Eubacterium limosum KIST612 uid59777

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|310825662|ref|YP_003958019.1| protein of unknown function DUF395 YeeE/YedE [Eubacterium limosum KIST612]
    MEEEKIQRSTRTRAPRKPKKNQIPIAIVVTILVVAAGVYLGLGSEKLPVYWIIGLCFGFILQRARFCFTASVRDPSLTGS
    TSLTRAVLIAFAVTTIGFTAIKYGAYINGQEIPGMSSVSPISLPLALGAVFFGIGMVIAGG
    CASGTLMRVGEGFTMQMLA
    LVFFVVGSFWGAHDMGFWDGVFNTNAPKIFLPDVFGWFGALVVQGLIILLLYIAARQWQKKKMGTAD

    >gi|310825664|ref|YP_003958021.1| protein of unknown function DUF395 YeeE/YedE [Eubacterium limosum KIST612]
    MKEFFQKLSKNDFYKKLMKEPLTYVAGAVLLSVFQIAHLASLGSAWGVTSAFADWGAWIYQGLGGDVSSWAYFASEKAQH
    TLAAGFLHDGGSIRNIGIIVGALLATLYASQFKIKKIKSIRQVVAAVLGGLLMGYGARMAHG
    CNIGALYSGIASLSLSGW
    IFAAFLMVGAFIGSKLLAKYFM

    >gi|310825665|ref|YP_003958022.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Eubacterium limosum KIST612]
    MNKKTEKYDVVIIGGGAAGLTAGIYCGRARLKTLLIEKALVGGLATYTSEIENYPGFPEGSSGLGLMDLFHEQAKKFGVK
    FKLTDVRSVDFSGETKVVETFRNRFEAKVVIVATGGKPRLTGAENEDKYLYDKGISF
    CATCDAAANTGKTVMVIGSGDAA
    IEEGTFLTKFADKVIVSVMHEEGKMDCNEIAKAQALENPKMEFIWNTVAERFEGDEHLDTVVLKNIKTEESIPVKVDTCF
    LFIGYLPNTEWFKDILDMNRGGYLITNERMETNVPGVLAAGDVRDKFLKQVATAVGDGAIAGYGAEKYISELEVYESQVL
    NNGEPSVVYVWNAVDPK
    CRELMTTVEAFQEKHAGDLHVTNVDIYKSDGIARRLGISEVPAVLYIKNNEVQKTLTQNISME
    GLEGLVD

    >gi|310825952|ref|YP_003958309.1| methylated-DNA/protein-cysteinemethyltransferase [Eubacterium limosum KIST612]
    MSVSLNEKFYRVIANIPEGRVATYGQVALLAGRPRAARAVGAALRHVPAHLELPCHRVVFSDGSLCKGLIFGGPGIQEQL
    LKKEGVAFLPNGKVNMRCCLWKIAEDFSH

    >gi|310826000|ref|YP_003958357.1| hypothetical protein ELI_0377 [Eubacterium limosum KIST612]
    MRITVIGAGPGGYEAAIMAAKLGAEVTCIEKDEVGGTCLNRGCIPTKAFLAASDVLETVESAKDFGINIDGTVSVDYKAV
    VDRKNKVKDGLIKGIHFLFEENKVNLIKGTGKIVDKNTVEVTKEDGSTETIETDKIILATGSVPVSPGMFKYDGKKVITS
    DEVLDLEKAPESIIIVGGGVIGCEIGQFLSRMGTKVTIVEALEQILPNEDKDVSKQLLRQFKKDKIKVHTGVGVAEVEVS
    DDGVKASLANGKSVEAEMMLVAIGRRSFVDNLGAQDAGVEVDERGRIIVNDKMETSVPGVYAIGDIVATAQLAHVASKEG
    IVAVENAMGADKHVTYAAVPRCVYTEPEVAGVGLTEKDCEKKGVEYKLGTFDFRALGKAQAIGKIQGFVKVIVDNNDVIV
    GASIVGPHATDLLAELSLAVHLGLTAEQVGDVIHPHPSLSEALMEALHDVHGKSVHK

    >gi|310826145|ref|YP_003958502.1| Multidomain redox protein (NAD(FAD)-dependent oxidoreductase Rhodanese domain, Rhodanese domain, SirA-like redox dom
    MKKILIVGGVAGGATAAARLRRLSEEDEIILFERDEYISFANCGLPYYIGDVIKDRSKLLVQTVAGMSKRFNLDIRNFSE
    VVSIDRAGSTVEVKNTKTGETYTETFDHLILSPGAKPIAPPIPGLAEADSIFTLRNVADTDKIKAEVTERSPKRAVVVGG
    GFIGIEMVENLRELGINVTLVEKLNQVLKPLDYEMAQIIHQELNAHGVNVILGDGVDHFEDAGKKVVLESGMKLDADMVI
    LAIGVAPENKLAKDAGLKLGTRGHIVTTETYEVMDGANGEVIKNIYAIGDAIEVRDFVDGSQTAVPLAWPANRQGRTVAD
    HINGIPFKNHGIQGTSVAKVFNKVFATTGNNVGQLRAKGLPFQQIHAHRGNHAGYYPDSTNIALKLIYDPKTLKVLGAQA
    VGQEGTEKRIDVIASVMKMGGTIYDLQDMELSYAPPFSAAKDPVNILGYIAQNIDEGVYKTVEWDEIDDIIAGGGYLLDV
    RTPVEFGAGHVEGSHNLELDTLRDHIDEIPVGKDEPLYIT
    CQVGLRGYLAIRILEDHGFTNLYNLAGGYNTYKAGHYKLA
    EPNFDVEGSKLGEPEAPEGAKADVNPVKTVDVTGLQCPGPLMATYKAVSEVKEGELVQTIATDFGFVQDVECWCKTNGHT
    LISQETRGNKYIATIRKGGGASACGLAAADPAVQKNATMVVFDGELDKAIAAMIIAQGAAAQGKDVTLFFTFWGLNVLRK
    PKAPKVKKNRIEKMFGLMMPKGARRLPLSKMNMFGIGPAMIKSIMKKKNVDDIETMIHKAQDAGVRFIACTMSMELMGIK
    KEELIDGIEYAGVGTYIASNENVGTTLFI

    >gi|310826263|ref|YP_003958620.1| hypothetical protein ELI_0642 [Eubacterium limosum KIST612]
    MKIFDVIVLGGGPAGYTAALYCARANLKTMILEKMWPGGQMATTSQVDNYPGFNEGIDGHELSERMKLGAERFGVVSEYG
    EVISIEATGQPKRIKTNSAEYECKALIIATGAAPRSLNLPHEEELRGRGVAY
    CATCDGLFFKNKVVAVVGGGNSAVADAL
    YLSKICKKVYLIHRRNRLNATKTYLALLDETENIEFIWNSQVVEPIYGDVLTGIKLENTETGAVSQLDCDGLFIAIGRRP
    NTDLFEGIVDIDEAGYIIADETTQTNVEGVYAVGDVRTKPLRQIITAASDGAVASKFIEDYFVQLCGRNHKAKSLRYKSE
    PNRFFVQTPENYEVGELNLEPTTDNTFIITHVGVDNSYNGLGIAKELVRQTVEAARQNHWKLIPRCPFAKAEYDKHPEYK
    DTLA

    >gi|310826264|ref|YP_003958621.1| hypothetical protein ELI_0643 [Eubacterium limosum KIST612]
    MENNKFDVIILGGGPGGYTAALYCARAGLSTMVLEKMWPGGQMATTSRVDNYPGFEEGVDGIELSGKMQQSAERFGVVTQ
    IGEVLSIDLESQPKVIRTGKGDLEAKAVILATGAAPRTLGIPGEDELRGRGMAY
    CATCDGMFYRNRTVVVVGGGNSAVAD
    ALFLAKICKKVYIVHRRDTLRASKTYMKTLEKTENIEFVWDSRVVEVLHDDLVTGVKVENVKTGDVTELSCEGVFVAVGR
    TPNTDMFKGVLDLDGQGYLIADETTRTNIPGVFAVGDVRTKPLRQIVTATADGAVASKYAEEYLAELCAGE

    >gi|310826479|ref|YP_003958836.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Eubacterium limosum KIST612]
    MKEMKIDIAVIGGGPAGMAAALEARRQGAGKVMIIERDIEPGGILQQCIHDGFGLHRFKKRLSGTDYAQRFIDEVEASDI
    EVLLDTMVLEITRDKVIYACNNRDGMMKIRCGAVILAMGCRERTASQVLLYGYRPAGVMTAGSVQRYINMEGYLPGKEAV
    ILGSGDIGLIMARRMTLEHIKVKGVYEVMQDPGGLTRNIVQCLDDYGIPLHLATTVTWIHGKERLEGVTVAKVDEHRKVI
    PGTEEFISCDLLVLAVGLIPENELSVKAGIEMDPRTRGPVLDNHFMTSVPGIFAAGNVAVVFDLVDYVSESGEIAARGAA
    AYLNGTLDTEAEAVETVPGENVNFIVPQRVRAGSREETTLFMRVKKPEKSVRLTCENGGETLVSKKLKTVAPPEMVACTV
    TPGHDAPLVVDVKEA

    >gi|310826530|ref|YP_003958887.1| glutathione peroxidase [Eubacterium limosum KIST612]
    MKNIYDFRVEKMDGGKQALKDYEGKVLLVVNTASKCGFTPQFDGLEALYEKYKDQGLMILGFPCTQFANQDPGSNEEIEN
    FCRLTYGVSFPMMAKIDVNGDNAEPLFVFLKEQQGFRGFDLNTEKGKAFDERLSKDDPDYAQKSDIKWNFTKFLVDRDGN
    VVARYEPMVEPAALEKDIERLL

    >gi|310826719|ref|YP_003959076.1| dihydrolipoamide dehydrogenase [Eubacterium limosum KIST612]
    MSESKDFKHYDLVVLGGGFGGYTAAIRAAQLGKKAAVIEEDRLGGTCLNVGCIPTKFMLQNAKIIKACDGAAKRGVVMSQ
    PSVNMAQMIKNKDEKVRRLGGGIKMLLKSNGVDVYQGTGEVFPDYSAKITDMEGGEEIIGWEKLVIATGSNPAIPDLFRD
    IPGLLTNREALNLPYLPKELIIVGGGVVGCEFATIFSIFGTKVTMLQNGSTLINGFDKEGTACVEESLVKNGVTIHYNAF
    VRDIYKDSASNFHLEVEMRNEEQPKSFCCADVLMATGRCANLKGLDSLNLELDRGWVDVNDYLETSVADVYAIGDVTAKS
    HLAHGASAMAMRAVENMFGGRPTKMNYSLIPSCVYTLPEVASVGMREEAAREAYSNVRVGSFPMSASGRALIRDESQGFV
    KVITEDKYGEILGIHVAGPGATELITQAETIMALEGTIEDMCRIIYPHPTISEALFEAAMDTFGMSIHLPKKEA

    >gi|310826954|ref|YP_003959311.1| hypothetical protein ELI_1362 [Eubacterium limosum KIST612]
    MYKRNYRNTEDAISILGFGCMRLPKINPDRPEIDEVAAQALFDYAFEHGINYFDTAFNYHQRLSEPFVGKALKKYPRDQF
    YLASKMPGFLVKEEKDVDEIFEKQLENCQVDYFDFYLCHAISDESFKVYDDCNIMEHLLKRRADGQIRHLGFSFHGSPEK
    LEELVERYDWDFVQLQLNYVDWNVQNAKRQYEILDAHGLPCIVMEPLRGGTLAVLCDEAAAVLRESEPDKSLASWGLRYA
    ATLPNVLTVLSGMSAMDQVADNICTMENFEPLSESEMALVNKAGDIFTKTKTIPCTGCRY
    CMDCPSGVEIPGLFKLYNEY
    MLGEDKNDFVNGYKALGPEKQESQCTACDQCTEHCPQSIDVPEALKKVTALAEKLL

    >gi|310827188|ref|YP_003959545.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Eubacterium limosum KIST612]
    MNRIQTDCAIIGGGPAGLAAAVEAHRAGLDTLIIERDLSLGGILQQCIHDGFGLLRFKRRMTGGQYAQAFIDEVEAEGIE
    VKLDTMVLEIRPDKTIYAVNEKDGLLEIKAKSVILAMGCRERTRSQVMIYGTRPAGVLTAGAVQRYINMEGYLPGKKAVI
    LGSGDIGLIMARRMTLEDIEVKGVYEIMHTEGGLTRNIVQCLEDYNIPLHLGTTVTKIHGKDRIEGVTVAKVDEHLKPIA
    GTEEYIDCDLLVLSVGLIPENELSEQLNIEMDPRTRGPVVDEQMMTSVPGVFAAGNVVTVFDLVDYVSQTGEMAARGAVR
    YIKGETGGNEYRAVEAGDNISFVVPQKISGTVGEVPVFMRVRKPDEKVRLVFSQNGQSQKLKKHAVVKPPEMVCEVIDLG
    KTTDGPICISVAKE

    >gi|310827699|ref|YP_003960056.1| methylated-DNA-protein-cysteine methyltransferase [Eubacterium limosum KIST612]
    MSDVRIYTTHYASPLGGITIASDGAALTGLWFDGQKYFGDTLPEQYVAGELPVFDAAKNWLDIYFQGKSPDFTPPLLLDA
    SPFRRAVWEILLTIPFGQTMTYGEIADKIAEQKGTDRMSAQAVGGAVGHNPISIIVP
    CHRVVGTSGSLTGYAGGIDKKVK
    LLTLEKTEMSGFFIPKKGTAL

    >gi|310828021|ref|YP_003960378.1| hypothetical protein ELI_2433 [Eubacterium limosum KIST612]
    MSENKPKRLTEMVRNCGCAAKLGPGALSKVLKDLELKDCDSLIIGLENSDDAAAYRINDKQILLQTLDFFPPIVDDPYLF
    GQIAATNALSDIYAMGGKPLTAMNIVCFPEREDKKILSEILRGGADKIQEAGAVLVGGHSVDDPEPKYGLSVTGITDCLH
    LHGNCHAREGDKLILTKPVGTGIIVSAIKGGIATPESREAAILSMTTLNKTACEVMGLYDEVHGCTDITGFSLGGHGIEM
    AKASHLSMELEASAIPLLPGVIELAEMGIVPGGTYRNREYFGPDYRSSVSGGMEDIIFDPQTSGGLLISVAPSESENLLK
    TLKVELKTDCALVGQLTDRQDKALIIKE

    >gi|310828040|ref|YP_003960397.1| hypothetical protein ELI_2452 [Eubacterium limosum KIST612]
    MKKNFKIEGMSCTACAAAIERTVNKMDGVEDAVVNYATENLTVTYNDSSVQPPAIVSAIEKIGYGAVPEQEASASGKSTV
    RNTAGENAQKQMKELQTRLIISLVFTIPLFYLSMGPMVGLPIPAFLDGDMNRLVNTITQMLLTLPVVYMGAHFYKDGFKA
    LWKRIPNMDSLVAVGTSASFLYGIYVLYQLAWGYSYGDMTMVHHFAHEIYFEGTAVILTLITLGKYMEARAKGKTSQAIE
    KLIALAPDTALVERGNSEVEIPIDDVRLGDTVVIKPGDRIPVDGEIISGHSSVDESLLTGESIPVEKETGDHVICGSINK
    TGAFKFRATKIGDDTTLSKIIHLVEEAQSSKAPIAKIADQISRYFVPAVMGIAALSFIVWLLLGYEFSFALSMGISVLVI
    SCPCALGLATPTAIMVGTGKGAEQGILFKNGPALETLGKADAVVFDKTGTITIGKPSITDIVPLGNTDEETLLQLVASIE
    AKSEHPLSEAIVEGANGRGIALRDVSDFNAIPGLGVEGTVDTRFITIGNQKLMKGSGIDPSTQTELYNTLSDAGKTPLFI
    GEGSELIGIIAVADTLKENSANAIAQLKAMGTQVYMLTGDNERTARAIGSKINIDHVIANVLPEEKADLIKKLQTEGKQV
    IMVGDGINDAPALAQSDIGIAIGNGTDVAIESADVILMQNDLLQIVAAIQLSKATIRNIKQNLFWAFIYNTIGIPLAAGI
    LYLPFGLKLNPMFAAAAMSLSSVSVVLNALSLKGFKPKFIPVNDLPSAHTDVTVVNNQFNTSDSVTESQKEGTNMTKKLH
    VNDMSCKHCVKRVEDTLNAIDGVSNVQVSLEDAQATMDVTDAVTDKMLCDALDEAGYPASVITE

    >gi|310828203|ref|YP_003960560.1| hypothetical protein ELI_2616 [Eubacterium limosum KIST612]
    MNTIFKATAKKLPEGLQVETTARNFKILLDEPEDLGGTNKGLNPVEAVLSALGACQTICAYAFAGAMHIDLKDFYVELEG
    DLDPDGFMGLNKEVRNGFSEVRFTMHMTTDASQKKAEKLADFIESRCPVGDCLENPVKLIRTGVVIHQE

    >gi|310828226|ref|YP_003960583.1| RnfA [Eubacterium limosum KIST612]
    MTNILLILVSGIFVQNFILSKFLGICPFLGVSKQIETAVGMGIAVTFVMAMASAITYVVQYAILDPLGLGYLQTIAFILV
    IAALVQLVEMIIQKTSPSLYQALGVYLPLITTN
    CAVLGVALLNIQYGYNFIETVFNGIAGALGFTLAIVLFAGIRERLEL
    SDIPKPFEGFPIALVTAGLMAIAFLGFSGML

    >gi|310828227|ref|YP_003960584.1| RnfE [Eubacterium limosum KIST612]
    MGSFKHFTNGLIKENPTFRLLLGMCPTLAVTTSAINGLGMGLATTVVLIGSNVVISALRKIIPDKIRIPAFVVIIASFVT
    IVGMLMKAYVPALDAALGIYIPLIVVN
    CIILGRAEAFAFSNPVLASFADGAGMGLGFTLSLTVLGSIREIIGAGAIFGLS
    IFGAGYEPVLIFILPPGAFLTLGVGIAAINKITEKLEAKKSNKEDSLS

    >gi|310828242|ref|YP_003960599.1| peptide-methionine (S)-S-oxide reductase [Eubacterium limosum KIST612]
    MKKLRTIYLAGGCFWGLEKFMENITGVVETRVGYANGNKEKPTYKEVCTGRTGFAETVKVVYDPGVISLEALLIAFYNVI
    DPTSVNRQGPDVGSQYRSGIYYTNSDDLPVIEHVTTMTFRRLGGRKPLATEIKPLRNFYDAEEYHQKYLDKNPGGYCHIP
    EWKMGYSQDRELRAS

    >gi|310828292|ref|YP_003960649.1| glutaredoxin [Eubacterium limosum KIST612]
    MKEIRLYTWPHCPFCNNAKRLLDQKGLTYKDVDIYGNNEMKQVLAEKTGQHTVPFIFVDEKFIGGYTELAELDNQGDFDK
    MLA

    >gi|310828450|ref|YP_003960807.1| hypothetical protein ELI_2863 [Eubacterium limosum KIST612]
    MKILDYDVVIIGGGPAGLGAAVKAKENGARVAVIERNDELGGILNQCIHSGFGLQYFKEELTGPEYAELFINKAKEAGID
    CYLKTMVLDITEDRKVTAINEEGTVIFNAGAVVLAMGCRERTRGAIKIPGSRPAGVFTAGLAQRYVNMENFKPGSRVVIL
    GSGDIGLIMARRLTLEGIDVVGVYELMPYPNGLYRNIKNCLDDFDIPLHLSTTVTKINGSDRVESIEVTKVDENLQPVEG
    TEETIECDTLLLSIGLIPENELSKKAGVLLNPVTNGPLVDDSLETNVAGIFACGNVLHVHDLVDNVTMEAEEAGASAARY
    AKAAKAKEGDALAVKPEGLVRYTVPSKIYKGENDHVIVKFRVGRPVDNARAVITSGGEVVFESRKARKFIPSIMEEIKLK
    AEQLEALTEPLVVTVKEA

    >gi|310828558|ref|YP_003960915.1| hypothetical protein ELI_2983 [Eubacterium limosum KIST612]
    MMKQHTLKSAKVPDTYKKPDDQSLKETLSPEAYEVTQNSMTERAFAGEYWDQFEPGIYVDITTGEPLFSSSDKFDAGCGW
    PSFSKPIDPDTIRKHKDTSYGMVRTEVRSRTGDAHLGHVFEDGPADLGGERY
    CINSAALRFIPKDQMEAEGYGWLLSVLA


    >gi|310828595|ref|YP_003960952.1| hypothetical protein ELI_3020 [Eubacterium limosum KIST612]
    MLQQGTKAPDFTLPDKDKHPVSLSDFKGKKVILYFYPKDNTKGCTTQACTFRDAYSEFEALGAVVIGVSKDSTRSHTNFA
    SKYELPFLLLSDPETEVIQAYDVWKEKKMYGKTYMGIVRTTYIIDEAGMIEKVYEKVKPAENADQILEHLKGEA

    >gi|310829038|ref|YP_003961395.1| thioredoxin reductase [Eubacterium limosum KIST612]
    MHYDIIIIGSGPAGLAAGLYAARGQMRTLILEKGGFGGQIATSWEVENYPGAPADTTGPSLTERMREQCVDFGVEFQTEE
    FKYFEKTGQTFEVTTSSTVYQTKAIIVATGAQPKLLGCPGELEFRGLGVSY
    CATCDANFFRNLEIAVVGGGDTAIEEAIY
    LTKFASKVTVIHRRDKLRAAKVLQERAMENEKIRFVWDSVVEEIKGDGLVQSIVVKNVKDGALTEIPVQGVFVYVGQIPH
    TQYFVGTLEKDARDYLITDEDMCTNIPGVFAAGDVRRKSLRQVVTAAGDGAIAAVSAIKYIEDYSEVAES

    >gi|310829042|ref|YP_003961399.1| CoA-disulfide reductase [Eubacterium limosum KIST612]
    MKKILIVGGVTGGASAAARLRRLNEEDEIILFERSEHTGCAGCGLPYYIGGVIEERRKLLQTVSGLAKRYRLDIRCGSEV
    LSINRDDKSITVREKETGETYEESYDKLVLSPGSRPTVPDLPGMDEAENAFTLKDVQDADVLKKALMTLTPKHAVVVGGG
    FGGLAMAENLQRLGLTVTIVEKKRQVVGAFDFEMAQILHRELNVHGVGLVLDDGVSRFENKGKTLVLESGRTLDCDLSIL
    TMGVKPESGLAQRAGLRVSEAGYVVTTQTYAALDADLLTPVDGIYAIGDVVQVQNFVDKQPDAAGLAGPATRQGRVLADH
    LAGLPTVNNGLQRTSILKIFGKTAATTGNNVARLKKMGISYQEVHAHRLCHADNYPGASLIDLKLIYDPKTLKILGAQAV
    GKEGVDKRIDVISTAMRLGATIRNLACLELCYAPPYSTVKDPVNILGTIAGNISEGVYKTIPWDEIEGIVADGGFLLDVM
    PPEEFDKGHISGAVNIELDCLRERLDELPQERGLPLYICSGTGQRAYTAVRLLRGCGYNNLYLLSGGYATYCDGTYQPNA


    >gi|310829319|ref|YP_003961676.1| hypothetical protein ELI_3757 [Eubacterium limosum KIST612]
    MARVINAQEFNEEVLKGKGVVLVDFFATWCGPCKALSPILDELAEKVKDVKIVKVDIDADSELASEYRVMSVPTLKIFKD
    GEVKESLVGGRPLEELEAKLMEYQS

    >gi|310829320|ref|YP_003961677.1| pyridine nucleotide-disulfide oxidoreductase family protein [Eubacterium limosum KIST612]
    MKHYDAVIIGFGKGGKTLAGSLAGMGKKVAMIEKSDKMYGGTCINVGCIPTKSLVNSAKASVIQKPGSYEEKNRLYWEAV
    EEKRRLTGMLRKKNFDKLNDLDNVTVYNGLGSFVSANRVKIETAEETLEVEGGQIFINTGSVSVIPPIKGIEGNPYVYTS
    VSLMELDVLPKRLAIIGGGYIGLEYASMYTDFGAEVTVYQIEDKLIPREDRDIAEAIQKAFEDKGVHFEMNVQTEEIENA
    GSEAVVHYKKDGTALTAGADAVLIATGRKPNTEGLNLEAAGVEKTPRGAVKVDEKLRTSVPNIWAMGDVAGGLQFTYVSL
    DDFRIVKDQLTGSGKRASSDRTVPYSVFIDPPFSRVGLNEEEAAAQGYHVKIAKLPAAAIPKAQVLRKPVGLLKAVIDAD
    TNKILGTMLFCEESYEMINIVKLAMDAGLDYTVLRDQIFTHPTMSEALNDLFAV

    >gi|310829322|ref|YP_003961679.1| hypothetical protein ELI_3760 [Eubacterium limosum KIST612]
    MWKKGIIILMLLVLAATAYTGCTAKPTKGSSQSKQEGDKNMVKAEYYKISQDEAKKRMDEHENILIVDVRQKNEYNEGHI
    KDAVLVPLDTIGGEKPEALPDSDQEILVY
    CRSGKRSEQASRKLVALGYTNIYDFGGINTWPYETE

    >gi|310829536|ref|YP_003961893.1| rhodanese-like domain protein [Eubacterium limosum KIST612]
    MSRELKNIEPDELEALLEKNDGNTVLLDIRDKMEIHNEFEDQECVVNIPLKLLPSQMEMLTPFKDKTIVLVCRSGMRASR
    AQKLLEQEGFTDLRVLRGGVVHWERFKKG

    >gi|310829663|ref|YP_003962020.1| hypothetical protein ELI_4115 [Eubacterium limosum KIST612]
    MATQFDRTALVLGDEGLKKLQNARVILFGVGGVGSFTAEALIRAGVGSLTLVDKDVVDITNLNRQLIALHSTIGRVKVEV
    AAERLRDINPAAEIIPLHQCFLPENAEDFELETYDYVIDAIDMVTAKLALICACQEKGIPVLSSMGTGNKLDPSCFEITD
    IYKTSVCPLAKVMRRELKARGIKKLKVLYSKEVPALK
    CTPPGSVSFVPSVAGLMIAGEVTRSLAGL

    >gi|310829878|ref|YP_003962235.1| hypothetical protein ELI_4332 [Eubacterium limosum KIST612]
    MGFATGAGVPAIMVFLQGILSFFSPCVLPLVPLYIGYLAGGTKTVDADGTVHYKKRTVLINTLFFVIGISATFFILGVGF
    TAAGQFFTGNRMLFARIGGVIIILFGLVQLGVFNFDFLNREHRLPFNLDKLAMNPLLAFVLGFTFSFAWTPCVGPVLASV
    LLMASSSSSFASGFILIGVYTLGFVLLFMAVGLFTSTLLDFFRRHQKAVRYTVKAGGVLMIIMGIMMFTGWMNGITGYLS
    QAGAGSSAPQPSPTVTTEPVPSPTPENTPEENAKKTLAPDFTLTDQYGVTHTLSEYRGKTVFLNFFATW
    CGPCQKEMPDI
    ETLYKKYGDNSGDLVVLSVANPHTEEGPNNNDMSPEKIADFMSDNGFTYPALMDRTGAVFQAYGIRSFPTTFMIDKDGYV
    KGYVPGMLTSSMMESIVNQAMAQ

    >gi|310829903|ref|YP_003962260.1| putative alkyl hydroperoxide reductase F subunit [Eubacterium limosum KIST612]
    MDKIYDLIIIGGGSAGLSAGIYAARAMLDTLIIEKNQPGGQAVNTAEVVNYPGIRRTTGPKLMDEMHRHAMDFGAEFTVA
    EIEGVDLEGEVKALHTSRGTYRSRAVIIATGASPRKIGFAGEKEYTGRGIAY
    CATCDGEFFSGLDIFVLGGGFAAAEEAV
    FLTRYGRSVTIVVREDDFTCAQMVADKVKEHPGIEVWYNTEVKEVSGDDFLKKAEFFNNKTGATFTYESKDGKPFGMFVF
    AGYEPATQIFKGRVDVDAEGYIPTNDRMETNVPGVYAAGDLRPKELRQIVTAVADGAIAATAAEKYVAAERERLGLAAPE
    PKAAKTPAAPEPEAEAPQGMEDGFIPAAMKGQLREIFQKLERTARVVTIIDPAVPKTLEMQGFLEEVAALNDHIQVEAYK
    KGEKPELEAAMHLDNLPVAALFDPEGQYSGVKFTGIPGGHEMNSFVLAVYNFAGPGQAVDEALAKRIAAIDHPVNAQICI
    SLS
    CHFCPDVVAACQRIALLNPNIQAEMIDTALFPKLKEEYKLMSVPAMILNKRDVVFGAKKMSEIVEIFENLKN

    >gi|310829904|ref|YP_003962261.1| alkyl hydrogen peroxide reductase [Eubacterium limosum KIST612]
    MKNLIGKELIDFEVQAYHEGDFKTVTKEDVLGKWGVFFFYPADFTFVCPTELADVADNYEEFKKIGCEIYSVSEDTHFVH
    KAWADTTDTIKGLPYPMLGDPAGVLAKFFGVLVKEEGQALRGTFVVDPDGVIKVYEIHDMGIGRNAEELLRKVQAAQFVR
    EHGDQVCPAKWKPGEDTLTPSLDLVGKL

    >gi|310829924|ref|YP_003962281.1| hypothetical protein ELI_4379 [Eubacterium limosum KIST612]
    MATKTYILEHLGCANCASKIERKIASLPGVSEANIVYATKQLRLTAEDPDGLLPEMQKIAVSYEPDILITEQKRRSLKKA
    PAAVGRAPHNHEEHHHSAACGCGHDHHDHGEHHHDTDCACGHDHHDHGEHHHDTDCACGHDHGDHHAHYHVPGHPADCQC
    DLCRHGEEYCHICGESLANCTCKMPDADVEKAVFILENLG
    CANCAAKMEHKIKELPGVEYATITYATRQLRLSADNAAAL
    LPEIQHICAAIEPDVKVIPRKKTMGKGATKVYTLENLG
    CANCAAKMEAKINALDDVSSATITYTTRQLKVTGKDPDSLLP
    QLRDICQSIESDVQVIPKETRPKALIPEASASAGKAVKKKMSAETKTLIGIIIGAALFIIGEIMERTLPPVYNIPVFVLA
    YIILGGRIVVTAAKNLMKGQVFDENFLMSVATLAAFAIQDYPEAVGVMLFYRVGEYFEDRAVEKSRKQIMDAVDMRPEVV
    SLLVGDEVRVIDAEDAAVGDILLVRPGDRIPLDGVIVEGESRIDTSPVTGEPVPVKAGYGDEVVSGCVNTSGLLKMRVEK
    VLEESMVTRILDSVENAAASKPKIDRFITRFSRIYTPFVVGLAILTAVVPSLVTGDWYYWIYTAITFLVISCPCALVLSV
    PLAFFSGIGAGSKRGILFKGGVSIEGIKNIAAVVMDKTGTITEGNFVVQQAVPANGMDETRLLALAASCELTSTHPIGNS
    IVTAAEERGLSVERPDSAREIAGKGVEAVLKDGTVLCGNRSLLESQNIDLDGYKNDHYGTEVLLALDGKFIGYLVISDTI
    KADAVDAIAKIKRLGIRTAMLTGDAQESAEAVAKSTGIDEVHAKLLPEDKLSELQAIRKAQGGVMFVGDGINDAPVLAGA
    DVGAAMGSGADAAIEAADVVFMNSSVEAIPEAIEIGRKTSRIAWQNVVFALIIKALVMVLGLLGFANMWMAVFADTGVAI
    LCVLNSIRILYKK

    >gi|310829955|ref|YP_003962312.1| hypothetical protein ELI_4415 [Eubacterium limosum KIST612]
    MKPIFLCYPKCSTCQKAKRFLEAQGVDYELRDIVEENPTKEELLKWMELYSGEPKKFFNVSGMAYRELGLKDKVKTMSRE
    EMAEILSTNGMLVKRPELIFEDKVLVGFKEEEWAAALGL

    >gi|310830075|ref|YP_003962432.1| hypothetical protein ELI_4535 [Eubacterium limosum KIST612]
    MAKKVNSSEFKSEVLDHKGVVLVDFFATWCGPCKALTPIVDKLSEEMSGKVKIVKVDIDENSALATEYRVMSVPTMKLFK
    NGEVVETLVGLRPESELRDKLNYYSAE

    >gi|310830108|ref|YP_003962465.1| hypothetical protein ELI_4568 [Eubacterium limosum KIST612]
    MANIISVDMTNFEAEVLNYTEGPVMVDFWAEWCGPCKALLPIIEEIAGEVPATAKICKLNVDENTDLARQFHVMSIPTCV
    FLKDGSEVERFVGSRDRQEYIDTLKNL