Finegoldia magna ATCC 29328 uid58867

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|169823726|ref|YP_001691337.1| hypothetical protein FMG_0029 [Finegoldia magna ATCC 29328]
    MKKFIKALTLFAMILVLATGCQKAAPGAAKGPGTAKDGNEQKIETASMKLVNAVNKGGYELVSTEDLNSWVEQKKDMVIV
    DTMPAKSFDKNRIPGAVNAELPMKADELKPEQKEAFLKALGEDKNKTVVVY
    CGFVGCARSDVGAVLAKEAGFTNVYRHPG
    GIVAWMDAGYKIEGSAAK

    >gi|169823751|ref|YP_001691362.1| putative cation-transporting P-type ATPase [Finegoldia magna ATCC 29328]
    MKRRYTLENLGCANCAAKMEEKIKELDGVNSVTVNFITTKMVLDVEDDKFDTVLAQAKDIIKSIEPLVEVK

    >gi|169823812|ref|YP_001691423.1| peptide methionine sulfoxide reductase [Finegoldia magna ATCC 29328]
    MRFIEKSTIYLAGGCFWGVEAYFKKLQGVIDTDTGYANGEGTDTDYKKIKQTHHAETVRIVYDKNRLDLAEILLHYFRII
    NPISVNKQGNDVGEQYRTGIFYEDEEDLEVINSVMKYIQSKYDEKLTVLVEKLQNFVLAEDYHQDYLDKNPGGYCHINLN
    AFDENLDTTEYKKMSEEEMKEKLSDVSYRVTQNEATERPHTSSFNDFDERGIYVDIVSGEPLFSSKDKYDAGCGWPSFTK
    TITSSSVNYSDDHKLSRVRTEVRSKHADSHLGHVFDDGPLEKGGLRY
    CINGASLRFVPLEKMEEEGYSKYIPFV

    >gi|169823815|ref|YP_001691426.1| hypothetical protein FMG_0118 [Finegoldia magna ATCC 29328]
    MDSKEVLAEQSKLFRENLPDVTKNFSDLCGTVFKDGKLSLKEKELIALAIAITVKCEGCVVHHTTGCVDAGCTMEEISEM
    IGVCVAMGGGPSKTFAGKALQLAEELLK

    >gi|169823846|ref|YP_001691457.1| putative methyltransferase [Finegoldia magna ATCC 29328]
    MEDIRKQVSEYYSNITTEKEGQMETKICSCQDNMPDHLKEIRSMINPEIIKRFYGCGSPIPPALEGCTVLDLGCGTGLDV
    YIASKLVGENGKVIGVDMTDDQLNFAKKYQDEMAEKFGYKKSNVEFKKGYIEDLKSIGIEDESIDVVISNCVINLSPFKE
    EVFKEVWRVLKKGGELYFSDIFADRRVPDEIYQNPVLRGE
    CLAGAMYVEDFRRLLRKIGWEDFRYTKTTVAPIENKEIEK
    LVGNVNFTSRTVRAIKLPGIIEDKCEQYGQFATYRGGMVGCDNYFDLDDHHRFFVDLPMAV
    CGNSCAMVQDTRFGKYFDV
    VGDRSKHFGLFDGCGDSPAPAADDCGCDGGSCCC

    >gi|169823996|ref|YP_001691607.1| hypothetical protein FMG_0299 [Finegoldia magna ATCC 29328]
    MRKNVLKGTTLLLALCFSVGAVGCQKSSGNTGKDSKVVSPKEAGMKNDKKQENEKFKPADYSLQPKDEFVYEFLGLKFKL
    PEQVKKDMTNKKIAMLDEQSPIDKELKYAMLTFSKLTEEQKNAVVDKMGDGYEKWQKELERVGTIGMFDKKMSEADISKI
    TKCDNHKKIGESKDGKFTYYISSKGKMDEGFAKEFAQTQIDIIDKKPRPENGFVLSEKTDLENTEAFDKKSVKGLGNLST
    KDINGKQFTSKDFEKYDLTMVNVFATW
    CSACVNEIPDLSEVSKEMKSKGVNIVGVVTDTVDDNGTNNDALQKSKLIQEKT
    KASYPFLMPDKSNFNGRLNGIQAMPETFFVDKKGNIVGETYSGAKSKEEWKQVIEKELANLKSK

    >gi|169823998|ref|YP_001691609.1| hypothetical protein FMG_0301 [Finegoldia magna ATCC 29328]
    MKKLLLTLALVSALTVTGCSNNTEKPADNNAKTEQKTENKSEEKAAIKEMKGADLEAIEQDKKKKETVLVVDVRSKDEYD
    QGHVKWAINMPIDTFEQEVSKLDAYKDKAVITI
    CNSGKKSQKAAEVLVNNGFKDVTNAEGVKKFEYKLVKFANILPADLV
    KASEDTNNVIVDVRDKKDYDKGHIKNAISMPLDEADARLSEIPTDKPVYTY
    CYSGNKSGQLAQKLVERGNKDVFNSLDGT
    KEHDYELVK

    >gi|169824046|ref|YP_001691657.1| electron transport complex protein [Finegoldia magna ATCC 29328]
    MEKGKAAKVFKSSILKNNPVLIQLVGLCSVLGVSTSVENAIGMTAAFAFVLICSNIVISLLRNFIPDKVRIPAYIVVIAT
    FVTLVSMMLQAFVPALYSSLGAFVPLIVVN
    CIILARAESFASKNGVFLSLLDGISNALGYGIVIVLVAFIRELLGSGKIL
    GKLVIGDIPPIGIMSAAPGAFIVLGILLATYNSFLSRQERKKNNMRGED

    >gi|169824047|ref|YP_001691658.1| electron transport complex protein [Finegoldia magna ATCC 29328]
    MLANVFKIIVLYLLVNNYVFGQFLGLCPLIGVSSKTETAIGMGMAVFFVITIASVVTYVLQIQILERFHIEYLQTIVFIL
    VIATLVQFVEMALKKMSPNLYSALGVFLPLITTN
    CIVLGVALANVKEKYNLIETLASAIGASLGFILAITLLAAIRERIA
    MNKNIPESFKGVPIAFITIGLMAMTFFGFGGLV

    >gi|169824096|ref|YP_001691707.1| copper-transporting P-type ATPase [Finegoldia magna ATCC 29328]
    MEEIKLKIQGMSCESCAARIEKVLSKYEYIDTVNVNLLQEYAYLKLKEGYDIETIVDKIKKAGYEVPMKTSKFDIEGMSC
    QSCASRIEKVLNKNNFKDVNVNLLQNSLTVSFYEGYKTNSDVKRLVDKAGFSAEIKTDNKIANEKNITEYEKLKRDFIIS
    AIFSIPLFSAMFFHMAGVHTILSNGYFQWALATVVQFYIGRRYYVNAYKSLRGGGANMDVLIALGTSAAYFYSIYHVLIG
    SDQLYFESSAVVITLILLGKLFEKRAKTRTTDAISKLMGLQAKKANVIKNGQTIETDIEDVMVGDKILVKPGEKIAVDGI
    IVEGSSSVDESMITGESMPVKKQVGDECIGSTINKNGSFVFEAKKIGEDTVLSQIVKLVEDAQSNKAPIQRLADKISSVF
    VPIVIAIAALTFVITYFVTKQFDRALLNSVSVLVIACPCSLGLATPTAIMVGSGKGAELGILIKSAEVLETANKIDAVIL
    DKTGTITNGKPEVVDYKSEDADFLKVVSSIEKSSEHPLADAVVKEYEKNSSDFYKVEDFHSITGKGLSARINDDEYFIGN
    EKLMKENNIDVNVDIQKYQSQGNTVVLVGKNDKFYGYILIADKIKESSPKAVAKLKDDNIDVYMITGDSENTAKHIAEKA
    NIDHVIAECLPKDKSDKLLDLKNQGKKVGMVGDGINDAPALAASDVGFSIGTGTDVAIEASDITIINGDLNKVHTAIRLS
    HRVIKTIKQNLFWAFFYNVIGIPIAAFGFLNPMIAGAAMAFSSVTVVTNSLRIKNFKEEK

    >gi|169824128|ref|YP_001691739.1| thioredoxin [Finegoldia magna ATCC 29328]
    MLELDKKTFEPEVLEAEGLVFVDFWSDGCEPCKALMPGVHELAEKYGDKIKFCSLNITSARRVAIKQQVLGLPTMLMYKD
    GQKIDEINKDDANLENIEAMIQKHYN

    >gi|169824134|ref|YP_001691745.1| thioredoxin reductase [Finegoldia magna ATCC 29328]
    MYDLIIIGAGPAGLSAGLYAARAKMNTLIVEKEKTGGQITTTDSIENYPGGIVGESGPSLIKKMADQIDNFGLEIRRADV
    VDVDFSDKVKKLTLKNGDVLEAKAVIIATGAAPRKLGCPGEKEFTGKGVSY
    CATCDADFFTDLEVFVVGSGNSAVEEATY
    LTKFARKVTLLVRGDHLKCDKTAEDEAKACDNLSMRFNTSIKEIKGEGILESIVMVDKESGKEEEYHCDEDDGTMGVFVF
    VGTIPYSDVFKGKIELDEYGYILGDEEMHTNVEGVYVAGDVRQKTLRQVVTAAADGAIAATQAEKYVDKF

    >gi|169824163|ref|YP_001691774.1| dihydrolipoamide dehydrogenase [Finegoldia magna ATCC 29328]
    MTKDIIIIGAGPGGYETAIRACQLGLNVTLIEKAEVGGTCLNRGCIPTKTLWKIADLYKEIRESETFGIEVNDHKLLADK
    IKHRKTEIIERLRSGVEYLFKTYDNLTFIRGEASFKDNKTVVVKTLEGETKELTADKIIIATGSKDYKPTNIEGIDHPRV
    LTSTGLLELEEIPKSMVVIGTGVIGMEFASIYSQFGTEVTVVGNKLLKTEDGEIQKRLKSILKSDTLKFVTGVYAKKIVE
    EDGRLKIISQKVGKDKFEETYADYVLVASGRSSNTDNLGLENTDIKTENNAIVVDENLQTNVEGIYSIGDCVYKNTQLAH
    VASNQGKNLVREFSGKDRNINMDIVPAVVFTVPEIASVGLTEEKAKEQNIDYVTSKFMYQANGKALSLNATEGFVKIVAT
    KDLSKILGCHIIGHDASTIIHFAAIAMNNNVGVEGLSAMIYAHPTISEVFMDSVEQLEGLSINTPNPNK

    >gi|169824207|ref|YP_001691818.1| NADH oxidase [Finegoldia magna ATCC 29328]
    MSKIVLIGANHAGTACANTILDNYKDEELVIFDQNSNISFLGCGMALWIGKQIKGPEKLFYCSKEVFEQKGATVHMETKV
    ENIDYDKKIVYAKDKNGKEIQESYDKLVLATGSQPILPNIEGMDLENVQKVKIFQDAQSVIDKINHEEIKKVVVVGAGYI
    GTELAEAFKRLGKESTLIEHGDTVLRGYYDDKFCKKMEDNLRDHGVNLVFNEEVVKLEGTDGKVNKVITDKGEYDCDMVI
    MSIGFKPNSSLAKDHLKLNDHKAIITDKHQQTSDENVFAVGDSTVIFNNATGKFEYVALATNAVRSGIVAGHNVCGTKLE
    SNGVQGSNGIKIYDLCMVSTGLTVRNAEKLGMEVEYTDFTDLQKPPFMEENNKEVTIRIVYDKNSREIKGCQIMSEYDIS
    MMIHMFSLAIQEHVTIDKLALTDIFFLPHYNQPYNYVTMAAIQAL

    >gi|169824215|ref|YP_001691826.1| hypothetical protein FMG_0518 [Finegoldia magna ATCC 29328]
    MDLKLYYKETCPFCKKVLRFIEKKGIKDVELVDIKADEANEKYLIEKGGMDQVPCLFIDEKPMYESMDIIKFLDEKFQ

    >gi|169824245|ref|YP_001691856.1| glutaredoxin [Finegoldia magna ATCC 29328]
    MKDVVIYTSDGCQYCHAAKDYMDENNVKYTEKNISQDQEARKELMKKGHMGVPVTIIGDEEIVGFDQAKLKEALGL

    >gi|169824248|ref|YP_001691859.1| hypothetical protein FMG_0551 [Finegoldia magna ATCC 29328]
    MKLKLYMSEKCPDCVDAIEILKNAGIDYEEINITDSMKNLKEFFTYRDNRKEFESIVKDNKVGVPMITDGKKIVFFEKLE
    DLRVFDED

    >gi|169824343|ref|YP_001691954.1| alkyl hydroperoxide reductase [Finegoldia magna ATCC 29328]
    MSLIKKHVEEFKVPAYHNEELTEVSSEDLKGHWSLLFFYPGDFTFVCPTELEDLQNLYSEFKELNCEIYSISTDSEFVHK
    AWHDKSEKIKKIQYPMLSDRAFALSKQFGVLKEADGQSQRGAFLINPDLDVVLYEVSADGIGRNAHELLRKLQAAQYVDK
    YGDQVCPANWAPGQDTLKPGIDLVGNL

    >gi|169824409|ref|YP_001692020.1| selenophosphate synthetase [Finegoldia magna ATCC 29328]
    MLDKKYKTIKPEDVKLTEFTQTAGCAAKIGPGKLAEVLSHLEKINDENLVVGLDTSDDCAVYKVRDDLCLIQSLDFFTPV
    VNDPYTFGQVAAANSLSDLYAMGSDPLLALNIVCFSDCMNQDILVEILKGGADKAKEAGCLLVGGHTIQDDEPKYGLSVT
    GINHPDKIWANSTAKVGDVIVLTKKLGVGIVNTAIKGGMDNQKLFDEVIKSMSTLNKYAKEACDGLDVHAATDVTGFGLC
    GHALEMAKGSDLTIEIDSKNLPIFEGVEEFVNLGLVPKGAYDNRNFIRNDVKISKNVSSFVDDVVFDPQTSGGLLIALSE
    DDANKLVKKLHESGQVGNIIGKVKEKADHFIEVI

    >gi|169824791|ref|YP_001692402.1| thioredoxin [Finegoldia magna ATCC 29328]
    MKDNKSKIFLVIGFIAVAILVMVFVKKKPNGTSEVKSTQSEQNASESSNSSEKIDTSDLNSFKEAYKQVDKEDVLFAGKD
    AGFEKFFSYDKPVFVNFTWIE
    CAPCKEMAPYIENTFDKFKGKAVVKDVEVNVNNDFASQAGIRVTPTQIFIPLKEDFKFS
    DKAKSVMDEYFQEVTVNGKKGYIHEGLLEENELEILISDMING

    >gi|169824796|ref|YP_001692407.1| sodium-translocating NADH-quinone reductase subunit E [Finegoldia magna ATCC 29328]
    MTISPLVIFFASIFTSNMIFSNFLGMCSFIAVSKEIETATGLGIAVTFVLTITTIINFFLYKLVVRFNIEYLRYIIFIIS
    IAAFVQLLEMILEKYIPNLYYALGIFLPLITVN
    CAILGVSLFMVIRNYNFLQTVGFAIGSGLGWMLAIVSMAGIRSKIKD
    TSVPAGLQGSPLTLIITGIMAMAFIGFSGIVQIS

    >gi|169824797|ref|YP_001692408.1| sodium-translocating NADH-quinone reductase subunit D [Finegoldia magna ATCC 29328]
    MANSNKYTKLLKNGLLDDNPVLIQVIGICSTLAVTNLCMNSLVMGLALAFVTGCSSFMISLLRKVTPKHIRMMVQVFIIA
    FFVIIVDIFLRAYMPEMSKTLGPYVGLIITN
    CIIMGRAEAFAISNDPVSSFVDGVASGLGYTVVLVLIALIRELLGFGSV
    FGFRIMPASFVPWTMMVMPPAAFFILPIVMWIANAHLKKEGDAK

    >gi|169824829|ref|YP_001692440.1| thiol peroxidase [Finegoldia magna ATCC 29328]
    MDKRQETTFANNPVTLLGTKVKVGDKAQDFTCLNAELKPVKLSDYDGKKKLISVVPSIDTGVCEFQTKEFNKKASEFDNT
    IIFTISCDLPFAQSRFCAAEGIDNLIVLSDHKDLDFGLKYGFVMEEFRLLNRGIVILDENNEVKYVEYVKENTNHPDYDK
    AIEALKSL

    >gi|169824832|ref|YP_001692443.1| thioredoxin [Finegoldia magna ATCC 29328]
    MIYLNNENFDEEVIQSKGKILVDFYADWCGPCQGLAPIIEEIDAENKDENIKICKLNVDGAQEISRKYKVMSIPTILVFE
    DGEIIKSTVGMVEKEYILDMLK

    >gi|169824951|ref|YP_001692562.1| methylated DNA-protein cysteine S-methyltransferase [Finegoldia magna ATCC 29328]
    MRKIYKSKLGNILIQSDGKNIIKCEFVDFFVEEGTDEIIEKCISYLDDYFSGEIIGKFENFRIEKSDYATKILMLVYEIP
    YGTTATYTDIKEKYEKIYNTKTSARAVGKAIGSNDLMILVP
    CHRVIGKNNKLTGYKFGIDKKKFLLDIEKSTKNL

    >gi|169825223|ref|YP_001692834.1| putative bacterioferritin comigratory protein [Finegoldia magna ATCC 29328]
    MNNLKEFLNEEYYDKYKGKNLVVYIYPKDNTSGCTIEADGFSEVYDEFQKLNTEVVGISKDSEKTHENFRKKQGLKQELI
    SDPERIFLNNFGCVYKGKMYGKEVTKTERSTFVFDKDMNLVKEFRKVKPDENPQEVLDFVRENLND