Ferrimonas balearica DSM 9799 uid53371

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308047777|ref|YP_003911343.1| NADPH-glutathione reductase [Ferrimonas balearica DSM 9799]
    MAQQFDYIVLGAGSGGIASANRAAMRGAKVLLIEAQHLGGTCVNVGCVPKKVMWFGAQVAEAIKLYGPDYGFDTTLNQFS
    WSKLVESREAYIERIHGGYNRGLDANGVTLVKGFGKFVDAKTVEVNGEHYTAPNILIATGGRPTIPAIPGAEHGIDSNGF
    FALTEQPKRVAVVGAGYIAVELAGVLHSLGSETHLLVRKHAPLRNFDPMIVDTLVKLMAAEGPTLHTHSIPKAVEKEADG
    SLTLHLENGNSLNVDCLIWAIGREPATDKINIEASGVKVNERGFIPVDEYQNTNVPGIYTVGDIMEGGIELTPVAVKAGR
    ALSERLFGGQPEAKMDYSLVPTVVFSHPAIGTIGLTEPQAREQYGDDNVKVYTSSFAAMYTAVTAHRQATEMKLVCVGPE
    EKIVGLHGIGFGMDEILQGFAVAIKMGATKADFDATVALHPTSAEEFVTMR

    >gi|308047805|ref|YP_003911371.1| Rhodanese domain protein [Ferrimonas balearica DSM 9799]
    MAFPNLISVDELAQNLDHPDWRVLDGTWFLPGSTEDARQRHREERIPGARWFDFDDALADPDSSLPHMLPTPEQFALELG
    KLGLKPEHKVVVYDRHGLFSAPRVWWMLKAFGHQAVAVLNGGLPAWREADYPLEQGEAAAVEASHYPVPALPGQVIDAQT
    LHQQLIAGEIWLLDARAPGRFAGAEPEPRPGVRPGHMPGAVNLPFGQLLDQGKLRPVAELKARFAAVADGSKPWVFS
    CGS
    GVTA
    CVLALAASEAGHHQWRVYDGSWAEWGADPALPLA

    >gi|308047878|ref|YP_003911444.1| Thiosulfate sulfurtransferase [Ferrimonas balearica DSM 9799]
    MSQYQCLPLPQFDALLAERPAQIVDIRDPNAFAAGHIPGAQHLHNGNLAEFILNAEFDEPLVVCCYHGISSQSAAAYLAE
    QGFEEVYSLDGGYEGYAKAKGLMAP

    >gi|308047895|ref|YP_003911461.1| copper-translocating P-type ATPase [Ferrimonas balearica DSM 9799]
    MTTQLRIEGARCASCVSKIEAALTPIAGVSGVQVNLADQSVEVTGEAEPAHLIRALDAIGYPAQLQVENRETIAVPGMRC
    AGCVSKIEGALRALPGMAQVQVNLAEKTVLLTGHYDLANALEALASIGYPGELQETDPTEADAEHLTGFRQQMMQSALAL
    TLGLLMMVWGWVDGMTVESWTDQWLWGSAGALTLVMMIYAGGHYFRGAWQALKHGSATMDTLIALGTGTAWLFSMGVVLM
    PEAFPAASRHLYFEASAMIIGLINLGQALEHRAKSKTNTALRQLMALRPKTARVIRDGEEQDIPIRLVQAGDQLRLRPGE
    QVPVDGVVLEGRSLVDESMLTGEPMPVEKVPGGDLSAGTLNKQGSLIMSAQRVGADTALAQIIELVRHAQSSKLPIANLA
    NRISAVFVPAVVVIALLSATVWFLWGPDPRLSHALVVLTTVLIIACPCALGLATPMSVINGVGKAAQLGLLVREGSALQT
    ATDLTALVVDKTGTLTEGRPSVTDQIPVPGIESPRLLIQAAALEQGSEHPLAEAILRAAQKEKLPPLDAFEAHTGLGVEG
    QVDGQHLILGNHAMMTQWQVDTRPLDAEVARLASEGKTPVYLAAEGQLQGVLAIADPIREDAGSAIERLHRQGIKVVMLT
    GDHPDTAAAVARQLGIDQFEAQMRPEDKVRILTSLQQSGDKVAMAGDGINDAPALAQADVGFAIGSGTDIAKASADIILI
    RSSLHGVADAIALSRATLRNIKQNLFGAFIYNSLGIPIAAGVLYPLTGTLLNPVVAGAAMALSSLTVVTNANRLRWFTPR
    R

    >gi|308047950|ref|YP_003911516.1| selenophosphate synthase [Ferrimonas balearica DSM 9799]
    MSHIKLTEYSHGAGCGCKISPKVLDTILASQLPSFTDPRLVVGNASRDDAAVYALDDQTGIISTTDFFMPIVDDPFTFGR
    IAATNAISDIYAMGGTPMMAIAILGWPVNLLAPEIAQQVVEGGRAACRDAGILLAGGHSIDAPEPIFGLAVTGQVPLSRL
    KRNDTAKVGDKLYLTKPLGIGILTTAQKQKKLADEDSQIAIDAMCQLNTIATKLAPIAGVNALTDVTGFGLAGHLIEVCQ
    GAKLHARIDFDALPRLDQVDHYLARGCVPGGTGRNFDSYGQHIGPLSDDQRALLCDPQTSGGLLVAVNAEAEAEVVACLR
    DAGLPHQCIGELYQGGDAPLVTLR

    >gi|308048026|ref|YP_003911592.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Ferrimonas balearica DSM 9799]
    MKRAALFVPLFIFLGLSVFLFKGLFLDPSKLDSVLVGNPVPTFELETLEDAGVKITNEDLLGDVYLINVWATWCPSCKYE
    HPFLNQLQRQGAIKIYGVNYRDERDLAIRYLAQSGDPYTRNIFDPEGTLSFDMGVYGAPETFVVDHNGIVRHRFAGVLEP
    QVWAKDFMPLIQQIRAEAAAEGNS

    >gi|308048028|ref|YP_003911594.1| Redoxin domain protein [Ferrimonas balearica DSM 9799]
    MKVVVYLVLALLSSSAFAYPGATKVAEDPALSRFIHLSKPQDLDSVQLVAPDGQPIQLSDLKGQPVMINLWATWCPPCVR
    ELPSLARFRADFEARGLKVVPIAIDYDPAVVQPFLNQLELPEFRTWYDSVNAMGQIVPTDLVPATYILDEQGRLVAFVRS
    FVDWDNAAVREVMERYLPAAKSQ

    >gi|308048094|ref|YP_003911660.1| dihydrolipoamide dehydrogenase [Ferrimonas balearica DSM 9799]
    MSNEIKTQVVVLGAGPAGYSAAFRAADLGLETVIIERYSTLGGVCLNVGCIPSKALLHIAKVIDEAKVMADHGVTFGEPN
    IDLDKIRAHKEKVIGQLTGGLGGMAKMRKVKVVNGNAQFTGANSIDVTAEDGSVTTVKFDNAIIAAGSRPIQLPFIPHED
    PRIWDSTDALELKEVPGRLLIMGGGIIGLEMGTVYKALGSEVDVVEMLDQVIPAADKDVVRVFTKRMNKKFKFMLETKVT
    AVEAKEDGIYVSMEGKKAPAEAQRYDAVLVAIGRTPNGKLLAAENAGVAVDERGFINVDKQMRTNVPHIYAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTDPEIAWVGLTEKEAKEQGLNYETATFPWAASGRAIASDAADGMTKL
    IFDKDTHRIIGGAVAGTNAGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVYEGSITDLPNPKAKKK

    >gi|308048131|ref|YP_003911697.1| glutaredoxin [Ferrimonas balearica DSM 9799]
    MFVIRWILGRIVLLVNALTAPKPAQRPAEQQAKLDQAMARYSLYQYDACPFCVKVRRALRRNNFNIELRDAKQEPHRSEL
    EAGGGRLMVPCLRIEEAGEVRWMYESSDIIAYLEQQYGDQPQAA

    >gi|308048141|ref|YP_003911707.1| glutaredoxin [Ferrimonas balearica DSM 9799]
    MGKKGAAALALVMLVALMGFSVYQLGAGNRLALSFNEAHDSEVVMYSAAWCPACAATRDYLTARGQSFVELDMEKNPAAA
    QEFAQFGGHGIPLVLAKGEVIRGHRPSELNRILAPLQP

    >gi|308048202|ref|YP_003911768.1| cytochrome c biogenesis protein transmembrane region [Ferrimonas balearica DSM 9799]
    MTKTLTRLLLLPLLGLLSLGASANFSFLKQEPQVLPVDQAYLFDFRQQDNALQLTWTMAGDQYYLYQDKFVLKVEVDGSA
    ELGPIQYPSPVIHTDEFFGDQPVYFNDVTLTIPVLEAQGEAAVTVTYQGCLDKVLCYPPTKQTVYLSAVAANDGLLTTAA
    PAPAAPQTQQDGLAALLAGDGLLLPLVTFFGLGILLAFTPCVFPMYPILTGIIAGQGKKLSTGKAFALSMTYVQGMALTY
    SLLGLVVASAGVKYQAALQSPAVLIGLAILFVVLSLSMFGLYNLQLPSSLQGKLANAQNQQKGGSFIGVFVMGLISGLVA
    SPCTTAPLSGALIYVAQSGDLVLGGLALYALSMGMGLPLLLLGTSGGKLLPKAGAWMEAIKHVFGFLLIAVSIMMLDRLW
    PGTIMDVIWALWGVALAGYLLHQNKKTAFSWMQTVRNVVVVLGLFASVSYGFHAVMNRGETLASAQHAVQFIKVKTVQDL
    EREVAKAGAEGKTVMLDLYADW
    CVACKEFEHKTFPQPQVTARTDKMVLLQADVTANDAQDIELLESYQVLGLPTLLFFTP
    EGEELNQLRVTGFMGPNPFADHLDAVLAQ

    >gi|308048289|ref|YP_003911855.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MDQHKLAAGDRFPELHVTTFEGESVRLGQPRPDSGANWQMVVVYRGRHCPLCTKYLNQLEGFREELLEIGVDIVAVSADS
    QAQLAAHKSQLEVGFPLAYGLTQDQMEALGVYISLPRSEQETDHNFAEPGLFVVNEEGNLHVVDLSNNPFVRPELQALVN
    GLRWIRDPGNHYPIRGTRKDVDSQLQYR

    >gi|308048392|ref|YP_003911958.1| hypothetical protein Fbal_0672 [Ferrimonas balearica DSM 9799]
    MKKIALALLAAGLVSGVAQAQPLDHKRMLATMGGVDQPTMANPHGSPHGAAPMQDAVLTGELDPNKLIFELVPMGRSYLE
    YQVDTAALAPLQGYDKPTEITVVVGTW
    CGDCHTHTPAFIKIMKALNNANIQVRYIGVDKQGKAGDVSLDSIEFESIPTFI
    VSQGGKEIGRIAGAPKASLEQDLVAILTQ

    >gi|308048410|ref|YP_003911976.1| glutathione peroxidase [Ferrimonas balearica DSM 9799]
    MKPLLPLLLLASASVSAAQCPAWLDTEKRRLHSKESVNLCELTANKAVLLVNTASHCGFTPQFKELEALHQQYGADGLVV
    IGMPSDDFFQEADDEAETAEVCYRNYGVSFTMLTPAAVRGSDADPIFAELARQGGAPKWNFYKYLVDQDGKLVDYWSPKT
    DPSDPEITGAIESLLNGS

    >gi|308048616|ref|YP_003912182.1| NADH:ubiquinone oxidoreductase, subunit D [Ferrimonas balearica DSM 9799]
    MAEKTLKEVLVGPIFGNNPIALQVLGVCSALAVTTKMETATVMSLALIFVTAFSNLFISLMRNHIPGSVRIIVQMTVIAS
    LVIVVDQVLKAYAYDISKQLAVFVGLIITN
    CIVMGRAEAFAMKSPPLVSFVDGIGNGLGYGFILLTVGFFRELFGSGSLY
    GVEILAKASEGGWYQPNGLMLLAPSAFFLIGFIIWALRTWKPEQVEPKE

    >gi|308048617|ref|YP_003912183.1| NADH:ubiquinone oxidoreductase, subunit E [Ferrimonas balearica DSM 9799]
    MEHYISLFIRAIFIENMALSFFLGMCTFLAVSKKVTTAMGLGVAVIVVLTLAVPVNQVIYSNILAPGALKWAGLPEADLS
    FLQFITFIGVIAALVQILEMTLDKYFPPLYNALGIFLPLITVN
    CAIFGAVSFMAQKEYTFTESVVYGLGAGTGWALALVL
    LAGIREKMKYADVPDGLRGLGITFITAGLMALGFMSFSGVSL

    >gi|308048903|ref|YP_003912469.1| Thioredoxin domain protein [Ferrimonas balearica DSM 9799]
    MQDTIVNVNVSNIQALVDGSMTRPLVLNFVSGQVPECQGVTAALTAEAQRRQGQFVLGNVDCDAEMDLAQYFRIQALPTV
    LILVKGQPVDGFAGPQPAEMISQVLQKHLPAGWELKLQEAAPLLESKAYDQALPILRDALAEEANAATRLALAEALLGLK
    RAEEAEGLLTEIGLADQDSRYQSLMSQLQLLKESADTPEIRALQTQLESEPDNQGLVVELAVQLHQAGRNEEALESLFVL
    LKRQLDAANGEARSTFLDIVKALGPADPVAAAYRRRFYGLLY

    >gi|308048981|ref|YP_003912547.1| arsenate reductase [Ferrimonas balearica DSM 9799]
    MTTSPVIIWHNPRCSKSRQTLALLEEQGLTPEVVKYLETPPSAEQLHDVLAKLGLSPRQLMRTKEAEYKAQNLADADDAA
    LIAAMVATPKLIERPVVIHGNKAALGRPPEAVLEILA

    >gi|308049001|ref|YP_003912567.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MQPLQAGDKAPQFTLKDQNNNDVSLADFAGKKVLVYFYPKAMTPGCTVQAQNLRDVKAQLDDHNVVVLGISPDPVKRLAK
    FAERDELNFTLLSDEDHAVADAFGVWGLKKFMGREYDGIHRLSFLIGPDGTVEQFINKFKTKDHHQVVLDLLG

    >gi|308049097|ref|YP_003912663.1| peptide methionine sulfoxide reductase [Ferrimonas balearica DSM 9799]
    MRQPPLTDDEQQVLEEKGTERPFSGRFLSLDDQGTYCCRRCQSPLFRSEHKFESGCGWPSFDDEIAGAVRRETDADGRRT
    EILCAQCGGHLGHVFEGEGLTAKNLRH
    CVNALSMSFAPSAEAGEQWAVFGGGCFWCLEALFQRLQGVSSVTSGYAGGEQE
    RADYRSVCAGDSGHIEVIRIGFDPAIISFGQLLELFFDCHDPTSWDQQGADRGSQYRSAIFCQDDTQRQIAQQQITALEQ
    LGRGRIVTELRGNEPFYPAESEHQNYFNQHSNQPYCHWNIKPKLAALMAKYSDRVRPEGGA

    >gi|308049376|ref|YP_003912942.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MRLSALALGLALTLSLPAGATSHLEKAYNTGEPIMKPMVLSRLIEFTQARKVPDLSFNNEAGEPVSLTQYQGDVVLLNLW
    ATW
    CGPCRKELPEMEALRQHFAGKGLTVVPLNIDQEGELPADVRALLTKLDLPELNTLYDPEHTIGNTVPVNVVPATYLF
    DGEGHLVGFVRGYLDWEAKGVIPYLEKFVDKYQHPHKG

    >gi|308049380|ref|YP_003912946.1| Rhodanese domain protein [Ferrimonas balearica DSM 9799]
    MTKLIRAIALLCCCAIPMAMAGAGGEMRPAPVYDTEINYMSLAQAEQRLGHPGVRFYDVNVLEIWADGYIPGAIHFFVDN
    WKDLLPEDKGTEMIFYCANRL
    CNASEIAAHAVKAMGYTNVSQMPDGIFGWKMSGRAVEKP

    >gi|308049387|ref|YP_003912953.1| Rhodanese domain protein [Ferrimonas balearica DSM 9799]
    MNALFKALAILACLLSPTALAGAGGEMRPAPVYETEINYMSLAQAEQRLGKPGVLFYDVNVLEIWADGYIPGAIHFFVDN
    WKDLLPEDKDAEMIFYCANRL
    CNASEIAAHAVKAMGYTNVSQMPDGIFGWKMSGRVIEKP

    >gi|308049443|ref|YP_003913009.1| Disulfide bond formation protein DsbB [Ferrimonas balearica DSM 9799]
    MLDRLAALPQQRAAWLLLSLSAFGLMGAALVFQYVYELGPCVMCIYIRVAVCAIGLAALVPALLPSSALARLIGWIGWIV
    GAGWGAKIAWQLVEKQSTPPEGFGLFGAS
    CDFIPDFPSWLPLHHWMPALFEPTGDCTDKAWEWLGVTMAQWTLVSFALYL
    MAAALVLTAVLLRRR

    >gi|308049450|ref|YP_003913016.1| glutaredoxin-like protein [Ferrimonas balearica DSM 9799]
    MDTVEKIKSQIAENPIILYMKGSPKLPSCGFSAQAAQALMNCGEQFAYVDILQNPDIRAELPAYANWPTFPQLWVEGELI
    GGCDIIMEMFQKGELQALIKETAAKSAAAE

    >gi|308049462|ref|YP_003913028.1| Redoxin domain protein [Ferrimonas balearica DSM 9799]
    MSQLMFRILALCTALLILPARAEPAPDFALTLEGNATTVVQLSREKLVYLDFWASWCGPCRFSFPFMNELHQELGPKGLV
    VVAVNVDVDPHDAKPFLAKYPADFTIHYDPEGTIAEAYQVPGMPTSYLIRDGEILLRHVGFRKSESDKLKAEVADYLP

    >gi|308049538|ref|YP_003913104.1| sulfur relay protein TusD/DsrE [Ferrimonas balearica DSM 9799]
    MSQFVLFVNGAPYGSQHAYSALRFAEAALDAGHQVRQVFFYQDGVYNASRLLCPASDEFDLAARWDALHQRDVALVSCVS
    AGLRRGVIDVEAAEDADLDAANLSASFILGGLGEYVTAAANADRTVQFG

    >gi|308049605|ref|YP_003913171.1| Peroxiredoxin [Ferrimonas balearica DSM 9799]
    MSGNIYQFSADLNGGEPQSLEAYRGKVLLVVNTASACGFTPQYEGLQKLQNEFGERGFSVLAFPCNQFGNQESGDDEAIR
    GFCDLRFNIDFPLFSKIDVNGNNAHPLFEWLKAEKGGWLGDNIKWNFTKFLVDREGRVVERFAPTTKPESIAGAIEKLLA


    >gi|308049619|ref|YP_003913185.1| heavy metal translocating P-type ATPase [Ferrimonas balearica DSM 9799]
    MSSVRCYHCDEPVPANAPFSATIDGVAQPMCCPGCAAVADAIVAAGLSDYYRYRTEKGQQQDVPEALASLIAYDLDEVQQ
    EFVAARGDLKEVLLSVEGIS
    CAACAWLIEKHLAALPGVAQISVNTTTQRAVLRWDASQQKLSDLLLSMNLIGYQAAPFQQ
    DAQEAKNARESQNFLLRIGLAGLATMQVMMLAVALYTGYFYDLEPEYRDYFRWVSMIFATPVVLYSAQPFYFSALRALMS
    LRVNMDVPVSIAILLAYVASCVATARGTGEVFFESISMFTFFLLVGRFFEQRARRKASENASNLQKLIPATALLLEDGDA
    RQVAAKSLKPGQVYRVLPGQRIAVDGVLLSGQSGVNESMLTGEQEPVQKQPGAPLYAGTVNLDQTIEVEVTKVGAEQRIN
    TLVRLQEQAAAQKPQIAEFADRVAQYFVPVILVLALVTYLVWHQLAPEDAFWIMLSVLVATCPCALALATPAALTCGTNR
    MMQQGLLVKSARVLEALPRIQHLLFDKTGTLTEGQLSVKTVHGFDSAVSETQLLALAAALESHSSHPVARAFALHRDASI
    QASDVNNHTGQGLEGVIHGQHYRIGQQAFVGTDLGQSGWVFLARDGKVIGAFELADRLRSDAADTISKLSGQGLKCEMLS
    GDPNPRALELAEQVSLKTAHYGCSPEQKLARVAELQRQGCQVAMFGDGINDAPVLAGANVSVAMGSGTDLAKCHADLVLL
    GDKLGPVVNAIETARQTNRVIRQNLAISLCYNLLILPLAVSGNVPPYLAAAGMSLSSLVVVANSLRLLKKTS

    >gi|308049666|ref|YP_003913232.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MLKQGVIWVVILGLAIWGGGWLRGLAMTPVGEPAPHAIVAGWEGGSQALPQAGQRQLLYLFAPWCQICDLTIDHVDALRE
    SGRAVHLVALSFEDRAEVAEFLDGHPELGPVWLGNNQLARDYQVPAFPAYVIVDEEGSVLARRVGYLPGWALRLYLAWYG
    V

    >gi|308049691|ref|YP_003913257.1| thioredoxin reductase [Ferrimonas balearica DSM 9799]
    MSDVKHCQLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGDPEGLTGPGLMERMKAHAERFETEI
    VFDHINEVDLKSRPYRLKGDSGEYTCDALVIATGASAKYLGLESETAFQGRGVSA
    CATCDGFFYRNKPVAVVGGGNTAVE
    EALYLSNIASEVHLIHRRDSFRAEKILVKRLMDKVANGNIVLHTDRTLDEVLGDEMGVTGARIKDTRSEATEELKVDGVF
    IAIGHQPNTQIFEGQLEMKDGYILVQSGLEGNATATSVPGVFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDAQ

    >gi|308049743|ref|YP_003913309.1| (sulfur carrier protein ThiS) adenylyltransferase [Ferrimonas balearica DSM 9799]
    MLSDNDYLRFGRQLLMPQWGEPGQGQLARQRVLLIGLGGLGCPALQYLAGAGVGQLRLVDADTVSLSNLPRQTLYRPDQV
    GELKVTAAAQWVAAHNPGLSVEAIAGMATAERLPALLEQVDVVLDCTDQLASRHAINAACVAWGVPLVSGAAIGWQGQLM
    VIDPVNTPASACFACLSDPNETATPDS
    CQQAGVAGPVVGAVGTLQALLALRLLLGQPVQTGLHRFDGLQFQWQRFELSPV
    AECPVCSDSRSL

    >gi|308049870|ref|YP_003913436.1| OsmC family protein [Ferrimonas balearica DSM 9799]
    MADKQYRITSSMTHGWKVTADVRGHKMVIDQPSATDEGANPLETFLFSLAGCLSAIAKMAARDEGITLRGIEIDVTGVLN
    PAGLAGKPSEDPVGFKSIDATARIDADLSDEEKAAFFGRVCHRCPIHDNLLRPTVVTHSA

    >gi|308049946|ref|YP_003913512.1| electron transport complex, RnfABCDGE type, A subunit [Ferrimonas balearica DSM 9799]
    MTEYLLLLVGTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATAFVLTLASTCSYLVHQYLLVPLELTYLRTLSFILV
    IAVVVQFTEMVVRKTSASLHRVLGIYLPLITTN
    CAVLGVALLNINEQHDFISSVLYGFGAAAGFALVLILFSAMRERLAA
    ADVPVPFKGASIAMITAGLMSLAFMGFTGLVK

    >gi|308049951|ref|YP_003913517.1| electron transport complex, RnfABCDGE type, E subunit [Ferrimonas balearica DSM 9799]
    MSQFREIAWQGLWKNNPGIVQLLGLCPLLAVTNTLTNAMGLGLATLVVLVSSNVLVSLLRKGIPNEIRIPVYVMIIAALV
    TCVQLLVNAYAYGLYLSLGIFLPLIVTN
    CVIIGRAEAFASKNPVGAAALDGLMMGTGFMLVLMILGGTRELIGQGTLFDG
    ADQLLGDWASVLRIQVMHLDSPFLLALLPPGAFIAMGLLIALKNVLNEKLEARIKPADKAVEKVERVRVTQ

    >gi|308049990|ref|YP_003913556.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MSVLVGRQAPDFTAAAVLGNGEIVDSFNLHSAIKGKPAVVFFYPLDFTFVCPSELIAFDHRIEEFQKRGVEVIGVSIDSQ
    FSHNAWRNTSVENGGIGQVRYPLVADVKHEICQAYDVEHPEAGVAFRASFLIDKEGLVRHQIVNDLPLGRNIDEMLRMVD
    ALQFHEEHGEVCPAQWEKGKQGMDASPDGVARFLSEHAEGL

    >gi|308049993|ref|YP_003913559.1| glutaredoxin, GrxA family [Ferrimonas balearica DSM 9799]
    MFVVIFGRPGCPYCVRAKQIAESLQETREDFKFRYVDMHAEGVSKEDLEKTVGKPVHTVPQIFIDQNHIGGCDDFEAYAK
    ENLGLYA

    >gi|308050070|ref|YP_003913636.1| peptide methionine sulfoxide reductase [Ferrimonas balearica DSM 9799]
    MSQYRIATLGAGCFWGVEHFLRQIPGVKAVVCGYMGGHVEHPTYPEVKSGQTGHAEVVQVEFDPNEVDFETLLTFFWQHH
    NPTTLNQQGEDIGSQYRSVIFFHDETQRLAAEVSKATQQRDGYWKAKRIVTEICPASTFWRAEEYHQNYLARNEQPSCHL
    PFY

    >gi|308050072|ref|YP_003913638.1| Redoxin domain protein [Ferrimonas balearica DSM 9799]
    MIAVGQPLPPIEFTRLSADGMETLDNRYFAGRTVVLFAVPGAFTPTCSEAHLPGYVVLADKLKAAGADAIACVAVNDAFV
    MKAWGDSQNADAIDMLADGDGSAHKAMGLSMETGAFGGTRAQRYAMIVKDNVVTVLNVEAPKAFEVSDAETLLKALNP

    >gi|308050147|ref|YP_003913713.1| arsenate reductase and related protein [Ferrimonas balearica DSM 9799]
    MILYGIKSCDTVRKARKHLDAKGCTHTFHDFREAGLDDATLTRWLAQVPYTTLLNTRSTSWRALDDAAKQDLDADKAKQL
    MLDNPTLVKRPVLEAGDALMVGFKAADYDQWVAQHG

    >gi|308050358|ref|YP_003913924.1| Rhodanese domain protein [Ferrimonas balearica DSM 9799]
    MRKWLVSLVLAMGVQGGVIASERAETAWHWVEEGALLVDVRTPGEFAAGHLPGAINIPLDQLPGRLDELGDSKSQPIVVY
    CRSGNRSGQALNWLSRQGYQQVQNGGGLEEMRSSQH

    >gi|308050468|ref|YP_003914034.1| iron-sulfur cluster assembly protein IscA [Ferrimonas balearica DSM 9799]
    MGISLTEAAAERVKTYLKNRGKGIGLRLGLKTSGCSGLAYVLEFVDDLSPGDEVIEAQGVNLIIDAKSLVYLDGLEVDYV
    KEGLNEGFKFENPNAKGECGCGESFTV

    >gi|308050702|ref|YP_003914268.1| DSBA oxidoreductase [Ferrimonas balearica DSM 9799]
    MKKILGIALALMLAGCSESAPEAPAKAETAAPQAAAQAAPKAAQTSHFKEGVHYQVVNPAGKVEQPTITEFFSFYCGGCY
    NMEARFLPTIVPALQEQGLKFEQKHVNFARNDADFQTYQAVIRAFATVQEMGEAGKIKDPMFALMGGKDHNHTAGDKHGE
    GINSLADVRAIFVENGVDAAKFDAIAETPAITEQVELWNKEQRLYQVGSIPAFVVNNKYLINLNNVQSVGELVDLMAYLA
    TK

    >gi|308050747|ref|YP_003914313.1| methylated-DNA/protein-cysteinemethyltransferase [Ferrimonas balearica DSM 9799]
    MTQHYQSWLDTPVGRLVIDANAQAILAVTFTEPQSAATESALTRQAKAQLLEYFAGQRQHFDLPLAPAGTPFRQSAWQAL
    CTIPYGQTRSYGEQAEVMGKPTAVRAVGAANGANPIAIVIP
    CHRVIGKNGSLTGYAGGLDRKAWLLALERGEVRA

    >gi|308050764|ref|YP_003914330.1| peroxiredoxin, Ohr subfamily [Ferrimonas balearica DSM 9799]
    MSLYTATAFASAGRNGQARSDDGLLDLSLTYPKALGGSGTGTNPEQLFAAGYAACFSNAILYVAKEQGVALTEAPVTGQV
    SLLPQPVGFALGVSLAVELALPQAEAEALVATAHQV
    CPYSNAVRNNIDVAIDVKGGA

    >gi|308050772|ref|YP_003914338.1| Disulfide bond isomerase, DsbC/G [Ferrimonas balearica DSM 9799]
    MRLPFTPLLGAMLLMVSGSSLAQTPEQTVTDALKQKLGLTADSVSEAPVAGLYEAITNQGIFYVSADGSMLIHGQIYDLN
    NGMKNLTEQRMSKLRLEMLDAVKGTSIEFKAKNEKHVVYAFTDIT
    CGYCRKLHNEIAEYNDLGITVRYLAFPRGGERNRA
    GQVNQSWTDMQNVWCAKDPQAAMTAAKAGEKVPDVTCATGEVVKRHYELGNSMGVTGTPALVLEDGTILPGYLPPSRLLQ
    ALESQ

    >gi|308050810|ref|YP_003914376.1| iron-sulfur cluster assembly accessory protein [Ferrimonas balearica DSM 9799]
    MTVEAEQAMPIQFSDAAAAKVKALLAEEENPELKLRVYVTGGGCSGFQYGFTFDEKVNEGDFTIEKQGVTLLVDSMSLQY
    LVGGVVDYTEGLEGSRFFVNNPNATTTCGCGASFSI

    >gi|308050836|ref|YP_003914402.1| hypothetical protein Fbal_3129 [Ferrimonas balearica DSM 9799]
    MARLFTLLLLCSLSLFARADAPVTWTAKDAQGQPEITLYFFWSQTCPHCAEAHPFVDALAEHYPWIKLEAHKVSDADTLP
    LWRSVAAETGVPANSVPYLAYCGQATVGYNGHGVTGQFLLSQLKACYERNGGVLDPNDPGLGEEFASSAPAEGGMFSTCS
    SDSGEGTCGLDSSEAAPATAIQPVNLPFIGMVAPESLSLPVLTVVLAGVDAFNPCAFFVLLFLLSIMVNAKSRTRMLIVG
    GIFVFFSGFIYFLFMSAWLNIFALLGGSDGGWIMMAAGFLALTAGFINLREYVTQKGDVSLSMSAENRGALIKRMGQLTK
    ASSLPTMIAGTVVLSILANTYELLCTAGFPMIYTSVLTLHDLPSSERYFYLVMYNLVYVIPLALIVLVFSLTMGKRKLTE
    KEGQTLKLMSGIMMMGMGAMLVIDPMLLQNAVLAIGLIVASIIVTLVVATARKTLEKRRASQG

    >gi|308050939|ref|YP_003914505.1| thiosulfate sulfurtransferase [Ferrimonas balearica DSM 9799]
    MQLKSISLIMLLGCSLSGGAMAYDSALAQSYQKQFANVEGAAAGKNLGLMSPAAFVDATKAGKEMVALDIRTEAEMALFG
    LTLPHSLNIPANELFLPENLAKLPTDKPVVVF
    CKSGARATALGTALRHAGFDNVKILKGGFKGLAAYLGPKEAN

    >gi|308050959|ref|YP_003914525.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Ferrimonas balearica DSM 9799]
    MTARMWLAAITTLFFSLLPLTSHARIAPAPEQVSPLLNGMMLPDATVQDSAGRSLSLAGLAADKPTLVLFYRGGWCPYCN
    AQLAGLQEVEKELAELGVQVLALSPEPADRLKEGEGKGRYQLLSDRNLEAMQAFGVAYALDEQTAGRYKGKMGARLKLDG
    EERVILPVPAAYLLDAEGRVQFSYVNPNFRVRVHPQLILTAARLMLAR

    >gi|308051261|ref|YP_003914827.1| hypothetical protein Fbal_3556 [Ferrimonas balearica DSM 9799]
    MKRTLLALVLAPLMMGPAMAAQGGCGFDNQAEGGLFATCEEEKKEVILTGLLGFEELRQQPGYEANFDAYQADAALVAKL
    AAIDTPTELVVIVGTW
    CPDCHRETPRLAKILAEANNPNLSVKYIGIDRSRTDPEGLAAQYDFQRIPTVLVFQEGEEQGRI
    VERPTSETLEQDLMNILGTTE

    >gi|308051264|ref|YP_003914830.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Ferrimonas balearica DSM 9799]
    MKILIIGAEAAGMSAAAKARRSAPDATITVFEQGEVVSFGACGLPYFVGGSFDEPGYMAERSVEQFRASGIDLRTGHRVE
    RIDAQAKLAVVTNLASGERFEQPYDKLMIATGASVVRPPVAGLELANVHFLKSMDDGLALRALAEQDAIQNVVVIGAGYI
    GLEVVEAMHHRGKQVRLVELADRVLAESFDSEMSDIIEAAIRRHDIALHLGERVEALEGEGTVTQVRTDKGVYPADLVVV
    ATGVRPTTEFLADTGIERLANGAIVIDEQGRTSLPDVYAAGDCATVWHRVRQQAVYIPLATTANKIGRLVGENLCGAEKA
    FPGTLGSAGVRVLDVEAGRTGLGLREAEALGLDVKSVVIDDKNTTNYVPGQAPIRVKLVYEAGTKRLLGGQLAGGEGAVL
    RVDTLAAAIQGNLTTADLGMMDLVYAPPFARTWDALNVAGNVAK

    >gi|308051268|ref|YP_003914834.1| thioredoxin [Ferrimonas balearica DSM 9799]
    MSDKIVQLSDDSFETDVLKADKPVLVDFWAEWCGPCKMIAPVLDELAEEYGDQLTIGKLNVDQNSETPPKYGIRGIPTLL
    LFKDGQLAGTKVGAASKTQLKEFIDAHL

    >gi|308051371|ref|YP_003914937.1| DSBA oxidoreductase [Ferrimonas balearica DSM 9799]
    MKNLLALAFALVLAPLSAYAADFKEGTHYTTFNQSPYSGQPTVTEFFSFYCPHCYTFEKNYVPQIKAGLAEGVKFEQNHV
    DFIGREMGPEMTRALAVAEVLKVEDTIKPAMFSAIHDARRTFASRNDVRQLFVDNGVSATDFDKAANSFMVNSMMKKWKK
    AQQDSGIRGVPALMVNSKYVVDVGSVQSLAELTELLNYLAKKG

    >gi|308051374|ref|YP_003914940.1| protein of unknown function UPF0061 [Ferrimonas balearica DSM 9799]
    MPWLGSAVMPLPLDAPRWVGWSDEMGQRLGLEQDDAALAQLSGATASLPWPPFAQVYSGHQFGGYTPRLGDGRGVHLGER
    NGLEVFLKGSGPTPYSRGGDGRAVLRSAVREFLASEALHHLGIATTRALAVIGSDTPVWREEQETGAITVRVSESHLRFG
    HFEYFLYTRQQSQLEALIEDTIDHHFAGVRSESDAKLAWLVEVVERTARTVADWQAFGFCHGVLNSDNMSILGETFDYGP
    FAFMNRFDPGYICNHSDHEGRYAFDQQAGIGLWNLNRLAITLTPWLDETAIRQALACYEPVLVERYLARMGARLGLPDPT
    AEDLPLIAELLNRMAEGGLDYSNTLREFAQLDPTSQDTPLHRRFAGVAGFSDWWQRYQQRLGGVDGLADWQARRSEANPA
    LILRTHLAQEAIAAAEQGDNDPLHRLHRALCRPYDPEPEFDDLRGDAPSWSQQLTLS
    CSS

    >gi|308051375|ref|YP_003914941.1| DsrE family protein [Ferrimonas balearica DSM 9799]
    MTSILLVAHDSPYGSERLYNALRIALATQEHAEQPVQQKLFLMSDATVAALSGQQTPDLSYHIGQMLEILLAQGVEIAVC
    RTCAEARGLTPDRLIEGVTIGTLVDLTRQTLAADKVIHI

    >gi|308051434|ref|YP_003915000.1| (molybdopterin synthase) sulfurylase [Ferrimonas balearica DSM 9799]
    MDEILSDQELLRYNRQIVIRAFDMDGQEALKQAKALVLGAGGLGCAAAQYLVTAGIGEITLVDFDHVELSNLQRQVLHRD
    SRIGINKARSAAEELSGLNPHVTINVVDRLLDEPELAAAVAEHSIVLDCTDNLMTREQLNRFCFEAKVPLISAAAIRMEG
    LVTVFDYGEDKPCYQCFASLFGEQQLS
    CVESGILAPVVGMVGCLQATEAVKQISGMGRTLSGRILMIDAMTMEFREMGLP
    KRPGCPVCG

    >gi|308051456|ref|YP_003915022.1| Rhodanese domain protein [Ferrimonas balearica DSM 9799]
    MQEYIDFFARNPVLSLIWVALLAMFIMSLVKSKLTKFKTVSHQQATLLINRQDAKVLDVRGADEFKKGHIVDAINVPLSQ
    IKNNQLGAVEKFKNDPIIVV
    CNAGISSSQAAQVLVKAGFEQVYNLHGGMTDWNAANLPVVRKKKR

    >gi|308049537|ref|YP_003913103.1| sulfur relay protein TusC/DsrF [Ferrimonas balearica DSM 9799]
    MTESSLNLAVVFRTAPHGSARGREGLDLLLLSASYDQQCAAVFIGDGVYQLCQGQQPGLIDAKDYIATFKALPLYDVDTV
    VV
    CAESLQQRGLTAEQLVLPVSRCTPSEIAGLLANSQQVLTF

    >gi|308048271|ref|YP_003911837.1| carboxymuconolactone decarboxylase [Ferrimonas balearica DSM 9799]
    MPLLDPLPPETTPELAEDFALFTRILGFIPNSLLTMQRVPAMVHGFGALTRAVMDPNGSVDPGFKRLLAHFCSRAAGCQY
    CEAHSLIAAELHDVPHDKVVALWEYQTSPLYSEAERAALDFALAAGAVPNAVDEPLMAKMREHWREEQIVEILGAIALYG
    FLNRWNDSMATEIEAPAQAMGDEVLAKGGWTGGKHRAG