Fibrobacter succinogenes S85

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|261414516|ref|YP_003248199.1| Redoxin domain protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MSKIIRAICILSLFSVSAFAGPWLGLIYKKDLYQNHLALRVSGVHPESGCLAAGVVSGDLVIGFGGKDLVNVAQMQDVLK
    TAKVGSKVAIEIFRDGKRIPLTVTLTERPDDISSLTGSAIGSKMAEFGKNFYKNGEKRKDAPKATLLDFWATW
    CGPCRQT
    LPVLEKIYNKYSSQGLEVIGISSEQTKPLLAFYKKQHASPYPLYRDADQGLWRRYGIHAVPTLMLLDSNGYIKRVWSGAP
    SFEMLEKLVLEVLEK

    >gi|261414578|ref|YP_003248261.1| UBA/THIF-type NAD/FAD binding protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MAFTNEQLERYSRHIILKEVGAKGQKKLLNAKVLVIGAGGLGAPVAMYLAAAGVGTIGIADADVVDLSNLQRQIIHATKD
    VGKPKVQSAKETMEAMNPDVKVITYHTFVTSENIMDLIKDYDFIIDGTDNFPAKFLINDACVMAKKPFSHAGIIRFQGQL
    MTYVPGQGPCYRCVFKEPPPKDAVPT
    CKQAGVIGAMGGVIGSLQAMEAIKYILGVGNLLTGYLLTYNALTMEFRKIKLPT
    HTKDCAVCGDHPTIDHLIDYEQAVCEMKH

    >gi|261414583|ref|YP_003248266.1| thiazole biosynthesis adenylyltransferase ThiF [Fibrobacter succinogenes subsp. succinogenes S85]
    MRIYISATLRNFFGKNAQVSVPENTVRKALANLISTYPEGEKVLFDENNKLRSFIKIYLNGKNLNVDTLWDATLEDDSEI
    LLLPAIAGGAPIEESQSKHVESLISDERRKEVAFDDSEIERFGKHLMLKDIGVKGQKRIKAAKVVVIGVGALGSPVIQYL
    AAAGVGTIKAIDFDEVSLENLQSQVLHGTRDVKRPKVASAKDKVKNINKNIVFEAVKEQLDASNIEAEIEGYDLVIDCTD
    NYKARYLINDACALHGIPLVFGAIYQFEGQVGIFNLDGGPCLRCQYPSPPPAGLIPS
    CAEGGAISPLPGIIGSIQANEAL
    KLILGIGEHLNGKILHVDSLYLSSRIFKVERDCHCPICGNNPTITNVEDIDYEDLCGLKTTNETPVEGFTPEELAKRIDN
    GDDITIVDVREPHERAILRFPNAIVIPIGQLVRRQKELDPNKDTIFI
    CKQGKRSELAINTLREAGYTGPLYNLKGGIDAM
    KDIMFSHEGAWL

    >gi|261414651|ref|YP_003248334.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Fibrobacter succinogenes subsp. succinogenes S85]
    MADILILGHGPAGVSAALYGLRAGLEVQLVGKDVGALAKAHKIENYFGLEKPLTGAELAEVGKKQAIALGAQIVDDEVTD
    LMFDGFGFVATGLNGTYRGKVCLMATGSARKKTPLPGMAEMEGHGVSY
    CAVCDAFFYRKKDVAVLGSGEYALHEATELLS
    VVNSVTLLTNGAELTAKFPESVKIETRKITGLKGAGQFEGVKFDDGLEANFDGMFVAMGSANATDLALKAGAAFDAGKLV
    LDKDFQTTVPGLFAAGDCTGGTLQVAVAVGEGAIAGLAAIKYLREHRE

    >gi|261414986|ref|YP_003248669.1| hypothetical protein Fisuc_0575 [Fibrobacter succinogenes subsp. succinogenes S85]
    MFKRLFSLIVFAAVMGFAQFAPEPQVADIKLMMDPKTEKPMIMDFSTHLSGISDPGILFAHFSNRPLLIYYFSPKCPHCQ
    KHFPEIQNLIKEYESKGLTGIAIGLNGGIKKNDIRLFIDQYHAVIPVFQDTDSKFGPAYGTGYIPVVYLVQKDGTFYRYE
    TLNEANMNHLRATLNKILKK

    >gi|261415167|ref|YP_003248850.1| thioredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
    MAELNITRENFEQEVLKSDKPVLIDFWAQWCGPCRMLSPTISEIAEEYKDKVKVCKVNVDEEGDLAAMFRVSSIPLLVVM
    KDGKVTNSAVGVRPKDQIVKMI

    >gi|261415251|ref|YP_003248934.1| Thioredoxin domain protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MAKVVQITAENFEEEVIKASETRAVAILFSSAEYPDCAPYSQLAGQLSTSMDFTLGVVSCDDRENMRLIQMFRVQSVPEI
    HVVDKGQIADVIQGVLPEADLKKRLEKFYVSEEARFQTALEDAIAQKNFDQALPMLDEALAKNPNDKKLQLLWAKANLGL
    GDTAKAKDILSKFVESDDQYREAKSLLELLDFHAEVAKKDVQGKEAIVYHEACKLACEEDFESALQAFLNLYVEAPEWND
    GAAKKAMLTLFGVLGPKHELTWKYRAKLNTMMFI

    >gi|261415327|ref|YP_003249010.1| Peroxiredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
    MTIYDFTLTDGKGNEIPLSKFKGQVMLIVNTATGCGFTPHYKPIEKMYTDFHDKGFEVIDIPCNQFMGQTPGTDDEIHEF
    CTLKYGTTFPQMKKSDVNGPNELPLYTYLKSKIGFEGFGFGVKAAAMAMLLKKIDKDYKNNPDIKWNFTKFVIDRAGNVV
    ARFEPTAKMEDVRSCVEKLL

    >gi|261415331|ref|YP_003249014.1| Thioredoxin domain protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MNGLRKNLAMKVAIFVVSAVLAAGASEDIKIVKINDDNFEKEILHSKKPVILEVSSTSCPPCLVMIPTLIGIAKNYSDIK
    IASIGIDEPNIEKIKNTLPIQAFPTFFFIKDGRIVNQRVGVVKEPELLSALDYTPKPNATQRAKNKPKKKNAHKNLVCKV
    DGQFNGLKNLVTISFVFGDSEIENVDIVTDVFVPPEQFDKRDQMMEHIRASGKGEVTPTMTGFQMHIDNDCRFMKAMDMK
    RTSTYGEMRAGLELQGFTCK

    >gi|261415456|ref|YP_003249139.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Fibrobacter succinogenes subsp. succinogenes S85]
    MRSSTYKILAWVGAIIFLGFAFYAFEAKSRQRLNYPETVVNFTADDVMGGKSDYASEKGTATLIVLTASWCPSCRAELPI
    LKQFNEEFGPKGLKILMIDEDDSKKVARKYKRSMDIPWTMLHWNYDALKALGSPGVIPVSYVVDKDDKVQHVDVGVLNEL
    RVRHELKRLLGQ

    >gi|261415912|ref|YP_003249595.1| Thiol:disulfide interchange protein-like protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MHYSAGTLQKGSNVTVEIVIPDKWHVNANVAADEFLKPSSIEISAKGVHFGEPKWPEPHKEYSEALDLENLVFRGYFTVT
    LPVDSVEDDYDSLTTKATFHYQACDNSICLAPSQVTFGLGPLGFAKKSASRDDGAVPAAKSATSSNGNAAGNAAGNAAGS
    AAGKATGNVVNAPSAAGNASEGAAGTFILLLSALFGGLILNLMPCVLPVLSLKLFSLIKQSRESRRRLLMLGATTTLGIL
    ASFWTLAGVVAAVKAGGGNAGWGMQFQSAGFIAFMVVILSAFAMSFFGVFEIWLPGSATTKMDKAGRKQGFWGAFFTGAL
    LVLLSTPCSAPFLGTAMGFAFTASTPVLFLFFTAAGIGLALPYMLVSAFPKVLKVFPKPGAWMVTLQKIMGVLLLGTVVW
    LLWVVHEQAGNVGVGIFAAISLLSIAMSFAIGNIAPPGVAFSREVLSVGGSVVILAVIWFAFASPKFEAEVDAIFKARSV
    QLVTEDGWYRYTPELIEEFAKSGRTVFIDATADW
    CLTCKANEAAVLNRDDFKRAMDSLNVARVKADWTRETPEVTALLRS
    MGKSGVPAYAIYPAGDVSKQIVLPELLTTDGIVGKIVDSRQ

    >gi|261415971|ref|YP_003249654.1| protein of unknown function DUF255 [Fibrobacter succinogenes subsp. succinogenes S85]
    MMRACLWVVMVLNLALSAFAAPPPKPKLVHWMNYTEALEKAKDSNKLIFVDLYADWCVPCRIMDANTYSDPTVASILNTK
    FIPVKLDADSQDTIVCDGKRKTVQRCYFDVWNLSVLPAFVLIAPKGLSILTIKDSFTAEEMKYLLYQILEKEKEWISK

    >gi|261416659|ref|YP_003250342.1| thioredoxin [Fibrobacter succinogenes subsp. succinogenes S85]
    MAALNLTAESFDKVISSGQLVLVDFWATWCRPCMMMGPVIEDLSNEFDGRAIIAKINVDDEGVSDICARFGITNIPNMKL
    FKNGVEVGNVVGAVPKNTLKNAIENNL

    >gi|261417114|ref|YP_003250797.1| Rhodanese domain protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MNKLLAISFCAMLLTTACNSSEEPKPQAVAKKVEAVQPAAAVVEQKVAPITTVDWQKAFEMHKAGAVLIDVRTPAEVAKG
    MAAATAINIPLQEMPQRLSEFPKDKDLLIY
    CRSGKRSMAASKFLVENGYTRVFNVEGGILALPPQN

    >gi|261417285|ref|YP_003250968.1| Redoxin domain protein [Fibrobacter succinogenes subsp. succinogenes S85]
    MKLKKIALGAAALALVACGEAQKPIAKAAAITPDSADEQKFAYMLGAQFGLQNFSNLPWQTGYGIDEDATVQAFRDAIAS
    LNDTTAKLQLPQDTLAAVSRRIQQSMRERYFKTQPDSTAKDLTDEQRRALVDSLRKALPVEAAPAVKNEKVTLQANASEQ
    QKFSYVVGAQFGNQFFSIGNQFQTQFDGDYFVLGLRDAGKRVRDTTFTMTLPDDTLKAVGDRFMEKSKLINEERMKKAKA
    EEEKLKAEVASLRGDTLANGMPAKMNFKVKASGITVKSEDLSDFAGKPLLMFYFSAT
    CGHCAHAAPQILEIAKEFAQKGL
    TTVSIASGGNNKPGIRRFIDDAKFDETISVVWDESRQFGELYSDGYVPKVYLVNPNGTYKQYAAFEKEKEDLKKEIAELL
    NGKNVEWKIEVKKPEADSAKAPEVKQDAKKDTKSAKAKK

    >gi|261417348|ref|YP_003251031.1| methylated-DNA/protein-cysteine methyltransferase [Fibrobacter succinogenes subsp. succinogenes S85]
    MKFNDPKFTKISHRNVWGEWTFIFEGSKLCGLKFRETSDEVKATPSNVQACAYASPDMETELNSRVRSAYRKAVNELNLY
    LAGKICEFSIPIKIYGTDFQKKVLEVTRQIPYGKTCTYKQVAEAVGHPQAVRAVGNVLHNNPIQVVIP
    CHRVIDSRGRLS
    GYALGVGLKRRLLCMEGAIPNELMLE

    >gi|261417491|ref|YP_003251174.1| DSBA oxidoreductase [Fibrobacter succinogenes subsp. succinogenes S85]
    MKRLSLFAMALVVSGLVACNQASAGGSFNQQARLDSLEKDFKQVKEEFEIFKYALEKRGISLEQARAEMEADNKVWDIPD
    EDSPVFGNTKSPKLTIVEFTEFQ
    CPYCSRIAPAMQELNKKYPNEIKFVYKHFPLSFHSNAKAAAASSIAAQKQGKFWEYR
    YALAPHSRELSDSVYLAVAKEIGLNIEQFKKDMVLDSAMNARIDKDFQLGVKVGVQGTPNFYINGKRQDRFSPDLVEKML
    KEAK