Eubacterium rectale ATCC 33656 uid59169

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238922598|ref|YP_002936111.1| hypothetical protein EUBREC_0172 [Eubacterium rectale ATCC 33656]
    MNIQIFGTKKCNDTKKAQRFFKERGIKFQFIDMKEKGMSKGEFNSVAQVNGGLDNMINWDGKDKDLLALIKYIADEDKLD
    KVLENPQVIKTPVVRNGRQSTIGYQPDVWKTWK

    >gi|238923025|ref|YP_002936538.1| heavy-metal transporting P-type ATPase [Eubacterium rectale ATCC 33656]
    MKQYTVTGMSCAACSARVEKAVSKVDGVTSCSVSLLTNSMGVEGSATDAQIVEAVEQAGYGASPKGTATESENDKANNSL
    EQLKAAQDALVDRETPKLRNRLIASLIFLVVLMYFSMGHMMWGWPLPEFFNGNHVAMGLLQLLLTVAVMVINQKFFISGF
    KGLIHGAPNMDTLVALGSAASFGYSVYALFAMTAAQVNGDMDAVMSYMHEFYFESAAMILALITVGKMLEAHSKGKTTDA
    LKSLMQLAPKTATVVRDGVEQEISVDAVKKGDIFVVRPGENIPVDGEIIDGTTAVNESALTGESIPVDKQPKDAVSAATV
    NQSGFIKCRATRVGEDTTLSQIIQMVSDAAATKAPIAKIADRVSGVFVPAVITIAIITIIAWLIAGETVGFALARGISVL
    VISCPCALGLATPVAIMVGNGKGAKSGILFKTAASLEATGRTQIVALDKTGTITSGEPKVTDIVPDETFFEETGNNAGKL
    LAIAASVEAKSEHPLAKAIMERAKTDEIAVAEVTDFSAVVGNGLTAILAGKMIKAGNLAFVSKFVKVSDDMRAKAVEFSK
    EGKTPLFFAADDRLCGIIAVADTIKEDSPEAVRQLKNMGIRVVMLTGDNEQTANAIGKQAGVDEVIAGVLPDGKEAVIRK
    LKKQGRVAMVGDGINDAPALTRADMGIAIGAGSDVAIDAADVVLMKSRLIDVPAAVRLSRATLTNIHENLFWAFFYNVIG
    IPLAAGLWYPLLGWKLNPMFGAAAMSLSSFCVVTNALRLNLCRVYDPKHDRKATSDRKNKTNKPNESEEKSMTKTMNIEG
    MMCGHCEARVKKALEALDAVSEAAVSHESGTAVVTLSSDISDEKLKETVEAEDYKVTSIQ

    >gi|238923282|ref|YP_002936797.1| thioredoxin reductase [Eubacterium rectale ATCC 33656]
    MKGTNSMFDIIIIGSGPAGLSAAIYAKRANLNVAIAEKEYEGTGQIAESGNVNNYLGLPNINGYDLGEKFREHAVSLDVE
    FIEKEAVQIEAVQNGEKEESAIYRVKFDDDTIAEARALIYTAGAYPRKAGVPGEDEYTGKGVSY
    CAICDGAFYKGKTAAV
    LGGGDTALDDALYLSDICEKVYLVHRRDSFRGAQSTVELLKQKENVELVLNETVTEIYGEKKPTGIKLKSGRTLAVDGVF
    VAYGSVPQSELIKNLVQLDERGYVVAGEDGITYAATKNGDHDRSVQPGLYVAGDVRTKTLRQVVTAVSDGANAATTAAEY
    LRDINGYKQNI

    >gi|238923286|ref|YP_002936801.1| thioredoxin [Eubacterium rectale ATCC 33656]
    MAARISKADFDEKVLKSKLPVIVDFYSDSCVACKKLAPVLGDIEDDYEDKLHVYKVNTNFDGELADEYEVTANPTLLFVK
    DAEVLDRKVGAQKPADLKAWVEELL

    >gi|238923288|ref|YP_002936803.1| hypothetical protein EUBREC_0899 [Eubacterium rectale ATCC 33656]
    MLMAMTDEQIERYSRHIILNEVGVKGQKKLLKGKVLIIGAGGLGAPAAMYLAAAGVGTIGIVDADEVDLSNLQRQIIHGT
    ADVGKAKVKSAKETMNAMNPDVQVNTYRMFVDASNIRELIRDYDFIIDGTDNFPAKFLINDACVLEKKPFSHAGIIRFKG
    QLMTYVPGEGPCYRCVFKNPPPKDAVPT
    CKQAGVIGAMGGVIGSLQAMEAIKYLIGVGELLTGYLLTYDALTMEFHKIKL
    PKDTHNCAVCGDHPTILEPIDYEQEVCEETAGRFDAPRTQE

    >gi|238923297|ref|YP_002936812.1| hypothetical protein EUBREC_0908 [Eubacterium rectale ATCC 33656]
    MKFKIVYADELYKVQKEMNALLIDIRTREEYDRSHWKGALSMPMDITDSYESELDASQSVIFYCTHGGSSMKLARYLGNR
    GFDTATVIGGYNAMCGYQKKLQKYG

    >gi|238923466|ref|YP_002936982.1| thioredoxin reductase [Eubacterium rectale ATCC 33656]
    MYDSIIIGTGPAGLSAALNLKTYKKDFIWFGSKNLSEKVQKAEKITNYPGFPQISGQELFERFDAHRRAAGIDITEKTVT
    NIMPAGNGFMVLADNEMYEARTLILCMGVMSAKQLDREDELLGKRLSY
    CATCDGMFYKDKRIAVICNDKKYEHEVKYLAD
    LAAEVLYFPAYNDSEIELTNVKISKDVPIALIGDSFVEGITLRSGKTESVDGVFCLRNAIAPSKLMPQLEIENGHILVDR
    AQQTNVAGCFAAGDCTGRPYQYTKAVGEGNVAAHSCIQYLSKSEK

    >gi|238923597|ref|YP_002937113.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC 33656]
    MSAININKNNFENEVLNSDKTVLLDFWASWCAPCRRVVPIVEEIADERMDIKVGKINVDEEPELANKFSIMSIPTLVVMK
    NGKIVQQVSGARPKNAILEML

    >gi|238923598|ref|YP_002937114.1| rhodanese-related sulfurtransferase [Eubacterium rectale ATCC 33656]
    MGFFDFFKQSNINQGIEEYKMTAGAVLLDVRTPQEYQEGHIPESKNVPLQQLDNIVSVAKNKDIPLFVYCYSGSRSRQAT
    GMLQRMGYSKVNNIGGIAAYSGKVEK

    >gi|238923599|ref|YP_002937115.1| NADH dehydrogenase [Eubacterium rectale ATCC 33656]
    MKVIIVGGVAGGATAAARIRRLNEHAEITVFERSGYISYANCGLPYYIGDVITDLEELTLQTPESFFKRFRINMKIHHEV
    ISIHPEYKTVSVKNLENGEIFEENYDKLILSPGAKPTQPRLPGVGIDKLFTLRTVEDTFRIKEYINKNHPKSAVLAGGGF
    IGLELAENLRELGMDVTIVQRPKQLMNPFDPDMASMIHNEMRKHGIKLVLGYTVEGFKEKDNGVEVLLKDNPSLQADMVV
    LAIGVTPDTVLAKEAGLELGIKESIVVNDRMETSVPDIYAAGDAVQVKHYVTGNDALISLAGPANKQGRIIADNICGGDS
    RYLGSQGSSVIKVFDMTAATTGINETNAQKSGLEVDTVILSPMSHAGYYPGGKVMTMKVIFEKESYRLLGAQIIGYEGVD
    KRIDVLATAIHAGLNATQLKDLDLAYAPPYSSAKDPVNMAGFMIDNIAKGTLKQWHLEDMDKISKDKDVVLLDVRTVGEF
    SRGHIDGFKNIPVDELRERISEIEKGKPVYLI
    CQSGLRSYIASRILEGNGYETYNFSGGFRFYDAVVNDRALIERTYACG
    MDY

    >gi|238923603|ref|YP_002937119.1| peroxiredoxin [Eubacterium rectale ATCC 33656]
    MLELGIKAPDFELPDQNGEMHKLSDYAGKKVILYFYPKDNTAGCTKQACGFSERYPQFTEKGAVILGVSKDSVASHKRFE
    EKYGLAFTLLADPERKVIEAYDVWKEKKNYGKVSMGVVRTTYLIDEQGIIIKANDKVKAADDPENMLKELA

    >gi|238923740|ref|YP_002937256.1| putative ATPase of the PP-loop superfamily implicated in cell cycle control [Eubacterium rectale ATCC 33656]
    MQLSIEEVKKLDSNSYQIIDIRSEEEVAHGAIKGALNIQAEEIESDERVPHDKKLVIVCSRGKTSVDVAEYLTEKGFDAA
    SLKGGYISWLLDAMKEDEVAERDIKADVEQSIRKKFKKSIWRKFTKAINTYELVKPGDKIAVCISGGKDSMLMAKLFQEL
    KHHNKFDFDVKFLVMDPGYNEANRHVIEENCRNLGIPATIFESDIFDAVYDIEKSPCYLCARMRRGHLYAFAKELGCNKI
    ALGHHYDDVIETILMGMLYGAQVQTMMPKLHSTNFEGMELIRPLYLVREDDIKAWRDYNGLHFIQCACKFTDTCTTCNNE
    ENRSKRVEIKQLIANLKKVNPFVEANIFKSVENVNLATVVAYKKDGIKHSFLDHYDE

    >gi|238924006|ref|YP_002937522.1| rnfE/nqrD [Eubacterium rectale ATCC 33656]
    MNKYVERLYNGIIKENPTFVLMLGMCPTLAVTSSAVNGLGMGLSTTVVLICSNLLISLFRKVIPNGVRMPAYIVIVASLV
    TVVQFLMQAYLPSLSAALGVYIPLIVVN
    CIILGRAESYASKNPPVESIFDGMGMGLGFTMGLTIIGLIREILGAGTFFNI
    KIFGDWFTPITIFIMAPGAFLVLGFLVAGMNIIRKKMEAKGTPLAEPAGCLSGDCAHCGASCPSAKAAQAAVAPNTTEGG
    DK

    >gi|238924007|ref|YP_002937523.1| Na(+)-translocating NADH-quinone reductase subunit D [Eubacterium rectale ATCC 33656]
    MGTLGHLLLIAVAYAIVNNVVLSQFLGICPFLGVSKNTKTAAGMGGAVIFVITIATFVTQLIYNFILYPLNLSYLQTIVF
    ILVIAALVQFVEMFLKKQMPPLYKALGVYLPLITTN
    CAVLGVALNSVTKGYNILESVVYGFATAFGFFIAIVLMAGVREK
    IEYNDIPKPFQGTAIVLLTACLMAIAFMGFSGMVSV

    >gi|238924387|ref|YP_002937903.1| alkyl hydroperoxide reductase [Eubacterium rectale ATCC 33656]
    MKNKLSFISIFTLCIALSLTACGGKQSSNTNSKNTQTEAGSEASGKSDSKLDDLYQQENQLFADHADAWNKAFGMMNKSD
    ADPNGNYADYLAGTVESNKDSFTDDELKTLNEDIETIRKIEEQIAELENKNKSSDDNKKDSSKASSVFSDFSGEDFDGNK
    VDDSLFSGNAVTVVNFWFTG
    CKPCVAELSKLNELNDAIKSMGGEVVGINTETFDGNKTAIKEAASVLESQGVKYRNLSID
    SSSAAGKYASEIMAFPTTILVDRNGNIVGEPMLGGIDNQDNYDALMKQIQSVIDADSTNK

    >gi|238924789|ref|YP_002938305.1| endonuclease V related protein [Eubacterium rectale ATCC 33656]
    MKTRQEALDYGLSFPNTYQEAPFHDPNWQLIRVKDSKKVFLWTYERNGFINLNVKVSPAWRDFWRDAFPSVIPGWHQNKD
    NWNTIILDGSIPDDAIKNMISDSYDLVTYNPTRLIYEAVKRIPKGCVATYAQVAELAGNKKMCRAVGNALHKNPNPDEIP
    CYRVVNAKGELSGAFAFGGADEQANRLRADGIEVIDGRVDLDKYGIRIVDDVIYTKTTVEPLT

    >gi|238925314|ref|YP_002938831.1| hypothetical protein EUBREC_2969 [Eubacterium rectale ATCC 33656]
    MKKTYKIDVDCANCANKMEDAAKNTAGVKDATVNFMTLKMSVEFEEGQDAKAVMQEVLKNCKKVEDDCEIFL

    >gi|238925336|ref|YP_002938853.1| thiol-disulfide isomerase and thioredoxin [Eubacterium rectale ATCC 33656]
    MGATKIIRSTDGRRTTMVKKINSSEFEQVKNNKAIIVDFSAEWCGPCKMLAPVMEQLSDEITDVEFYNIDVDENPDLARE
    YRIMNIPAVIAIKGGQVAGQQIGLVSKDDMKGFIEGVF

    >gi|238925503|ref|YP_002939020.1| selenide, water dikinase [Eubacterium rectale ATCC 33656]
    MPQEIVFCKGGGCTAKLGPDLLSHVLAKLPRGEKDSNLLIGYDSCDDAAVYKISDDTAVVQTLDFFPPMVDDPYTFGQIA
    AANALSDIYAMGGTVKTALNIVCFPEKMDLNILGKIMQGGADKVIEAGGTLAGGHSIADSDVKYGLSVMGTVHPEHIYSN
    NTGQPSDVLILTKKLGVGLVCNANRVGEAPLGAIEDAVSSMTTLNKAASEISHAFDIHACTDVTGFSFLGHLSEMLNDDI
    TALIDSISIPVITGALRCADEFFLTAAAQRNRNHVGDKVCFAKNIPFSMEEVLFDPQTSGGLLFAVKASEADAFLHELKA
    AGLPAAKVGRFVKRRDVPIYVN