Fervidobacterium nodosum Rt17 B1 uid58625

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|154248744|ref|YP_001409569.1| methylated-DNA--protein-cysteine methyltransferase [Fervidobacterium nodosum Rt17-B1]
    MDKYEIFSIRCEIGSILVYTNSEICEKISFTEESIPESGDNIFTKQIREYLNRERKILDFPVKYSSGPVFTRIWNYLRGN
    VSYGRIVTYSEIAKACKTNLRVVGYAMASNPLPLYIP
    CHRVIGSRGIGGYSGKEHNIDGIKWKKYFLTLEGSL

    >gi|154248760|ref|YP_001409585.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Fervidobacterium nodosum Rt17-B1]
    MSNMVKVDSNYKTVPEFVLKDEDGNEFSSVNLLGKYTVVYFYPKADTPGCTMEGIDFTHLIDEFEGNVIGISPDSCNAIS
    KFKSKRGLKVKLLSDPDKKVAEQFGVVKDGKLIRSTFIIDPWGRIRREWIKVSVQGHAKEVLEEYKKLVEEDKKISDNIK
    VRRAFRGIRPLPLSDEDLKKLVEAAHLAPSCMNKQPWRFVIVRTQEKLQQIHSALSEGNYWMKHAPALIVVYTKNDFGCQ
    LSDGRNYALFDTGMAVGFLLAQATQMGLVAHPVAGYDPLKVKEILGIDGIVITIIAVGYWGNFEMLNEKHTQAEQSERNR
    QPLENILKII

    >gi|154248929|ref|YP_001409754.1| dihydrolipoamide dehydrogenase [Fervidobacterium nodosum Rt17-B1]
    MFDAVIIGGGPGGYVCAIKLAHLGKNVALVEKENLGGTCTNWGCIPTKALLTATHLIDEIREKADKYGVKATFEGYDISK
    VMAHAQKSVTLSRKGIEFLMKKNNVTLIKGTAEVVNKNQVKIKESGEIFEGKNLVLAHGSVPVVFPPFDSIEGIWTSNDV
    FKLQSVPQSLLIIGGGVIGVEFATFFSSLGTKVRIVELAEHILPTEDSDVAEEVKKAMIRKGVEIQEKSKVTNIEKLEKS
    YRVTIKDNNEKENVVEVERILLAVGRRPNIPEDVRALDVEIERGIKTNRKMQTNIEGVYAIGDIRGHIMLAHVASYEGIT
    AALNIAGIEAEMDYSAVPSIIFSNPEVASVGLREKDIDHEKVKISKFPLSANGRARTMLENIGFAKVIADKETGTVLGMS
    IVSPVATELIMEGVVAVKNKLTAHQLEESIHPHPTLSETLLGALEGITDKPLHL

    >gi|154249058|ref|YP_001409883.1| carboxymuconolactone decarboxylase [Fervidobacterium nodosum Rt17-B1]
    MSDNQFNTLEEFKKFREKMNEEILKRGTTNTKRFWALDSAVYKEGAIDSKTKELMGLVASMVLRCDDCITYHMIRCAELG
    TSDEEFFEVFDVALIVGGSIVIPHLRRAVNTLLEIRRMQLNGESISI

    >gi|154249087|ref|YP_001409912.1| electron transport complex RsxE subunit [Fervidobacterium nodosum Rt17-B1]
    MASKISEFTKGIIKDNPTYVQVLGMCPTLATTTSAKNGFGMGLAATAVLVMSNVVISSIRKTVPEKIRIPIFITVIATFV
    TIVDLLMHAFTYDLWKTLGLFIPLIVVN
    CIIMGRAEAYASKHGVLDSLLDGLGMGVGFTLSLTLLGSIRELLGNGSIFDI
    TIWGKAFNMFVMILPPGAYLTLGLLAALFAAISIKKEERAKKSAQQAGQAQKVGEAK

    >gi|154249088|ref|YP_001409913.1| electron transport complex, RnfABCDGE type, A subunit [Fervidobacterium nodosum Rt17-B1]
    MKLFLILLSAMLINNYVFVRFLGICPFLGVSKRVSTALGMGIAVIFVLVMSSAISWALDLVLISMHLEFLRTIVFILVIA
    TFVQFVEAFLKKNNPTLYEALGIYLPLITTN
    CIILGIAIVNSLSKYNLLEAVFNALGAGLGFLLALIIFATIRERLELYD
    IPKPFQNLPISMIIASLLSLAFMGFQGMIK

    >gi|154249276|ref|YP_001410101.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Fervidobacterium nodosum Rt17-B1]
    MQNTNKVKVAVIGCTHAGTAFITTAKKLYGENVDISVFERNDTVSFLSCGIALHVGGVVKDPMKLFYSSPKTLAELGADM
    KMRHEVVDVDLSEKYLLVKNLETGETFKESFDKLVVTSGSWPIIPNIPGVELEGIKLSKNFYHAKDIVNYSKNAKKITIV
    GAGYIGVELAEAFKENGKEVTIIDIADRILAKYLDSEFTQILEKEMKEHGINVVTGEKVTAFEGENGKVKRVITDKGTYE
    TDMVILAVGFRPNTDLLKGKIDMLPNGAIIVDRYLHTSNPDVFAAGDSTAVWFNPSGTYEYIPLATNAVRMGTIISYNLF
    ENKIEYKGTQGTSGVKVYSYNVAATGLTENWAKEKGIAVKSIFTIENNRPEFMPEYEPVYIKIVYRTDNGQIVGGQIMSR
    ADVTESANTLSLAIQNKMTITDLAFSDFFFQPYFNKPWNFLNTAALKALESLKI

    >gi|154249318|ref|YP_001410143.1| NADH:ubiquinone oxidoreductase, subunit D [Fervidobacterium nodosum Rt17-B1]
    MANSAEYKKIWKNNIWLENPVIVQILGICSTLAVTNNLRNTLIMTIGVTLVTAFSNFTISAIRNVIPRKVRMITQVLVIS
    FYVIIVDIILRAYVPDVSKALGPYVGLIITN
    CIIMGRAEAFAQGNTPVISFWDGFTAGLGYMLILVIVALFRELLGFGTV
    LGFRVLPSSFPAWTIMVMPPSAFFVLASLIWVIRGVQLKKASK

    >gi|154249319|ref|YP_001410144.1| RnfA-Nqr electron transport subunit [Fervidobacterium nodosum Rt17-B1]
    MVPDINPFVLFFASIFTSNILLTNFLGMCSFISISKDIKSSNGLGLAVTLVMTITTAINWIIEKYVIAPLDLGYLRYILY
    IIVIAAVVQVLEMIIDRVSPNLYMVLGIFLPLITVN
    CAILGVALFMQLRNYTFLQSVFFGLGSGMGWWLAIVLLAAIRKK
    TENAPVPAPLKGVGITLITIGIMAMAFIGFAGMIKVQ

    >gi|154249385|ref|YP_001410210.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Fervidobacterium nodosum Rt17-B1]
    MIEKEVDVLVIGAGAAGLGAAIGAAREGVDKVVIVERDERSGGILNQCIHNGFGLHYFREELTGPEYAERIKNIVKQYPN
    IDVKVEQYVHGIDYRRKEVSVVSTEGVTIYKPKSLVVATGARERPMGGILVPGTRPAGVFTAGVAQRFVNLENRLPGKKA
    IIVGSGDIGLIMARRLTLEGVEVVAVVERMPFPGGLERNIRQCLKDFNIPLYLSHTVVGIYGKERLERVIIAQLDENFKP
    IPGTEKKFDVDTLILSVGLIPQSTLFKDFLKIDPWTKGIMTSSSGRTSLNWIFAAGNCTVIYDLVDWVTEEGSTSGKFAA
    MYVKNNWEPAKFSVEKGQNVGLLFPTWYEEGTNLNIYIRVKKPLEIGTIRVKQRNNLLYSKKHANLMPSEMVNIRIPESK
    IGAGDIVVEVVE

    >gi|154249433|ref|YP_001410258.1| bifunctional methionine sulfoxide reductase B/A protein [Fervidobacterium nodosum Rt17-B1]
    MKKRIVNNNLSEFEKFVLFEKGTEPPFTGEYENHFEKGIYVCKNCGIPLYNSNDKFHSGCGWPAFDDEIPGAVRKQLDRD
    GKRTEIVCAYCGAHLGHVFYGEGFTPKNVRH
    CVNSVSMKFIPEGQKPPIDRMFFAGGCFWGVEHLFKQLDGVVDTRVGYM
    GGHRKNPTYEQVCTGLTGHYETVEVIFDPLKIDEETLVKYFFEIHDFTQENGQGPDIGEQYKSVIFYTNEKQKEVAEKIK
    DELSKKYKVATQIKKASDFWLAEDYHQDYYEKTGKTPYCHYRRKIF

    >gi|154249536|ref|YP_001410361.1| OsmC family protein [Fervidobacterium nodosum Rt17-B1]
    MATARMDFYSGMLFYSKTLSGHDLIIDADPSVGGRDAGPRPKELLLYSLMGCTGMDVVSLLRKMRVIENMESFRIEVEYE
    QSQEHPKVYTKIHLKYIFKFNGEPPREQVEKAVNLSQEKYCGVSAMLKKAVPEFSHEIVYE

    >gi|154249538|ref|YP_001410363.1| thioredoxin-related protein-like protein [Fervidobacterium nodosum Rt17-B1]
    MRKIIFYLLLSLLFVSSLFGYDYTYSDLGIAHRISQIEDKILLIMFSSPSCYYCKLFDKDVITNKSVQEFLRGNYVFVKI
    EPSSYKTTFLGKSYTNNDLFSAFGVRGTPTFVFIRNKESITQVPGYMPAEDFLKALKYIIRVVEKNYKEPFDSYSKKSDD
    LKGYPKIVNVDKANSEYILKYDKNAQLVSDLPKDIDVYKVYVTKDEDVAKKLVELGAIRVLLVK

    >gi|154249539|ref|YP_001410364.1| YruB family glutaredoxin-like protein [Fervidobacterium nodosum Rt17-B1]
    MPTYKIKIYTTPTCPWCKRAKEYFKQLGISFTEVDVSKDRKGAEEMVRKSGQMGVPVIEIGNQIIVGFDKAKIDRILGIS


    >gi|154249540|ref|YP_001410365.1| thioredoxin reductase [Fervidobacterium nodosum Rt17-B1]
    MGLFDIGSAGSELKEYYDVIIIGAGPAGLTAAIYARRAGLTALVIEKAIEGGAVTQTHVVENWPGEISIEGQALGQKFAD
    HAKHFGAEIHYAFAQKVYVDGDYKVVELDDGNKVKGRVLIIATGTEPRKLGVPGEAEFRGRGVTY
    CAACDGYLFKDKDVV
    VVGGGDSACDESHFLSKIVNSITMVQNLPYLTAAKVLQERVLNNPKIKVITNHIVKEIRGTNKVEEVIIVNNETKEEKVL
    KADGVFIYVGLVPKTEIFKGFVNMNDYGYIITDENMETNVPGVYAVGDIRIKGLRQIVTAAADGAIAVEHAAKKYF

    >gi|154249541|ref|YP_001410366.1| glutaredoxin-like domain-containing protein [Fervidobacterium nodosum Rt17-B1]
    MGLLSEKDRKYLVDLFAKELENEVKLLFFHGEDCEYCDLESQLLDEVKELSDKIVVEKYHKDSEKGKEYNVEYAPALILT
    LSDGVDRGVRFYGIPSGHEFSTLIQDIITFGKGAKPQLSPETIEKLKNLDKPVKISVFVTPT
    CPYCPRAALTAHNMALAS
    DKVTAEVVEANEFFDLSEQFGVSSVPHIAINRNPDRFFIGAYPEPQFLQQVLDLAE

    >gi|154249573|ref|YP_001410398.1| glutaredoxin 2 [Fervidobacterium nodosum Rt17-B1]
    MLKIMYFKNDKCGVCTAFLPKIQRISKDYELELEVVDVVQKPEVAGQNMVFTVPTILIIDSEGNEIKRFARSFSELEIRE
    YLDRVYDILGM

    >gi|154250026|ref|YP_001410851.1| heavy metal translocating P-type ATPase [Fervidobacterium nodosum Rt17-B1]
    MELKEEKRTLKITGMTCANCARIVEKSLSKVEGVKFAAVNLATNTAFVVLEKEVDEEKLKKAVENVGYGVSDEPIEMIEE
    KRLKRIKSNMIIALALTIPLMILMFLHTSGKHIPYFKEIELIVSAIVIFYAGRDTIKGASIALLHKHSNMDTLILFGSAT
    AWSTNILTYFGTNILPFGTIGAVIVSLHLLGRYIESYLRDRASKQVRELINLQAKEALVITDKGEILMPVEAIKEGSIVV
    VKPGERIPVDGIIVEGSTSIDESMITGESIPVSKEVNDEVVGGSLNLTGAIKIKVTKVGEDTFLSKIINLIQEAQGAKVP
    IQALADRITNWFVPMIISLATISAFVWYFNFENLNMLTQSIRSFLPWTLHTSDPLSFAVFVFLTTVVIACPCALGLATPM
    ALIVGTSLAAKKGLLIRNAEAIQTAKEVGYVLFDKTGTLTEGKPQVIYTDLPESEYEKILAIENLSNHPLAKAVVDYLRT
    QINNKNNDIEIEKFEELHGKGVRARVNGDFYFIGKTENISAYEDYTINGCSIVEVRKNENILGFFAIQDVIRHDSREAIY
    KLSKMGITPVMVTGDNENTARFVAEKLGIKEVFANVKPEEKLDIVRKFQAKGKKVIMVGDGINDAAALKSADIGIAVSSG
    SDIALDNSDIIITKGGISKVVDAIEISKLTFKAIKTNLLFAFFYNVLAIPLAMFGLLHPAIAEGAMAMSSITVIINSMRI
    RKEKKPSCCS

    >gi|154250061|ref|YP_001410886.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Fervidobacterium nodosum Rt17-B1]
    MLELGQKAPNFELVDHELKPVKLSELKGKVVLAFYPGAFTSVCEKELCTFRDMMAKFNNLNATVFGISIDTPFSNKAFAE
    KNKLNFRLLSDFGGNVAKQYGGVHENFINIPNYTVAKRAVFVLDDGVVIYKWVTDNPAVEPPYEEIQKVLG

    >gi|154250120|ref|YP_001410945.1| peroxiredoxin [Fervidobacterium nodosum Rt17-B1]
    MGLPLIGEKVPEFTAKTTHGVINFPKDYEGKWVVLFSHPADFTPVCTTEFVAFQKRYDEFKALNTELVGLSIDQVFSHIK
    WVQWIKEKLGVEIKFPVIADDRGQIAELFGMIHPGKGTNTVRAVFIIDPKGILRASLYYPQELGRNMDEILRMVKGLQVN
    DTNGVALPANWPNNELIGDEVIIPPASDCATAARRMEEYDCYDWWFCHKKLK

    >gi|154250159|ref|YP_001410984.1| redox-active disulfide protein 2 [Fervidobacterium nodosum Rt17-B1]
    MDIKILGKGCPKCKALERNTEEALKELGISTNIEKVQDIDKIMEYDIMFTPALVVNGKVKISGKVATKDEIKKIIQEYIL


    >gi|154250286|ref|YP_001411111.1| heavy metal transport/detoxification protein [Fervidobacterium nodosum Rt17-B1]
    MLKKEVILEGLDCANCAAKIEDEVNKLNGVKAYMNFMNKTLTLEIESEQEYKNILQQVKTIVHKHEPDVVVKEKSVNKSN
    KKVLILEGLG
    CANCAAKIEKEISGLEGVEFAAVDFVSKKLTLEISPKVNRSELNEKIEAIVKKIEPDVKVIFEENTSKAN
    VKENNEEHSCKEK