Exiguobacterium sibiricum 255 15 uid58053

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|172056245|ref|YP_001812705.1| methionine-R-sulfoxide reductase [Exiguobacterium sibiricum 255-15]
    MAKAIFAGGCFWCMVKPFHKYDGVEQVISGYTGGHTENPTYKEVCSETTGHLEAVEVTYDPSVITYDELLEIFWRQIDPT
    DGGGQFNDRGQSYEPAIFYVDEDQKQAAERSKAALDASGRFSKPVAVDIRPAKPFWPAEEYHQDYYKKNPFRYQMYSVGS
    GRAKFVKEAWKDQGKEQELKQRLTPIQYKVTQENGTEPAFRNEYWDEERPGLYVDIVDGTPLFTSKDKFNSNCGWPSFAK
    PISEDKMEVELDTSHGMTRTEVRSANADSHLGHIFDDGPTELGGLRY
    CINSAALRFIPVEELDSAGYGEYKKHFE

    >gi|172056265|ref|YP_001812725.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MKTIHVDELQEKLEAGEALHVVDVREQDEYDAGHIPNVRFIPMSEIGERYTELQEGETYYLICKAGGRSENVGRFLEQYG
    YDVINVEGGMMNWKGDQEA

    >gi|172056300|ref|YP_001812760.1| heavy metal transport/detoxification protein [Exiguobacterium sibiricum 255-15]
    MKETTLTIVGMTCNHCKASVESALNELDGVTNATVSLADNNVTVTHEDVATERLVEAIEEIGYDVPTA

    >gi|172056301|ref|YP_001812761.1| copper-translocating P-type ATPase [Exiguobacterium sibiricum 255-15]
    MSKTMELNIEGMTCAACSARIEKVLNRMDGVEATVNLPLETARIAVPEEMDEQLILDKIKKIGYGATIKTTPHEQVQNRR
    MLYRFWIAAFLSLPLLLSMVSHIPNSPVHLPWLMNPWFQFALATPVQFVIGAPFYVGAYKSLRSGSANMDVLVVLGTSAA
    YFYSVAEMMIHPLMPNLYFETSAVLITLVLLGKVLEDRAKQQTTGAIKSLLSLQATDAVVLEQGVERTVSLDQVQPGMQL
    IVKPGQKIPVDGIITTGDAYLDESMLTGEPLPAHKGTGDVVIGGTLNTNGYLTIEATKVGQETMLAGIIRVVEQAQTEKA
    PIQRQADRISGIFVPIVVAIALVTLAVWWWTTGSFAEAIRPAIAVLVIACPCALGLATPTSIMVGTGKGAEHGVLFKGGA
    QLESLQHVDAVVFDKTGTLTIGRPVVIETFGQEQALDFAAALEKKSEHPLAHAITEERDVVFDIEHFTVDPGRGVRGSIM
    GHDVMVGSVRMMQEHGLSLPDWTSSGATVVYVTVNGIIEAGYAIRDELKPTTKQVIQEIQQTKAVYLLTGDRREVALQLA
    TELQIPHSHVFSDVLPIEKADHIKTLQANGQRVAMVGDGINDAPALATANVGIALGSGTDVALEAADVTLLGHDLQQVIT
    AIRLSEQTMKNIRQNLFFALGYNAVGIPVACLGLLAPWVAGAAMAFSSVSVVTNALRLKRIPLSKGGNQS

    >gi|172056335|ref|YP_001812795.1| methylated-DNA--protein-cysteine methyltransferase [Exiguobacterium sibiricum 255-15]
    MMNTLPETDYYEALVRRDGSYEGTFFVGVKTTGIFCRPTCPARKPKQENCEFFETAKEALLASYRPCLRCKPLAYPGDSE
    VITRLIAAVEANPEKRFKDADFRELGLDASTARRQFKKRFGMTFVEYARSRRMGLAMKEIRKGQPVIEVQLASGYESSSG
    FRDAFARILGETPKRWSGAYLQAKWLDTPLGPMLAIADEGGLHLLEFVDRRGLEREVERLRLTARAVIIPGDAPVFEQVT
    VQLEEYFAGTRDRFDLPLVLYGTPFQRQVWEQLCLIPAGETISYQELAVRVGNPAAVRAVARANGANQLAILIP
    CHRVIR
    LAGDLGGYAGGLARKAALLKLERTKRGLNHR

    >gi|172056372|ref|YP_001812832.1| thioredoxin domain-containing protein [Exiguobacterium sibiricum 255-15]
    MSNYIKSEDTFKELIASETPVIIKFEADWCPDCKRMDYFMPDVESQFSELPIYTIDKDEFPEIASDNVVMGIPSLLVFQN
    NEKLGHLHSANAKTPEEVTDFLKKNFN

    >gi|172056378|ref|YP_001812838.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MKNMSTNELEEILQQEKTIQLIDVRETDEYAVGHIKQAKNLPLSELSERTDELDAGRPLHVICLSGGRSMNASTYLEQAG
    FDVTNVDGGMMSWEGDVTK

    >gi|172056379|ref|YP_001812839.1| beta-lactamase domain-containing protein [Exiguobacterium sibiricum 255-15]
    MLLRYFYDEKLAQASYMVGCQMTGEAIVIDPSRDIEGYLKEAAKEGLHIVATAETHIHADFVSGTREFAERFDTTAYLSD
    EGDADWKYEFAADIDAKLVTDGNRFKVGNVTFEVMHTPGHTPEHVSFLLYDRDQTVPMGIFTGDFVFVGDIGRPDLLEEA
    AGIQGTTAVGAKQMFESLKRFKALPDFVQVWPGHGAGSACGKALGAVPTTTVGYEKQTNWALQVEDETAFVKELTTDQPE
    PPNYFAMMKRVNKKGIVATPTLSKPRVAEATELETLVNTMQVVDTRSGKSFASGHVPGALNIPYNSKFVTWAGWLLDFDH
    DIAVIAEFRLLEEIQTDLQSIGLDRFVTLVDIADLSPEQLTEQYPDWSAEQAIEAAEAGEVVVLDVRNKTEWDAGHYEQA
    KRILLGKLSSRYKEIPVDRPIAVH
    CASGVRSRMAVSVLQSLGMKNVINIDGGYAALQPVLDRQALTEK

    >gi|172056391|ref|YP_001812851.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MQVDILNIVFLVIVAFLAYRMFAPTKGVNKLSASDLKQRLGDRTRFYLDVRTPGEFKGNHIKGFKNIPLQVLPTQLDKIP
    KDKEVIVI
    CQSGMRSKQAVKQLKKAGYTQVTEVSGGMNAWR

    >gi|172056392|ref|YP_001812852.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MKRFTAKEVQEKLENGEQLNIIDVREVDEVKEGKIPNAIHIPLGLVEFKMNELDKKKQYVMVCRSGARSGRAATYLEGQG
    YDVINMDGGMMAYEGKTN

    >gi|172056393|ref|YP_001812853.1| SirA family protein [Exiguobacterium sibiricum 255-15]
    MQTIKTDIVLDARGLACPMPIVRTKKTMKTLEPGQVVEVQATDKGSTADLRAWANSTGNQYLGTIEDGDVLRHYVRKASG
    NDQEAPAFQKVVNNETVEAVCGNADIMILDVRETAEYAFSHIPSAVNIPLGELEERIEELDSSKTIYVV
    CRTGNRSDLAC
    QQLDAKGFNVQNVVPGMSDWKYDTNQTV

    >gi|172056398|ref|YP_001812858.1| methionine-R-sulfoxide reductase [Exiguobacterium sibiricum 255-15]
    MKKRMLTIVSVVALIAIMIGGYFVFQQQQAKSSGSKELTYAKEETAILAGGCFWCMEPPFEELKGVKSVISGYTGGDVKN
    PTYNQVSAETTGHREAVLITFDPAVISYKQLLDVYWRQIDPTDPNGQFVDQGESYTTAIFYTNAEQKQIAEQSKKNLAES
    GIFDKKIVTPLIEAGPFYEAEAYHQDYYLKSEKKYKFYRSASERDEFINQYWNDQPKLDVPKYSKLTDDQIKAKLTDIQY
    KVTQEDGTEPAFDNPYHDLKADGIYVDLISGEPLFSSNDKYDSKTGWPSFSRPLEKGNIIEKSDFALGMKRMEVRSRHGN
    AHLGHVFNDGPEPTGLRY
    CMNSAALRFVPKADLEKEGYGQYASEFK

    >gi|172056422|ref|YP_001812882.1| methylated-DNA--protein-cysteine methyltransferase [Exiguobacterium sibiricum 255-15]
    MEVYFTRLNWNDTSFPIAASETGLCYVGALNEPSDLFDDWIRKHLPRAELIEHPRIMQPYQEQLLEYLNGVRTRFSLPLH
    LIGTPFQLEVWQALCQVPYGVTVTYSDIAKQIYRPGATRAVGTAISKNRVLIVVP
    CHRIVGKKGDLTGYWGGLNMKRQLL
    EIEQVSSSKLPFL

    >gi|172056423|ref|YP_001812883.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Exiguobacterium sibiricum 255-15]
    MVVGELTQERDLVILGGGPAGYTAAIRASQLGRTVTLIEQAQIGGLCLNKGCIPSKVVAHAAEVKLQTKHMTALGFSFHP
    THDFSQLVEYRERTIRQLRTGVEALCQANAIEVVHGTASFLADDRIGVELGHQFDTYRFNDVVIATGSHSIKQDAPSVLN
    AEQLYQLTELPERLVIIGQDYIAIEAAMSFQALGTSVTLIADAFDFDPSLDKELRRLFKKQKIQLVTGTVTAIEAQEDVT
    VTVVKQGQETTWSAPFLFHSLPRVPHTLELGLERIGVTLAEDGTIPVDPFGQTNRPHIYAIGDVTPGPAIATRAIHEAKR
    TAEHLSGQSADTTVPYYPTIIRSLPPIVSIGLTEQTATDAGHSFRTAQFALNANGATTIEGGSGFIKVISDATTSLILGI
    HMIGEGAIELAGVFAQTLELHAKEEDVRFPVMPHPSRNEAFTEAIEALLGQAIHLPPRQQDVLAKS

    >gi|172056445|ref|YP_001812905.1| peptide methionine sulfoxide reductase [Exiguobacterium sibiricum 255-15]
    MEKATFAGGCFWCMVTPFEELPGIHSIVSGYTGGHVDNPTYEQVKTGTTGHSEVVEITFDPALFSYERLLELYWPQTDPT
    DAGGQFQDRGTQYAPAIFYHTEEQRLAAIASRDALAATNRFKQPIVTRIEPAHAFYPAEEYHQDFHKKNPAHYKKDRKAS
    GRDAFIDVAWKEEVTV

    >gi|172056459|ref|YP_001812919.1| heavy metal translocating P-type ATPase [Exiguobacterium sibiricum 255-15]
    MEAKTERLKITGIDCANCAAKVERGVASVAGIEQADLDFAGQKLYLTYEKGAASDDTYQAVVERIQQLEPDVHLVRTAST
    EAVDPREHAGHDHSHPHDHGPFLNRTKKIQYSVGMISFISAFFVPGSIDLLFFAVAYFLIGWDVLQTAVRNIRHGQVFDE
    NFLMVIATVGAFLIGEYPEAVAVMLFYQVGEFFQHRAVDQSRKSIAALMDIRPDIATLEDGRRVSPEQVNIGQRIVVRAG
    EKIPLDGTVLTGEAFIDTTALTGESVPRRVRPTEPVLAGTINTDGHLLIQVDRPYNESTVAKILDLVENASRHKAPTEKF
    ITRFARVYTPIVVLVATLLAVVPPLVVTGATWSDWIYRALVFLVISCPCALVISIPLGFFSGIGAASKRGILVKGGNHLE
    ALQQLDTVVFDKTGTLTEGVFEVVELKAVHGSEDELLRVAATVEQHSNHPIAKSIQRMYARHASVSTAVQDYQEVAGSGV
    TGRFGTDQIQAGNARWFKELGLTPLDQTEDGTYVHVAQNDSYLGFIRIADRIKDTTVEALDGLKALGIRQTIMLTGDRRE
    TAEQIGRQIGITQVKAELLPDQKVEQLEAILYQANGRVAFVGDGINDAPVLTRADVGIAMGGLGSDVAIEAADVVLMTDE
    PKQLVEAIRIARATRRIVYQNIAFALGIKGVFLLLGAFGVATMWEAVFADVGVTVLAVLNAMRILRK

    >gi|172056572|ref|YP_001813032.1| OsmC family protein [Exiguobacterium sibiricum 255-15]
    MTKTILTSRATAVGGRDGKVASDDNVINLDLVMPGTKGKEDIPTSNPEQLFAAGYAACFDGAFNLMARQDKKRVETRTNS
    EVSLLEDEEAGGVKIAAKLVVEVVGVTEEEAQDLLEKTHQF
    CPYSKATRGNIDVDLSVKVVDSLDN

    >gi|172056601|ref|YP_001813061.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Exiguobacterium sibiricum 255-15]
    MKKYVVYLMAAIIISGIAYTSYSAYQTKQDQQQMKAKQQAEGGLETGMKAPDLEIEQDGRMIHLSDLTDQLIVINFWATW
    CPPCQQEIPELNAFAKSTSIPVYGINVTTAERRLSDVKQFLKKTPITYSVLYDTKGQSEKTYQLVAMPATYIIDQTGTIV
    GKHVGPVTQEMLKEMVRKIGG

    >gi|172056701|ref|YP_001813161.1| methylated-DNA--protein-cysteine methyltransferase [Exiguobacterium sibiricum 255-15]
    MPYKKMSYTFGELVIGWEEEEVVYLDFGHDMARLKKYLDPAAYYEASLPDFLADALDAYEQGQPEALNTISCRLEVTAFQ
    HRVLEALRSIPFGQTASYGQLARMIGSDKVARAVGGALNRNPIALIYP
    CHRIIGASGKMTGFASGIAHKEALLAHELGEK
    N

    >gi|172056710|ref|YP_001813170.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MFMFPTIQMTDLQQLVHTDQIRWFDCRYDLQHPDYGRDAFKESHVAGAQYLDLSTDLSGPRSKTGGRHPLPSKEQWIGTL
    ESLGVERDDFIVLYDDGFPYAARAWWLFKWAGHERVVVLEGGLSSYLAFDFPMSTESTVFEKSTYQADFKDDMLVQYEEV
    KNRSAETYLVDSRSPDRFQGQNETIDPVAGHIPGAVNCFFENAISPDRRLKDAEDLKELYADLLEADSPILY
    CGSGVTAC
    VNVLALHALGKTDVRLYAGSYSDWISQTDEVAR

    >gi|172056755|ref|YP_001813215.1| DSBA oxidoreductase [Exiguobacterium sibiricum 255-15]
    MKVEVWSDYACPFCYIGKKRLEKAIQENGATNVEVEFKSFELDPSSPETPTMGLYDILASKYGTSVDQARSMSQGVVDAA
    KTDGLFYEMDRVVPANTFKAHRLTQLAKKHDKMDEVSEELFQAYFMNGENLNDDSILTRIATAVGLDPATVEAFLASEES
    SDEVRQEEEMARELGVTGVPFFVFDRKYAISGAQPVEAFSQVLERIQQEQKVEIVAEGDACGVDGCN

    >gi|172056798|ref|YP_001813258.1| thioredoxin domain-containing protein [Exiguobacterium sibiricum 255-15]
    MSKKSNRVKSTKKPQSKANWITAGVIALIVLIGATMLLFTDREDTASKNGNLTASQVSDKLKSGDEFYTYFYQTGCVHCE
    KVKPYLVPLGEKQDIPFEQIDLAVEQSAWDTFGIEGTPTVVHFKDGKEVSRVSGEQTEDAYKEFFAGKAVKNSEEESSGD
    LND

    >gi|172056916|ref|YP_001813376.1| arsenate reductase and related [Exiguobacterium sibiricum 255-15]
    MANELIFFTYPSCTSCRKTKSWLKEEHVDVEERHLFRNAPTVDELMELLKLSTDGIESLLATRSQAFKDLGIDVDDMKLS
    ELLRLMSDNPKLLRRPIITDGKQLVIGYDKPGLETLAKRKNRIIAQVS

    >gi|172056929|ref|YP_001813389.1| rhodanese domain-containing protein [Exiguobacterium sibiricum 255-15]
    MEISTIITIVLWVALIAYIIWRFMPVKGITKLSQEEFRANYRKAQIVDVRETQEFKGGHIIGARNIPVSQMKMRAKELRK
    DMPIYLY
    CQGNMRSSQAAKVLKKAGYTNLYQLKGGFKQWTGKVKRS

    >gi|172056955|ref|YP_001813415.1| dihydrolipoamide dehydrogenase [Exiguobacterium sibiricum 255-15]
    MAREFDVVVLGGGPGGYVAAIRAAQAGKTVAIVEQGKLGGTCLHRGCIPSKAFLKSAAVYQTVKHAATYGVDVPESFLRF
    EQVKQRKQDIIDGLESGIQHLMKKGKIEVFHGRGSILGPSIFSPMPGTISVEPEEGDGELILPRQLIVATGSRPRPLNGL
    AFDSEYVLSSDEALDMNALPKSIVIIGGGVIGIEWASMLTDFDVEVTVVEFSDRILPTEDQAVSREVARQLKKRGVKIMT
    SAAAQSDSFQLTESGVTIDVDRNGDKTTLAADKLLVAIGRMANVEGIGLENTNIIVENGFIQVDDEFRTKDNHIFAIGDV
    IGRLQLAHVASAEGAKAVETIVNGSTTPLNYAFVPRCIYSVPEAASVGLTEAEAKAAGLDVKTGMFSFNGLGKARIEGEA
    AGFIKLVSDAKTDDLVGVHIVGPKATELISEGGLALVLNATAWEVGQLVHPHPALSEAFGEAALAVDGLAVHA

    >gi|172057050|ref|YP_001813510.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Exiguobacterium sibiricum 255-15]
    MKKTNQNPDERLAAAKQKKKKRSFWRLMIMTMVLFAGAVVIMQFVDQATRDKDGRVLAGDDAPEFALVDLYGEKQHTMDE
    YKGKGLLLNFWGTF
    CEPCKKEMPLINDNYKMMQKEGVNFAAVNVGETPVRVSSFIKEIGGTDYPVLMDTNSAVEKAYGIY
    NLPVTFIINKEGKVVEKYEGEIDQAKLEEMIKKANE

    >gi|172057232|ref|YP_001813692.1| OsmC family protein [Exiguobacterium sibiricum 255-15]
    MQATVIWNQKMGFSGETESGHHLAMDAAPENGGDNQAPRPTELLLHAVAGCTGIDIVSILEKMRLTLTSFEMDIEGERAD
    DHPRRFTTISIHYRLEGDLPDDKVRRAIALSKDKYCSVSQSLNAEIEVYYSINGVRNEEPI

    >gi|172057238|ref|YP_001813698.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Exiguobacterium sibiricum 255-15]
    MTDRYSRQVRFRPIGQKGQDQMADRHVVIIGAGALGTANAEQLVRGGVGHVTLIDRDHVEWSNLQRQQLYTEQDVQDHLP
    KAVAAKRRLGKVNSVVSVTAIVEDVTPENIERLVRGSDLMIDATDNFSVRMLINDVAAKSGIPWIFGACVGSYGMTYTIR
    PGQTPCLHCLLEHLPKQQET
    CETSGVISPVVQLVAAHQVTEALKYLTGADNALRQTLLSFDVWDNHQSQINVGSLRQSAC
    PSCGDDPVYPYLNAPIVQFVTLCGRDTVQIRGEGPRDLVRLEQELTTHGISCLQNPYLLMFKADDYRITAFADGRILLHG
    EANLQQAKQVYENYFTGIFTKK

    >gi|172057301|ref|YP_001813761.1| glutathione peroxidase [Exiguobacterium sibiricum 255-15]
    MNTSLYEIEVQDATGQTVSLNDYAGEVLVIVNTASKCGLVKQLGDLQQLHDKYADQGVKVLGFPCDQFNNQEFADQQETM
    QFCQRNYGVTFPMFQKIDVNGPAEHRLYTYLKQQQGGLLSSNIKWNFTKFLVDREGRVVKRFAPVDSIQTIEKTLARYV

    >gi|172057448|ref|YP_001813908.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15]
    MKLLIIGSVAAGTSVGAKARRNSEDLQITIYDRDQDISYSGCGIPYFVGGEIADIDELTPRDAAFFKKRYNIDIHTRHEV
    ESIDHATKTATIVNLATGDRLTDTYDTLVLATGASSIVPPLQGVDHDNVFTVRNVRNADAIRSYIDAHNPKTATIVGGGF
    IGLEMAEQLSYRGIQVTLVERLPQVMPPLDRDMAERVADHLRDKGVSLLLGESVTALNGTERVTDIALESGKSIATELVI
    LSVGVKPNTELAKQIGVGLGQTGAIAVNRKMQTNVADIYAVGDVAESFSVITGEAIYRPLGSTANKMGRIAGMVITGEEA
    EHRGILGTGIFKAFDLTVAQTGLTEKEAREAGYDIEVLHNIKPDRPEYMGGKEMTIKAIADRATGRVLGAQIVGPQGVDK
    RIDVLATAITFKAKAEDLFHLDLAYAPPFATTKDPVLYTGMALDNAIKKTARLMTPNELIEQVAGGKSFQIIDTRSKAQF
    EKNHVDGAIHIPLGELRTRAKELDPTLPTIVY
    CNKGVTGNAAQNVLKNLGFTDVCNLSGGNKNYQHCKKCLTE

    >gi|172057639|ref|YP_001814099.1| OsmC family protein [Exiguobacterium sibiricum 255-15]
    MKPMFTSSATAVGGRDGRVVSEDGILDVALAMPVPGSKKQATNPEQLFAAGYSACFDSALNLVARKQGIKHDGSEVTAHV
    TLNEATDGFTLSVELDVLVRGVSEEQAAELGKLAHSV
    CPYSRATAGNIQVDIFTRTTDSE

    >gi|172057723|ref|YP_001814183.1| thioredoxin [Exiguobacterium sibiricum 255-15]
    MATFQELTSIEAVRDFYLGQRASFIYVSSPGCGVCASLFPQIEPILASHPEFRSGHVDLGSVPEIAGEFSVFTAPALLFF
    ANGKEIHREVRIVPIEPFTKKVEQLSRLVASLD

    >gi|172058017|ref|YP_001814477.1| dihydrolipoamide dehydrogenase [Exiguobacterium sibiricum 255-15]
    MVVGEFAQETDLLVIGAGPGGYVAAIRGAQLGLKVTIVERENVGGVCLNVGCIPSKALITAGHNFQHAKGSDSMGITSEN
    VAVDFSKVQSWKQSVVNKLTGGVGGLLKGNNVETVVGEAYFQSEDTVRIINEDSSTPYKFKKCIIATGSTPIELPAFKWS
    KRVLSSTGALNLPELPKKLIVIGGGYIGMELGTAYANFDTEVVILEGTKDILSGFEPAMTQVVKKKLKQKGNITIHNEAL
    AQSVEETEEGVKVTFEVKGETQTVEADYVLVTVGRRPNTSDLGLEMAEVKVSERGLVEIDDQCRTSNENIYAIGDIVPGP
    PLAHKASFEAKIAAEAAAGHPAYLDYSAIPAVVFTDPELATVGYTEAQAKEEGLDYIASKFPYAANGRALALNEPDGFLK
    MITRKADGLLIGAQIAGTGASDMIAEMGLAIESGMTAEDIALTIHAHPSLGEIAMETAEVAIGSPIHIMK

    >gi|172058030|ref|YP_001814490.1| disulphide bond formation protein DsbB [Exiguobacterium sibiricum 255-15]
    MSRYHFMLIVSTVATLGSLYFSEVRGFIPCPLCWWQRLFMYTTAIYLLVSLFRNRPVDGFFLRLYTLLGFAVAAYHVVLE
    RLPDGEAL
    CTNGCLIKWVNYFGFLTIPMMSLIAFTLLVILAFYPNKKNAQ

    >gi|172058059|ref|YP_001814519.1| arsenate reductase and related [Exiguobacterium sibiricum 255-15]
    MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSLDEIKQILRMTEDGTDEIISTRSKVFSKLDVSVENLSLQHLY
    DLIQEYPGLLRRPILIDEKRLQVGYNEDEIRRFLPRKVRTFQLLEAQRLVNE

    >gi|172058171|ref|YP_001814631.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15]
    MRTYDCIVIGTGSAGNQAAYKFAEKGLNVAIIENFTPGGTCAQRGCDAKKILLTGSEAKDAVERLLGYGLKGLVSIDWRQ
    LMERKNEYTRAIPEQTRNRYDEVGIDYYHGEPRFLSNKKLLVDDIELEADQFLIATGLRPRELSVPGSERFLNSNEFLEL
    RDVPRRLVCIGGGYISFEFAHLARIAGSEVTILLRSGALKQFEQDLVSVLLEATQALGIKILHETEAVSYSDTTLTLSDG
    TRLEADVVLNATGRVASIEHLQLEKAGVIYEEKGIHVNDYLQSSASNIYAAGDVAVSGNPALTPFAGTEGRLAACNMLEG
    NTRRLELLPVPSIVFTTPNLAKVGQTEASLKQNNTRYRGKLIDTSSWQTNVRIKDPFARAKVLIGEDDQILGAHFIGVHA
    AELANYFSFAMQHRIPSSALQKTSFAYPTPASDIASLLED

    >gi|172058173|ref|YP_001814633.1| thioredoxin [Exiguobacterium sibiricum 255-15]
    MAIVHATSQSFKEDTQEGLVLVDFWATWCGPCRMLAPVLEELDADMENVKIVKVDVDANPEVAGAFQVQSIPTLVLFKDG
    QPVNKTMGFMPKDALKEFVETSN

    >gi|172058237|ref|YP_001814697.1| redoxin domain-containing protein [Exiguobacterium sibiricum 255-15]
    MATFKGNAITLIGTPVEIGQEAPDFEVLANDLSPVTRDTYEGVRIISVVPSIDTGVCDAQTRKFNEEAAAIEGVTVLTIS
    NDLPFAQRRWCAASGLDNVVTLSDHRDLSFGTQYGVAIEELRLLARSVFVIDASNEVVYAEYLEESTNEVDFDSALAAAK
    GAKATK

    >gi|172058262|ref|YP_001814722.1| thioredoxin domain-containing protein [Exiguobacterium sibiricum 255-15]
    MKKLESKEQFDQAKKEKSIFLFSADWCPDCRFLDPFMPEMEQTFSEFNFYYVDRDQHIEIAQEMDIFGIPSFVAYRENEE
    TGRYVGKERKTPEQVTAFLETV

    >gi|172058282|ref|YP_001814742.1| hypothetical protein Exig_2273 [Exiguobacterium sibiricum 255-15]
    MYDVIVIGGGPSGLMAALASLQAGAKTLLLDKGSKLGRKLAISGGGRCNVTNRKPLEELVQSIPGNGRFLYSAFSQFNNE
    SIIELFEGFGVALKEEDNGRMFPVSDKAADVVRVLIDQIRQHGAEIQINAEVATLDFHPDGSFAAVLLADGSRLEAKSCV
    VAVGGQSVPHTGSTGDGYPWARKAGHTITELFPTEVPILLNDTFIQEKTLQGLSLRDVALTVHGKKDKPIKTHTGDLLFT
    HFGLSGPIALRCSQYTIKERKRSGERVVHLSIDLFPEESIGALTERFQAALAANPKKTVRNALKGFVPERLLDLLFARIG
    FGDEVCTQIKKQDFTQLLATLKRFPLQAVGTLDFDKAFVTGGGVSIKEIQPKTMMSKKADGLFFAGEILDIHGYTGGYNI
    TAAFVTGHCAGTNAALTAL

    >gi|172058325|ref|YP_001814785.1| iron-sulfur cluster assembly accessory protein [Exiguobacterium sibiricum 255-15]
    MIHLTEAAALQVKEMMLQAPDDEQNLRMLVQGGGCSGLSYGMGFDSEKETDLTFEQHGVKVIVDQKDYPVVKGLEVDYKQ
    SMLGGGFTITNPNAIATCGCGTSFRTATNAGTPGGC

    >gi|172058355|ref|YP_001814815.1| thioredoxin [Exiguobacterium sibiricum 255-15]
    MKEVTAAPENGFLYVYAPMCGTCAIASRMLEIVEATKDGEWIQQANGNFIPEFLEHAQVMSVPALLKIEDNQVVSRLYAF
    QSVQNVFAFCAE

    >gi|172058357|ref|YP_001814817.1| arsenate reductase and related [Exiguobacterium sibiricum 255-15]
    MVTMYGYPKCSTCVKAKKALETNGVEVDYKHIVDETPSAETIRELHQKSGEPLKKFFNTSGQSYRSQGIKDRLPELSEQE
    QYELLASDGMLLKRPIVTDGQDVTIGFKEELYQGKWY

    >gi|172058406|ref|YP_001814866.1| glutaredoxin 2 [Exiguobacterium sibiricum 255-15]
    MMPSKEHTTLTLYSRPGCTLCEEAAFLLDFVLDEFPDWTFEEVNIEEDAALSLRFLYEIPVVMHQSEIWSYGKFETETIR
    NRLLEKS

    >gi|172058413|ref|YP_001814873.1| thioredoxin reductase [Exiguobacterium sibiricum 255-15]
    MTETEQKIYDVIIIGAGPAGMTAALYASRANLSTLMIERGIPGGQMANTEDIENYPGYDSILGPDLSQKMFDHSKAFGAE
    YAYGDVRSIEDGPAFKTVHAHNKDYHARAIIIASGAQYKKIGVPGEEELGGRGVSY
    CAVCDGAFFKEKELFVIGGGDSAV
    EEGVYLTRFAKKVTIVHRREELRAQKILQKRAFDNPKIDFIWNHTVKQINEDNGKVGGIELINTKTAETTTYPIDGVFIY
    IGMNPITGYVQDLGILNDQGYVVTNEAMETNIKGIFAAGDVREKTLRQVVTATNDGSIAAQNAQHYIEALLEELQESSQV


    >gi|172058523|ref|YP_001814983.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Exiguobacterium sibiricum 255-15]
    MNTVDFTLPNAQGEMISLSDFRGKKVIVYFYPKDSTPGCTTEACDFRDASEAFAAKNTVILGISADSQKRHQNFISKYEL
    PFELLSDVDHTVCEQYGVWQLKKNYGKEYYGIVRSTFLINESGELIQEWRSVKVKDHVTEALSFLEQLN

    >gi|172058536|ref|YP_001814996.1| hypothetical protein Exig_2529 [Exiguobacterium sibiricum 255-15]
    MHITFTETALARIDQLRGDTPGQLHLYYDTEGCGCGNSGIFSIRLVEGAADEDMTIDSNVGPVLVKRWSSHFLDQEMTLD
    YIPEKKSLILKSDGQYFNTNVLVTDQTGCQLTANR

    >gi|172058552|ref|YP_001815012.1| hypothetical protein Exig_2546 [Exiguobacterium sibiricum 255-15]
    MATNRLINEKSPYLLQHATNPVDWYPWGEEAFAAARSANKPIFLSIGYSTCHWCHVLAHESFEDEETARMLNDRFISIKV
    DREERPDIDQIYMTAAQMMNGQGGWPLSVFMSPDQTPFYIGTYFPKTPQFNRPSFRQVLLQLSEHYRTDPDKIKRVGQEI
    IQALTAVTTFDSEDPLDEALVHETFDQAMRQYDVENGGFGTAPKFPSPSLLTFLLDYYRFAEDETALQMVMRTLTAMRDG
    GITDHVGFGLYRYTVDERWEIPHFEKMLYDNALFATLCIETYQVSGRERFKQYAEEIFAYIERDLSSPDGAFYSAEDADS
    EGREGLFYTFTFDELTDLLGQDAVFPLLYQATPQGNFEGRIVFRRTGQSIQQLSADRNTAVQDILIQLEQERRTLLLFRS
    QRTRPFRDDKVLTSWNALMISAYAKAGRVFNDERYTKFARQALTFLETHLMDDDRLHVRYRQGHIQGNGYLDDYSFLTEA
    YLELHQTTQHIPYLKQAIRLTERMIGDFSDEDGSFFFTSFEDETLLMRPKDVYDVVKPAGNSTAVSNLLRLSQLTGRTDY
    RDQAQRNFSTLASEIKSQPTGFASLLSVYTRTLMEPKELIVLTESYTDVASFLTQLHQRRLPELSLLVGSKTDLLEIAPF
    LATYDAPTQQPTAYLCHDFQCDRPTTNLSELLQKIII

    >gi|172058560|ref|YP_001815020.1| glutathione peroxidase [Exiguobacterium sibiricum 255-15]
    MLQEQTFQRIDGTEATLKDYPGQAWLIVNTASKCGLTPQFEGLEQLHQDYRKQGLVVLGFPCNQFAGQDPGTDEEIQSFC
    QMNYGVTFPVFSKIEVNGKGTHPLFAELKALAPNTTGEQDVEWNFTKFLVTRDGEVTRFAPKTNPTDLVAAIERIVVPV

    >gi|172058830|ref|YP_001815290.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15]
    MKTIIVGGVAGGATAAARLRRLDETAEIILLERGKEISFANCGLPYYIGDVIKDRNKLLVQTPEGMNARFNLDVRNLSEA
    IRINRQQKTVTTRKVDTGEEYEESYDQLILSPGAKPIRPGIPGLAEATNVFTLRNIPDTDKMRQYVDESRPAHATVIGGG
    FIGLEMAENLVERGARVTLIEMSDQVMAPVDPEMAAIVHEHLRAKGVELILADGVSRFEEAGTRVVLTSGKTIQTEMNIL
    SIGVMPESNLASEAGLKLGIKQTIQVDETLRTSDPAIFAIGDAIEVKDYITGEPVHVPLAWPANRQGRLVADIIAGRDVR
    YTGTLGTAVAKVFDLTVASTGNNEKRLRQSGRRYEAIHLHPGSHAGYYPGASPISMKLLFDPVDGTIFGAQAIGMTGVEK
    RIDVLATAIKGGLTVLDLPDLELSYAPPYSSAKDPVNMAGYIASNIVLGDSENVHWHEIDQIVTDGGLLLDVREPSENEL
    GSIPGSVNISLPTLRQSLDELPKDQPIYVT
    CQVGLRGYVASQLLKQNGFDVKNLSGGYKTWATVNRDREARSQVREETAV
    TTIKSEPKQVTKEQITLLDTCGLQCPGPILELKTKIDQLQDGDQVFVKASDPGFLPDVQAWAKKLGHTVHTAEMNKGVVE
    VLLEKGNATNQPVQSAAATADDATMVVFSGDLDKALASFVIAQGAQAMGKQVTMFFTFWGLNVIRKPDAPAVDKAPMERM
    MGMMMPKHAGELPLSNMNMAGAGQKMMKKVMKDKQVDALETMMAKAQAAGVRMIACTMSMDIMGIKKEELLDDIDYGGVA
    SYLGATDGSNLNLFI

    >gi|172058842|ref|YP_001815302.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15]
    MKVAVIGCTHAGTAAVKELTSQHEQLDITVYERNDNVSFLSCGIALHVGGVVEHAESLFYSSPDELAELGANMRLKHDVL
    EIDSTNQTIVAKNLVTGETVYDTYDKLIMTTGSWPIIPMLPGIELNQIEL
    CKNYHHAQTIIKKATDAKRITVVGAGYIGA
    ELVEAFEAYGKEVTFIDSADRILNKYLDRSFTDIIENELTDRGIRLELNQTVQSFTGVDGNVTQVVTDKGTFETDLVILC
    VGFRPSTELLKGQIDMLPNGAIIVDDFMRTSNPNIFAAGDSCAVYYNPARTHAYIPLATNAVRMGTLVGKNLLAPTIRYQ
    GTQGTSGLRLYDLNIASTGLTEDAAPFFGLEVTSTTVQDAYRPEFMPTAENVQLKLVYETTTHRLVGAQIISKVDLTQAM
    NTLSVAIQNDMTLEELAFVDFFFQPHYNKPWNLLNQAALQGMNELTSERV

    >gi|172058886|ref|YP_001815346.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Exiguobacterium sibiricum 255-15]
    MKSYQLVVIGGGAAGMTIAAGAASLGAHVALIEKHTHLGGDCLHYGCVPSKALIEAAHDVHVMKQTAAKYNVTLNGEAVY
    SKTKASVDRARNIIQSHDGTKRFKDLGVDVYIGEASFLSANEVEVAGQLVVGEKFAISTGSQPIIPPIEGLDTIPYLTNE
    TIFEQTERPERLLVIGGGAIGLELSQAYAHLGTEVTVIEGAKSLMPKEDRSMVEVLQRQIEQELTLHLDTTVTSVRKAAK
    GIEVTVKTGEESRVIETDAVLVAVGRKPRIDALRLDRAGVHVEKGYVQVDGSLRTNQRHIFAVGDTIQSLPFTHVAGLEG
    KTVVTNALFGLRTKPDYRAVPWVTFTTPELFHLGLTEEEARQKYSDIKVYETGLDEVDRFVINGRTEGHVKLIADKRGKL
    IGAHAIGEQAGEWMQEVVYAMARKDKVGQLSRVVHPYPIRGAAVQRAADLYWRERLFDGPLPKWLKRYFDWKQGE

    >gi|172058955|ref|YP_001815415.1| OsmC family protein [Exiguobacterium sibiricum 255-15]
    MKHHFHLTADWPGNRNDVGQIETGELKTKISIPDAMDGPGVGTNPDEMLLGAAATCYIITLAAMLERNDIPKVSLTMESE
    GIVDVTNGVFTYDAIIHRPTLILPAETTEANLTKARRLAEKAEGS
    CMITRALAGNVKVSLEAVVELEG

    >gi|172059002|ref|YP_001815462.1| peroxiredoxin [Exiguobacterium sibiricum 255-15]
    MSLIGSEVKPFSASAFHNGEFVDLTDANLRGKWSVVCFYPADFTFVCPTELEDLQNQYATLKALDVEVYSVSTDTHFTHK
    AWHETSETIGKIEYVMIGDPSHVISRNFEVLNEQDGLADRGTFIIDPDGVIQTVEINAGGIGRDASTLVNKIKAAQYVRN
    NPGEVCPAKWEEGSATLTPSLDLVGKI

    >gi|172059003|ref|YP_001815463.1| alkyl hydroperoxide reductase, F subunit [Exiguobacterium sibiricum 255-15]
    MALAADIKAQLAQYLDLLEGDLVLAVSAGTDSVSLEMSELVEEIASMSTRISIEQAALPRTPSFSVNRVGEESGITFAGI
    PLGHEFTSLVLALLQVSGRAPKIDAALIEQIKGIKETYHFESYISLS
    CHNCPDVVQALNVMSVLNPNISHTMIDGGAFKQ
    EVEAKEIMAVPTVFVNGEAFGNGRMSLEEILAKLGTGVDASDFADKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTMSIENFISMKYTEGPKLVASLEEHVKEYGIDVMNLQRATRLEKKDLVELELENGAVLKTKSLILSTGARWRN
    IGVPGELEFKNKGVAY
    CPHCDGPLFEGKRVAVIGGGNSGVEAAIDLAGLVKHVTVLEFAPELKADAVLQDRLASLPNVTV
    VANAQTKEITGTDKVNGITYVERETGAEHHVELEGVFVQIGLVPNTDWLGETIERNKFGEILVDRHGATNIPGVFAAGDC
    TDSAYKQIIISMGSGATAALGAFDYMIRN