSDIRCPFCYVGKKKFEKALAQFPEAENVEIIWHSFQLDPNLETQHDRNPYEYFSEAKRIPVEQAKAMHEHAKNA
    GREAGIEFNFDESKIANSFKGHLLIQLAKTQGLANQMEEALFAAQFIKGQNIDDEQTLYDIARSVGLSEEQTQNALKSDE
    FAHAVAQDGLMARQLGINAVPFFVFNDKYGVSGAQQPEHFLEVLSKSWEEFSAGDKGLQIISRGESCDTDGNCD

    >gi|255534804|ref|YP_003095175.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
    MYTELADDTLQQLVADNEKVVVQYGATWCGNCRIMKPKFKKLASENDDIPFLYVDAEKFPESRKLAKVDNLPTFAIFKNG
    ELVNQVQSNQAESLINLFNELN

    >gi|255534805|ref|YP_003095176.1| Alkyl hydroperoxide reductase subunit C-like protein [Flavobacteriaceae bacterium 3519-10]
    MHYEILKPIYMSLVGKKFPNIAIDAMSEMGDDLKINIFEEATQNQQKVLLFWYPKDFTFVCPTELHAFQDALGEFEKRNT
    KVIGASCDTNEVHFAWLNTSKDNGGIEGVTYPILADTHRQLANQLGIVDQDFEFDEEGNEFFTGSNVTYRATYLIDETGK
    IFHEAVNDMPLGRNVKEFLRLIDAYTHVQKHGEVCPANWEEGKDAMQANRKSTAEYLASQN

    >gi|255534877|ref|YP_003095248.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Flavobacteriaceae bacterium 3519-10]
    MKQLFTVLSLFFALSVFGQKVPQINKTEFSKTSLAQKITSQTGTKLSVGEVLKKHEGKILIIDFWASWCQDCILALPATK
    ELKENNPEVEFVYFSLDRSHEQWNRGLAKYGIDAEENYWFDEGWKNSFNNFIELNWVPRFIVVDQRGAIADYYAVSPSDP
    ELLETIKKLKK

    >gi|255534910|ref|YP_003095281.1| Thioredoxin [Flavobacteriaceae bacterium 3519-10]
    MAIEITDQSFQDTVLNSDKPVLVDFWAVWCGPCRMLGPIVEEISADFEGRAVVGKVDVDNNQQVSVDYGIRNIPTLLIFK
    NGQVVDKIVGVAPKETIAEKLSAHL

    >gi|255534931|ref|YP_003095302.1| hypothetical protein FIC_00787 [Flavobacteriaceae bacterium 3519-10]
    MNKFKIKGMTMAMLLVSAVAFSQTAATKNAAETKNSVTPASKVDPAAALEEKKRIAAEEKAKLPKPYDAEENAEQKISEL
    VKQAKAENKNIILQAGGNW
    CIWCLRFNQFVQTTPELKQIVDDNYLYYHLNYSPENKNEKVFAKYDNPGAKFGYPVFVVLN
    QDGKMIHTQDSAVLEEGKGYSIEKVKDFFLKWTSKS

    >gi|255535035|ref|YP_003095406.1| Thioredoxin reductase [Flavobacteriaceae bacterium 3519-10]
    MEQNILDCVIVGSGPSGYTAAIYAARADLKPELYTGLEPGGQLTTTTEVDNFPGYPDGVTGPVMMMDLQKQAERFDTKVY
    YEMITKAEFATEAGGIHKLWAGNKEIFAKTVIISTGATAKYLGLDDEKKYAGGGVSA
    CATCDGFFYKGKDVVVVGAGDTA
    AEEATYLAKLTNKVTMLVRKDAFRASKAMVHRVNSTPNIEVKFNHELIAIEGENALVERAVVINNQTQETSKIDVHGIFI
    AIGHKPNTDIFAGQINLDENGYIKTIPGSTLTNLPGVFAAGDVQDHIYRQAITAAGSGCMAAMDAEKYLAELNS

    >gi|255535092|ref|YP_003095463.1| Thiol:disulfide interchange protein tlpA [Flavobacteriaceae bacterium 3519-10]
    MKNILVGLMVLAAFTSCKKETTAAENSTVNEVDSVSDPVISESASPFRQIELSPDQTSQILAKKDNDTLYVTNFFATWCG
    PCMREIPHFKDKMQELKYQPVKFTFIGLDAKEDWPTKVKAFAEENNLSQNIVLVDGEKLTPAFFPANFKQWDGGSIPFTF
    MRKGDKTDETIGMMSKELLDEKINSFK

    >gi|255535116|ref|YP_003095487.1| Thiol peroxidase, Tpx-type [Flavobacteriaceae bacterium 3519-10]
    MAEITLKGNAVQTIGQLPEIGLSVRDFALVNDKLEVKTLADYDGKKKIFNIFPSIDTGICAESARKFNEKAGELDNTVVI
    NVSKDLPFALGRFCAAEGLDHVESLSDFRGTFGDDYGVTMMDSPMKGLLSRAVIVTDETGKVIYKEQVPEIAQEPNYDNA
    LNALA

    >gi|255535142|ref|YP_003095513.1| Organic hydroperoxide resistance protein [Flavobacteriaceae bacterium 3519-10]
    MKNKFMKTLYTTSVTATGGRDGHVQSQNGIIDMEVRTPKALGGKSDDFANPEMLFAAGYSACFDSALNLVIGKSKTQTGE
    TSVTAEVSIGQIDNGGFGLAVKLDVNVPGVTQEEAQALVEKAHQI
    CPYSNATRNNIEVTLNVTNN

    >gi|255535180|ref|YP_003095551.1| Methylated-DNA--protein-cysteine methyltransferase [Flavobacteriaceae bacterium 3519-10]
    MELSTEIMYQASLDKNPDFEGVFWMGVKTTGIFCRPICRARKPKPENVEFFSSTKAAILKGYRPCKVCKPLENPDETPDY
    IQQILEELRENPAQKFKDYDLVKRGIEPSTMRRWFQKNHGMTFQAFQRMFRLNTAFKKLQQGENIIETAYDSGFESLSGF
    SESFKNIFGVSPKNSKTQQIIDLKRIETPVGTMYAAAVDEGICMLEFTDRKMLETEFKDLAKSLNATIVLGENRHFMVLE
    QELKLYFEGELTQFTVPLSPVGTQFQKSVWKILQQIPYGETWNYRRQAEVLGDVKKVRAVANANGMNKISIIIP
    CHRVIG
    TNGTLTGYGGGIWRKQKLLELEKAILL

    >gi|255535189|ref|YP_003095560.1| Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase [Flavobacteriaceae bacterium 3519-10]
    MNYDIIVIGSGPGGYVAAIRASQLGFKTAIIEKESLGGICLNWGCIPTKALLKSAHVFNYLKHTEDYGLNKIENPGFDFS
    KVVQRSRGVATKMSGGISFLMKKNKIDVIMGTATVQKGKKVSVADKDGKNTEYSAQHIIIATGARSRELPNLPQDGVKVI
    GYRQALNLPEQPKSMIIVGSGAIGIEFADFYNSLGTKVTIVEFMPTIVPVEDEDVSKHLEKSLKKTGIEIMTNASVESVD
    TSGNGVKANVKTATGNITLEADILLSAVGITSNVEGQGFEEIGIQIEKGKVLVNEWYETSVPGYYAIGDILPTQALAHVA
    SAEGITCVEKIKGMHVEKIDYGNIPGCTYCHPEVASVGLTEKQAKEKGYEIKVGKFPLSASGKATANGNTDGFVKVIFDA
    KYGEWLGCHMIGEGVTDMIAEAVVARKLETTGHEIIKSIHPHPTVSEAIMEAAAAAYGEVIHI

    >gi|255535567|ref|YP_003095938.1| putative glutathione peroxidase [Flavobacteriaceae bacterium 3519-10]
    MKKIFILMLGVAAFVQSCTQQKKEISQDKNTVMNSIYDFKVESLDGGEIDFADFKGKKILIVNTASECGFTAQYADLEEI
    SKTYAGKVVVVGFPANNFGGQEPGTNEEIGAFCEKNFGVTFPLAAKVSVKGDDTAPIFKYLTDKDLNGVKNTSILWNFTK
    FLVDENGKLIDSFISTTKPTDEKITKYFK

    >gi|255535593|ref|YP_003095964.1| hypothetical protein FIC_01454 [Flavobacteriaceae bacterium 3519-10]
    MKQLTVLFLLFILMPAKAQVNWMTLEEAVKAQSEAPRKIMIDFYADWCGPCKTMDKETYGHPLISKYLNENYYPVKFNAE
    SKESITIFGRTFSNPDFAAGKRKNSMHEFTKFMNVTAVPTIVFLDEQSMPITILQGALTAKELEPYIPFIAYDEYKKIET
    REQWENYQKKFKSNIKD

    >gi|255535615|ref|YP_003095986.1| phage shock protein E [Flavobacteriaceae bacterium 3519-10]
    MSLVEVLQAGDYHLIDVRESMELEMDGHIEEAQNIPLGELEERKQEVVNLSGTKIFFCRSGNRSGKAVEYFKQQGMTDVY
    NGGGYQELKAVLESL

    >gi|255535669|ref|YP_003096040.1| Arsenate reductase [Flavobacteriaceae bacterium 3519-10]
    MIKVLHNNACSKSRAILEHLDENNVHFEIIDFIENPLSETELRTVVKKLNTDVKDLIRKNDPLFREKYCDKEYTEDEWIK
    ILLESPSLMQRPILIKGSVAMIGRPIENVRFFIEK

    >gi|255535719|ref|YP_003096090.1| Probable transmembrane protein [Flavobacteriaceae bacterium 3519-10]
    MLELLQQPLPWYVAGPLIGLTVPALLILGNKSFGISSSLRHICASCLPANIPFFKYDWKKEAWNLFFVFGIFLGGVITML
    FFSNPNPVEVHPNLAKELAGYGITDFSNLVPTQLMNWESLFTVRGLIMMVGGGFMVGFGTRYAGG
    CTSGHSIMGIANLQL
    PSLIATICFMIGGFLMANVLLPIILSL

    >gi|255535720|ref|YP_003096091.1| metallo-beta-lactamase superfamily protein [Flavobacteriaceae bacterium 3519-10]
    MKIEQIYTGCLAQGAYYITSNGEAAIIDPLRETQPYIERLEKDGVALKFIFETHFHADFVSGHLDLSEKTGAPIVYGPTA
    EPEFESIIAEDGQIFAVGDVKIKVLHTPGHTMESSCFLLIDEKGNETALFSGDTLFLGDVGRPDLAQKAAHLTQEELAGL
    LYESLSNKILPLADDITVYPAHGAGSACGKNMQKETVDTLGNQKQTNYALNQPNKEAFINAVTDGLLPPPAYFGMNVAMN
    KKGYDSFQDVKRSGMTAFSPDDFETAAENTGALILDTRNNADFAKGFIPQSVNIGLNGDFAPWVGTMIVDVNQPILLVTE
    EGQEEEAITRLSRVGFDKIAGHLAGGFSAWKDSGKSTDTVNRITAAQFASEVKIGENTIVDVRKESEYAAQHVEDAYSKP
    LAYINNWITDIDPQQHFYLH
    CAGGYRSMIAASILQARGYRNFTEVEGGFAAIAKTEVPTTDFICQSKVLSSNPQFNNRKT
    MFNFLKNIFTPPDNSALGDIINSGAFLVDVRTPGEFRSGSVKGAVNIPLDVITKHLGKFAGKKNTVVF
    CRSGNRSGQAKR
    ILEQNGISNVSDGRTWQNVNHLLNNQ

    >gi|255535729|ref|YP_003096100.1| Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase [Flavobacteriaceae bacterium 3519-10]
    MSQFDVTVIGSGPGGYVAAIRCAQLGFKTAIIEKYPTMGGTCLNVGCIPSKALLDSSEHFENAKHTFANHGIIIDEPKAD
    LARMIARKNEVVEQTTKGIQFLMDKNKITVFEGVGSFESATQIKVTKNDGATEIIDSKYTIIATGSKPSSLPFISLDKER
    VITSTEALELKEIPKHLVVIGGGVIGLELGSVYKRLGSEVTVVEFMDKIIPTMDGALSKELNKVLRKQGIKFMLSTAVQA
    VERNGDAVKVTAKDKKGEEVVVEGDYVLVSVGRKPYTDGLALEKAGVDLDERGRVKTNGHLQTNVSNIYAIGDVVAGAML
    AHKASEEGVLVAEQLAGQKPHINYNLIPGVVYTWPEVAAVGKTEEQLKEEGVAIKVGNFPMRALGRSRASGDIDGFVKII
    ADEKTDEVLGVHMIGARAADMIAAAVTAMEFRASAEDIARMSHAHPTFAEAIKEAALDATAKIAIHM

    >gi|255536033|ref|YP_003096404.1| putative disulphide-isomerase [Flavobacteriaceae bacterium 3519-10]
    MQKFQVFMKKILLLILFSISTPFLAQQSINFETGTFQEILAKAKSQKKLVFMDAFAVWCGPCKMMEKNIFPLPAVREYYN
    ANFINARIDMEKGEGIGIAQRYGIRSYPSYLILNGDGEVVKQTYGYMGEEPFLAFAKQANDPKFATSSNKELFEKGESAP
    EFLLNMMQLYSQTDFDVAQKASERYFQVKKDQALTKDEVGLLLYFTKSPVDVNYKTFVSRKPEIITLMSEDIYNQFDTNI
    KISSILENAMDKKTGRINDGQYYKDAIPLVGAAEAEIALHRTKVIVYPNAGLFDEYEKAALSYYKNSENFSQDELLKAAW
    IFSDHVTNISSLKKAQEWAEKSVMQAETPENTYILARLYAKTGQKENAKMYAESSKNLAERLGKDATAAIQLLGTLK

    >gi|255536054|ref|YP_003096425.1| UDP-galactopyranose mutase [Flavobacteriaceae bacterium 3519-10]
    MGCNRRKNEFNHTKSNCMTDIDILIVGAGISGATLAERYANIGKKVLIIEKRDHIAGNCFDYLDENGILTSKYGAHLFHT
    NEKDVWEYVNRFGEWYPWEHRVVARVDDKTVPIPVNITTVNTLFGTNISTEEEMKQWLDNNRVEFSPAKNGEEAVLNRVG
    PVLYEKMFKHYTVKQWDKYPAELHASVLERIPVRTNYDDRYFSDEFQALPKGGYTKIFEQMLDHPNITVLLNTDYFDVKD
    QYTGYEKLFYTGPVDRFFEFKKELDKLEYRSINFVTEHLDQEYFQETSVVNYPGNEVDFTRIVEYKHFGNQKSAKTSIVK
    EYTVDDGEPYYPVPNEKNQLIYEKYKEEADKLTDVYFVGRLANYKYFNMDQAFKNALDLFSSLETQNLKHHATGATF

    >gi|255536175|ref|YP_003096546.1| Rhodanese domain protein [Flavobacteriaceae bacterium 3519-10]
    MQLYNTLSAEERARLIDEAGKQRLTLSFYAYAKISDPKKFRDELFIAWNALDALGRIYVAHEGINAQMSIPADHFEAFRE
    TLEVYDFMKGIRLNVAREHDDHSFLKLTIKVRNKIVADGLNDETFDVTNKGIHLKAKEFNTLLDDPDTIVVDFRNHYESE
    VGHFKGAITPDVETFRESLPIINEQLQDFKEDKNLLMY
    CTGGIRCEKASAYFKHQGFKNVFQLEGGIIEYARQIKEENIE
    SKFIGKNFVFDHRLGERITDDVVSQCHQCGKPCDNHTNCFNDACHLLFIQCDDCKTAMENCCSVECLETIHLPLEEQAKL
    RKGLQVGNKIFKKGKSDALKFKNSGNLRDQPLAKANTKNIRQKIAVKKVLVGKAEHYYTKSKISQFLINSNGLSAGDKVL
    ISGPTTGEQEFTIKEMFANGGPCETANKGDQITFETPFRIRLSDKIYKIVAEN

    >gi|255536253|ref|YP_003096624.1| putative lipoprotein/thioderoxin [Flavobacteriaceae bacterium 3519-10]
    MKKVIVTTCLLVLTNLSAQFKINIETAPSFTPKEVYLYTLSGSKDMLHSKAERKGNAWQINVDKPYTGMMKLYFPESNTS
    VNFISENKDVKLKFESINGKIANIQYLDPSNAVMNSMQDAQQKKEYILPALHQIKDYYQENTDFRKALNSEINRLSAGQL
    NVAAHPFVNYYQTNYAKYVEKKPSKTLTHDEIIHFLSNSGDMLETSSLMRPVLVSYLNVGPSTNLVADVDKLLKAVNTET
    PRGQTVMSELIEIFDIYEMTDLKDKYLTEAKNLKCTINDRLSRTIEINKNTEIGASFANHVFTQPTNTTAKSVYDVKSDR
    KVIVFWAST
    CSHCEADLPKLIEKYSTMKSKNIEIIAFSLDSDKVAYGNKVKSLPWINDAELKGWYSTSAEKYNVHATPTY
    FVLDGANKIIAKPSHASDVISYLKLN

    >gi|255536398|ref|YP_003096769.1| hypothetical protein FIC_02274 [Flavobacteriaceae bacterium 3519-10]
    MLISTHQTSPNKKTIKNMKKIFAGLFLTASFAFATAQTISFDKTTYDYGTVKNGADGHTMFTVKNTGDKPLIISKVQASC
    GCTTPEWSQDPIMPGKTAQIKVGYNTTIVGPFTKIIEVYSNDPANSRSVINIKGTVEGQAAAAEMAAPAMEMSTKAVPAS
    VKTNARKASK

    >gi|255536485|ref|YP_003096856.1| Rhodanese domain protein [Flavobacteriaceae bacterium 3519-10]
    MDISPIISAQGLADLIGTKNLVIADAGSGTEARERYVKEHISGSHYVDLNEDLAEVPADAKNGGRHPLPSLDKFAALLAR
    LGIRRESHVIVYDDKNAANAAARFWWMLRAAGYTKVQVLNGGLPEAIKHGITVNAEIPKVADTELPALKTWSLPTIDLGG
    VDAFSKNSEALIIDVRENERYRGETEPIDLVAGHIPSAINLPLKNNLDGDGKFKNPEVLKAYFTEILGDHLTENIAVH
    CG
    SGVTACHTLLAMHYAGLSIPKLYVGSWSEWSRNFKPVEKL

    >gi|255536637|ref|YP_003097008.1| peptide methionine sulfoxide reductase [Flavobacteriaceae bacterium 3519-10]
    MIENRYQFMNKILVFLMSLILYSCNGQEPKKPITKNVKMDKQNLEYITFGGGCFWCVESCFNMLKGVDAAISGYSGGHKT
    NPTYEEVCTGETGHAEVVEIAYDPKIISYEQLMDVFFFLHDPTQLNRQGNDIGTQYRSVIFYKDEAEEAKAEAALQASAA
    SGRWNGKYVTELAKFEKFWPAEQYHQGYYNENPNQPYCSAVVGPKIAKFKKHYGELGMLEPKTAQ

    >gi|255536675|ref|YP_003097046.1| protein of hypothetical function UPF0061 [Flavobacteriaceae bacterium 3519-10]
    MNLDKITSPYLYIFPGDTSGNTRQRQTPKVLFASTKIVGFANAELIHFNQKLSDEIGLGPIETNADRDFLNATALPENIK
    TYATAYAGHQFGNWAGQLGDGRAIFAGEITNAAGKKTELQWKGAGATPYSRHADGRAVLRSSVREYLMSEAMFHLGVPTT
    RALSLSLTGEQVERDMLYNGNPQDEKGAVVVRTAESFLRFGHFQLMAAQDEIETLRQLADFTVSNYYPTIDPNDPQKYAE
    LFRQIASRTADMIVEWYRVGFVHGVMNTDNMSALGLTIDYGPFSFLDEYSLNFTPNTTDLPGRRYAFGNQAKIAQWNLWQ
    LASALFPLVNDVEILQNILNGFSDDFWKKHDKMMASKFGFDQLIEGDDSFFTAWQKLMEDLKIDYTLFFSRLEMTAGSDD
    LKTTFGDVFYSPVSDDSFKLFENFIETYRTRLTKNTITPEDSLQLMRKTNPRFVLRNYILFERIAELEQGKRDLFNKILT
    ALESPYEELFPEFSKKRPAIYDDQSGSSTLS
    CSS