Alkaliphilus metalliredigens QYMF uid58171

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|150387898|ref|YP_001317947.1| heavy metal transport/detoxification protein [Alkaliphilus metalliredigens QYMF]
    MQKKIFIEGMTCGHCVGHVKRGLEEVTGVNEVKVDLEEKNAVVDLQEIVTEESLKSAIEEAGYKVVKIESI

    >gi|150387900|ref|YP_001317949.1| UBA/THIF-type NAD/FAD binding protein [Alkaliphilus metalliredigens QYMF]
    METRYEKQINFSGIGSEGQQLLQKASVLIIGCGALGTVVANSLVRTGVGHVKIVDRDFVETGNLHRQILFDEEDAAEGMP
    KAEAAKKKLGKMNSTIRIETLVADVNSITISQMISNVDLIIDCTDNFKTRYLINDVAFKENIPWIYGGVIGSSGVLQSFI
    PGETACLRCMMAEPPPTGSLPT
    CDTAGVINTITGIIGSLQANEAIKYVTNQVEKMKKEMLYLDLWDNTVESIEIQTNIDC
    PCCQKRSFIFLENKFPEAVHICGNNSVQVMPFTNKKVNLDQLAIRLQEANIQVKRTPFLLNIKTDAHEITVFPDGRAIIK
    QVSNVNEAKSIYAKYIGY

    >gi|150387979|ref|YP_001318028.1| heavy metal translocating P-type ATPase [Alkaliphilus metalliredigens QYMF]
    MSYVSHVIKKELILEGMDCAGCTSKIEVAIAKLVGVKEVSLNFVTKTLTIEIDDESKMESVVSAAKDIVNQFEPHVIVKE
    KMIDKVSKKALVLKGLS
    CVSCATKIEDKVKELKGVHSVYMDFTSEKLVIEAKTHDWHRITKEVTAIVKHIESDVEVIDES
    RKKDEQGHSHGGGDNKMELIRLGIGAILYAIALAFQMSDSIEFVLYFISYLLIGGEVLLKAGRNIRRGQIFDENFLMSIA
    TIGAFAIGEFPEGVAVMLFYQIGEFFQGLAVNRSRKSIGALMDIRPDYANLKVGNDVKKVSPEEVTVGDHILVKPGEKVP
    LDGVVIEGQSMVDTSALTGESVPREVEVDSNVLGGFINKNGVLTIKVSKEFGESTVSKILELVENASSKKAPTENFITKF
    ARYYTPVVVFVALALAIIPPLVIDGATFSEWIYRALVFLVISCPCALVISIPLGFFGGIGGASKNGILIKGGNYLEALNS
    VDIVVFDKTGTLTKGVFKVMEINVEQNISKEELLEYAAYAESYSNHPISTSILKAYGKEVNKEEIESYNEISGHGIKIKV
    KDKEILAGNIKLMDSEKIAYEPVEAIGTIVYVAINGKLAGSIIISDEIKEDSQRAIKELKAIGVKKIVMLTGDNKQVGIK
    VAKQLGIDEVHTELLPDEKVEKLEQLDRQKSPKGKLVFVGDGINDAPVLARADIGVAMGGLGSDAAIEAADVVLMTDEPM
    KLVSAIKIAKRTKRIVWQNIIFAFGVKGIVLLLGAGGLATMWEAVFADVGVALIAVFNAMRVLNVKNL

    >gi|150388801|ref|YP_001318850.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Alkaliphilus metalliredigens QYMF]
    MLQYDIVVIGGGPAGLAAAIEARKNGVKKILIIERDRELGGILQQCIHNGFGLHIFKEELTGPEYAERFIKELITMDIEY
    KLDTMVLEVSDSKVITAMNATDGILHIQAKAIILAMGCRERTRGAIRIPGTRPAGVMAAGTAQRFVNIEGDMIGKRIVIL
    GSGDIGLIMARRLTLEGADVLAVAELMSYSGGLTRNIVQCLEDFNIPLYLNHTVVNIEGHDRVEAVTIAQVDEKYKPIKG
    TEKRFECDTLLLSVGLIPENELSKSAGIALDNVTGGPIVNESMETSVEGIFACGNVVHVHDLVDWVTEESRRAGSSAAKY
    IKGQIQSNCKTIKLKGINGVRYVVPHQIRLDNIEQTVELMMRVDNIYKDIKFVIKSNGEVIKEVKRKHVAPGEMETIKLD
    LSKFTPGDCDEMYIEIVEKEA

    >gi|150388916|ref|YP_001318965.1| heavy metal translocating P-type ATPase [Alkaliphilus metalliredigens QYMF]
    MTQSSNIEKVVWKIQDMSCSSCSLSIEKKLKATEGVLNASVNFAAEKANAAFDKETTNIEELTKIIEDLGYGAIVETDEK
    ETEKVTLKVSGMT
    CTACSSAIEKGLNKMEGIRSASVNFAVEKVTVEYEPTKVRMLDVKKKVSELGYELILEADHEDDGVD
    EDEVKILKTRKTMMISIGLSSLIMTLMVIHMFVRHIPGYVPIVALLGLPIVFGTGWHVHVGSWKALKNKSPNMDVLVTLG
    SLPPYLIGLMALFFPLQSFIEMATTIMTFHLIGKYLEVRAKGRASQAIKKLLEMGAKTAKIIVDGEEIEVPVKDLQVGDI
    MVIRPGEKVPTDGVVFDGNGLLDESMATGESMPVKRQKGDEVIGATINKQGLLKVKVTKVGKDTFLSQVVKMMEECQGSK
    VPIQEFADRITGYFVPAIIVITIGTFISFNVFPEFHLGIVRWGATFLPWVNPDLTPLTLSFITATAVLVISCPCALGLGT
    PTALMVGSGMGAERGILIRNGEAIQTFKDVKAIAFDKTGTITKGKPEVTDIVLVKGVQEKDFLYYAATIEIGSEHPLAHA
    IVEKAKNDKIKLGEVIDFNAIVGMGVVGNIDGERILVGNRKLMKDNEIPYEDYEEELIRLEEEAKTAMLLAKGNQFLGIV
    AVADPIKEDSARAIAELESMGIKTAMITGDNRRTAAAIGKKVGISHVISEVMPDGKVEEVKKLQEQYGVVAMVGDGINDA
    PALKQSNVGIAIGTGTDIAIEAADVTLVRGELSGIVSVIKLSKAIFRKIKENYFWAWFYNAVFIPVAMFGLLHPMIGAAA
    MAVSSLNVVYNSLRLKKVDIEPSYQKA

    >gi|150389003|ref|YP_001319052.1| glutaredoxin [Alkaliphilus metalliredigens QYMF]
    MAKEIIVYTSNTCPHCHTAKEFLSEKGVEFTEKNVQEDPSARKELMKHKIMAVPVIQIDGEMIVGFDPDKIEGML

    >gi|150389049|ref|YP_001319098.1| redox-active disulfide protein 2 [Alkaliphilus metalliredigens QYMF]
    MMEIKILGSGCKNCTTLTKVVEEVLGELNMEATVEKVTDFQDILGYGVMKTPGLVVNGTVKFAGRIPSKDEVKKVLEG

    >gi|150389070|ref|YP_001319119.1| dihydrolipoamide dehydrogenase [Alkaliphilus metalliredigens QYMF]
    MTYDVLVLGGGPGGYVAAIKAAHLGGKVALVENGYFGGVCLNWGCIPTKALLKNARVYQDVLMGDFYGIEGIDKSQLSIN
    WPAMLKRKDRIVRQLVGGVKGLLKKNKVDVFDGFGTLIDANHIEVKGQQLEGKKLIIATGTSPMIPDIPGLEASMKAGNI
    LTSKELLSIEALPKSVVILGGGVIAIEFATLLNALDVEVTVIQRSDRILKGVEEEMALTLSKDLIKRKVKIVTNSSVEKI
    EGTRVFTKINGEEEIFEGDKILLSLGTSPNVKGLEALSLDMDKKGIITNDKMETSITGVYAIGDVNGKYQLAHVASAEGI
    VAAENAMGGNEELNYNIVPSCIYSFPEIASVGLTEEEARQKDYDVVVSKFPLAANGKAMAEGENIGFVKIIADKKYGEIL
    GTHIMAVHATDMISEAIVSMQLEGTAYDVAKAIHPHPTMSEIVMEAAHGIMDQPIHF

    >gi|150389301|ref|YP_001319350.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF]
    MKAIEVGNHAPNFMVKDINDQNLSLADYQGKKVLLSWHPLAWTPVCTDQMRALENNWQTFQKLNTVPLGFSVDPPPCKKA
    WATAILMNNVSLPSDFWPHGKVAQAYGLFNEAQGVSERANIIVDENGIIKWVKVYPSQQLPDINEVIQVLSNMQM

    >gi|150389436|ref|YP_001319485.1| pyridoxal-5'-phosphate-dependent protein, beta subunit [Alkaliphilus metalliredigens QYMF]
    MLYNNIIELIGNTPILRIAPEVHKLKNIDIYAKLEFYNPFGSVKDRVAYGMIKDDIKNIKENNQTIIESSSGNTAKALQV
    LAAINGIEFKTVTNRIKIPEVKSILQMLGAEIEELPGLSECPDPTDPNDPVIYIEKIMSQEANQYFHTAQYVNMKNRDTH
    YDTTGKEIYKDVGSVDYFFGTLGTTGSSRGIIEYLYEKNENMKKVGIVADKGDTIPGIRNIDEMYEVGIYEKKLYDHIIT
    VDSIEAIDGMLKLIKQCGVLGGPTSGGAFWGTLKYLQEIDEGLSEKKKAVFVVCDRVEWYVSYIQKRRPDLFDATIKKET
    IRNLSQEELSNATTIKIQEALEWVEKNNSLIIDLRGGLAFKTSHIPNSINIVDDYFEALLDSGMPFANNMTVLLV
    CPVGE
    KSKKFVALMKKRGFEAYSLEGGMVAWRDAGYPMERSRQKKKG

    >gi|150389795|ref|YP_001319844.1| dihydrolipoamide dehydrogenase [Alkaliphilus metalliredigens QYMF]
    MKVAVIGGGPGGYVAAIKAAMLGAEVTLIEKKRVGGTCLNVGCIPTKSLLASSDVLEVVRDAKNYGINIDGTIEPDLPAI
    MKRKEKIVEQLVKGIEFLFDKKGVKLINGFGKLVDKNKIEVTKEDGSKEEIEADKIILATGSVPIVPPIFPHDGKKIITS
    DEALFLEEIPKSMSIVGGGVIGCEFGQFFSKMGTKVTIVEMAEQLLPFEDKDVAKQLERSFKRDKIKMLTGQKINKCEVQ
    DNKVIAYLEGDKTLEADIMLVSVGRKPYLENLGLEDLGIEMEKGKVVVNKNMETNIKGIYAIGDIVDTPFLAHVASKEGL
    IAAENALGKDKAISYRAVPRCIYTGPEVAAVGMTEKEAEAKGMIYHVGKFEFRGLGKAQAIGHFQGFVKVLVDDQDVIIG
    AAIVGPHATDLLAELSLAVELQLTAERVGDIIHPHPTLSEGIMEALHDVHKACIHAV

    >gi|150389849|ref|YP_001319898.1| hypothetical protein Amet_2079 [Alkaliphilus metalliredigens QYMF]
    MTKTKEIIKTGWNLDSTYAHLPKQFFTIITPNPVSAPKLVILNEPLATVLGLDSEALQSKDSLEVLAGNRALEGALPLAQ
    AYAGHQFGHFALLGDGRALLLGEQITPSGERFDLQLKGSGPTPYSRGGDGRASLGPMLREYIISEAMHALGIATTRSLAV
    VTTGEAVIRETDLPGAILTRVAASHLRVGTFEYIAKWGTVQELRALADYTLQRHFPEVGAVENPYLSLVQEVIKGQAALI
    AKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDSYDPKTVFSSIDRQGRYAYGNQPHIAGWNLARFAETLLPLLHEDQD
    EAVKLAQDEISRFIQLYHSHWLTGMRAKLGIFNEEVQDESLIEELLKMMEKNHADYTNTFRALSFETLEGTALFGTTEFA
    QWHELWRARLNRQQESKDASQQLMQNSNPGVIPRNHRVEAALDAAVKQGDYSVMEQLLNVLSKPYAHSPEQAEYCMPPAP
    SNRPYRTF
    CGT

    >gi|150390050|ref|YP_001320099.1| electron transport complex, RnfABCDGE type, E subunit [Alkaliphilus metalliredigens QYMF]
    MNVKEIVRRGIISENPIFVQFLGMCPVLAVTNTAENALGMGLATTAVLLGSNTVISAVKNFIPSKIRIPSYIVIIATFVT
    MIGMLMNAYVPALFASLGIFMPLIVVN
    CLILGRAESFASKNNTGKSVVDGVSMGLGFTLSLVILGAVRELLGAGTIFNMA
    IMAESYKPAGIMIQPPGAFLALGLLVAMFKVIGKMVQASKDKKTEIRGA

    >gi|150390051|ref|YP_001320100.1| electron transport complex, RnfABCDGE type, A subunit [Alkaliphilus metalliredigens QYMF]
    MVDFSASSIFVILISAILVNNFVLSRFLGICPFLGVSKQVETSFGMGMAVTFVMALASIMTYLIQHLVLVPLELQYMQTI
    TFILVIASIVQLVEMIIQKVSPTLYQSLGVFLPLITTN
    CAVLGLTILNIQLEYNIIETTFHAIGAAVGFTLVIVLFAAIR
    ERLEVSNVPEAFKGFAIALVTAGLMSMAFLGFSGLV

    >gi|150390052|ref|YP_001320101.1| electron transport complex, RnfABCDGE type, B subunit [Alkaliphilus metalliredigens QYMF]
    MNLSSVIYPIVSLGGLGLVFGAGLAYASQKFAVEVDPKVEEVRNALPSANCGACGYPGCEAFAKAIVEGKAPIEGCPVGG
    ASCAESLGEIMGVEANAGVKKVAKVICNGDTSKCKEDFDYQGVEDCVAATMVAGGSKSCKYGCLGLGTCVRECPFDAIDI
    VDNRIARINPEKCTGCTKCIAVCPKDVIDMVPYEQDVIITCNNKETGKVVRPKCGVACISCKI
    CVKSCPFEAIDFENNLA
    FIDYEKCTNCFVCVEKCPTKAIEGQLEKRKKALIHEDLCIGCTICKKNCPVDAIEGELKENHKIIEDKCIGCGVCEQKCP
    KDAITMIK

    >gi|150390848|ref|YP_001320897.1| glutaredoxin [Alkaliphilus metalliredigens QYMF]
    MKKVIVFTSKTCPHCRTAKEFLLSRGIMFEEKDVNEDPMAGAEFSRRKLQGVPAFLIGDEVVVGLDKQRIEALLDYIVSN
    CEKCNVRMRIPKNKGRIRVTCPHCSSQFIKST

    >gi|150390936|ref|YP_001320985.1| RnfA-Nqr electron transport subunit [Alkaliphilus metalliredigens QYMF]
    MSKKTKRIFQLGILNDNPVFRQILGICSALAVTNLMINSLVMGIGLIFVTALSSFTVSVLRKHTPRHIRMMVQTLIISAY
    VIIVDIVLKAYYPSMSDALGPYVGLIITN
    CIIMGRCESYAQNNPPSLAFLDGIASGLGYTFVLLLIAFFRELLGFGSIFG
    ITVMGAWWPRWIFMIMPPGAFFMLGILIWVMNSLVPSEEKETSVAGGAN

    >gi|150390937|ref|YP_001320986.1| RnfA-Nqr electron transport subunit [Alkaliphilus metalliredigens QYMF]
    MENVNPFVILFASIFTSNMILANFLGMCSFIAVSKEIKTSLGLGQAVTFVLTGTTIINYLVYHHVLVPFGLEYLRFIVFI
    ITIAAFVQLVEMVVERYLPNLYYSLGIFLPLITVN
    CAILGVSLFMVIRDYTFIQSVAFGFGSGLGWLLAILAMSGIRQKI
    KKAPIPKGLEGAGITLFITGLMALAFIGFSGIVQIQ

    >gi|150390983|ref|YP_001321032.1| rhodanese domain-containing protein [Alkaliphilus metalliredigens QYMF]
    MYKWIVVILIVVMSFIFYNNNRKEEGYQKMNPVDARLQLEEDSNILLIDVRTQEEYMQKHIEGSKLIPLNVLESKIKKAV
    PNKEKKIILY
    CQTGSRSAAAANMLLNMGYKNVHDLGGINKWPYETKGSL

    >gi|150391015|ref|YP_001321064.1| methyltransferase type 11 [Alkaliphilus metalliredigens QYMF]
    MDDTNKTDIRNAVRESYGKIADDKINDAGCCSDSIKIKNSAKEISNKIGYSDEEISNVPEDANMGLGCGNPQLIAEIKEG
    EIVIDLGSGGGFDCFLASEKVGPKGSIIGVDMTPEMVSKSRTLSRKHRYMNVDFRLGEIENLPVADNTADVIISNCVINL
    SPKKQRVYNEAYRVLKKGGRFAISDVVLIKELTEEMKQDEKLHCG
    CVTGASSVEELKIYLERAGFSNINIETKEVSKEYA
    EKWAHNLRVGEYIMSASIKATKL

    >gi|150391018|ref|YP_001321067.1| heavy metal transport/detoxification protein [Alkaliphilus metalliredigens QYMF]
    MKKKITIEGMSCGHCVGHVNEALKEISGVNSVEVNLTEKHAVVDLAHEVGNDKLKAAVDGAGYQAIEVVEI

    >gi|150391019|ref|YP_001321068.1| heavy metal translocating P-type ATPase [Alkaliphilus metalliredigens QYMF]
    MTQSNNIEKAVWKIQDMSCSSCALNIEKKLKTTKGVISTNVNFAGEKAQVAFDKENINIEELTKIIEDLGYGAIVETTDK
    ETEKVTLKVSGMT
    CTSCSNTVEKGLNKMDGITSANVNFAAEKVTIEYEPKKIRLIEMQKKVSELGYELNLQEEEDDGIDE
    DEIKIRKTAKTMKISIALSSVIMGLMIIHMFVTPIPGYLPIVALLGLPIIFGTGRHVHVGSWKALKNKSPNMDVLVTLGS
    LPPYLIGLMGLFFPLQSFIEMATTIMTFHLIGKYLEVRAKGRASQAIKKLLQMGAKTAKIIVDGEEIEVPTKDLQVGDIM
    VIRPGEKIPTDGVVVDGNSLVDESMATGESMPVKREKGHEVIGATINKQGLLKVQVTKIGKDTFLSQVVKMMEECQGSKV
    PIQEFADRITGYFVPAIIVITIGTFISFNIFPEFHLGIIRWGATFLPWVNPELTPLTLSFITATAVLVISCPCALGLGTP
    TALMVGSGMGAEKGILIRNGEAIQTFKDVKAIAFDKTGTITKGKPEVTDIVLVKGVEEKDFLYYAGTIENGSEHPLAHAI
    VEKAKNEKIKIGEVIDFNAIVGMGVIGNIDGEQILVGNRKLMKENKISYEAYEQELIRLEEEAKTAMLLAKGNQLLGVVA
    VADPIKEDSAQAIAVLESMGIKTVMITGDNKRTAAAIGKKVGISQVIAEVLPDGKVAEVVRLQEQYGTVAMVGDGINDAP
    ALKQSNVGIAIGTGTDIAIEAADVTLVRGELSGIISSIKLSRAIFRKIKENYFWAWIYNILFIPVAMFGLLHPMIGAAAM
    AVSSLNVVYNSLRLKKVDIEPSFKEA

    >gi|150391031|ref|YP_001321080.1| rhodanese domain-containing protein [Alkaliphilus metalliredigens QYMF]
    MEAFGATVPVNKNYIIDLPEAKEILADQERSKLVDIRSWEEYIGTTSGYSYIEGKGRPAGAAWGHDLNNYRNIDNTMKNA
    AEIKSMWNEWGISPDQRLSFF
    CGTGWRAAEVLIYAEVMGLENISLFDGGWNEWQDDASNPIELGESN

    >gi|150391040|ref|YP_001321089.1| rhodanese domain-containing protein [Alkaliphilus metalliredigens QYMF]
    MKNKSLKLIPILLILSLVLVACGQAQETGTNENPMQYMGVEELKTSIESGSDDYIILDVRKVEDYNTSHIAGAYTSDQDA
    ANKGGDDATGIANLKNTLQEATGSEVGNAEDKYALV
    CYSGKSYAQKATDLMIEMGISKDQIYTVEGGMTAWEEGGDDYKE
    LLE

    >gi|150391122|ref|YP_001321171.1| methionine-R-sulfoxide reductase [Alkaliphilus metalliredigens QYMF]
    MKEKTYYKPSEKELKEKLTDIQYRVTQEGATERPFKNEYWDHQEDGLYVDISSGEPLFTSQDKFDSSCGWPSFTKTVEEE
    RIVEKKDRGHNMIRTEVKSKAGDSHLGHVFPDGPKEAGGLRY
    CINSASLRFIPVSELENEGYGEYVKLFEK

    >gi|150391239|ref|YP_001321288.1| UBA/THIF-type NAD/FAD binding protein [Alkaliphilus metalliredigens QYMF]
    MDFNDQQIERYSRHIILSEVGVEGQQKLLDAKVLVIGTGGLGAPAAMFLAAAGIGTIGLVDADKVDLSNLQRQIIHQTKD
    VGKLKVLSGKETINEMNPDVNVITYETFATASNILDIIKDQDYDFVIDGTDNFSAKFLINDACVLAKKPFSHAGIIRFNG
    QLTTYIPDNDTPCYRCIFKQPPPEGAVPT
    CSQAGVLGVMGGVIGTLQATETIKYILGIGENLAGYLLTYDAITMEFRKVK
    IKHNKKCSVCGEEPTIKELIDYKPPVCGI

    >gi|150391246|ref|YP_001321295.1| OsmC family protein [Alkaliphilus metalliredigens QYMF]
    MALIEVGFPGNKRVDANIKGFTVNTDQPISGGGDGGAPSPFDLFLSSIATCAGIYALIFCENKGIDTTGLKLALDVIRNE
    ENGGMDQIDLKLNLPEGFPQKYEKAIINAMNL
    CTVKKFIANPPEFTTSIQK

    >gi|150391251|ref|YP_001321300.1| methylated-DNA--protein-cysteine methyltransferase [Alkaliphilus metalliredigens QYMF]
    MPVYFYETSIGKIGIAEKNGNITNLYFETDKPPEDIEINETPLLQEAAQQLQSYLTGDSKEFNLPLKPSGTDFMEQVWES
    LCKIPYGKTVSYKEIAVDVDSPKAVRAVGLANNRNPIPIFIP
    CHRVIGSDGSLVGYGGGLELKERLIGLETMKNSCGFFQ
    YGQKEIAYLKKKDKKLGAAIERIGKIERGTIADPFTALISSIVSQQISNKAAETVWNRLDELLESMTPESITKTELSQIQ
    GCGMTNKKAEYIKGIADVALCGKINFKTLHMLSDQEIIQKLSSLHGVGIWTVEMLLIFSLNRPNVVSYGDLAIRRGMMNL
    YGLKELSKEQFNQYRAKYAPYGSVASLYLWVMSED

    >gi|150391282|ref|YP_001321331.1| hypothetical protein Amet_3546 [Alkaliphilus metalliredigens QYMF]
    MNNDKIKVIASGGVIGLLAAILVKFGNPVNMGICVACFFRDIAGGLGLHRAAVVQYLRPEVPGFILGSFAMAKAKGEFKP
    RGGSSPLLRFILGFFLMIGALVFLGCPLRMILRLANGDLNAILGLLGYVAGIWIGIQFLKGGFTLGKSIKQPAVSGYTMP
    VFVVILLIFLVTAPSFIYFSEAGPGSMVAPISIALAAGLIVGAMLQRTRLCTAGGIRDILLIKDFHYFWGLIGIFVFALL
    GNLLFNFETFKIGFEGQPIAHNAHLWNFLGMALAGVCAVFLGG
    CPLRQSILAGEGDIDATVTIFGLMAGAAFAHNFGLAA
    SPAGVGLNGKVAVIVGFIVVIAIGYGVIKSLEKHETTTAIKKGVGANV

    >gi|150391323|ref|YP_001321372.1| selenoprotein B [Alkaliphilus metalliredigens QYMF]
    MSKKRVVHYINQFFAGIGGEEKADIKPEVREGIVGPGMALESALKDEIEIVATIICGDSYFNENVEEAKAEVIKMVKQYK
    PDLFIAGPAFNAGRYGVACGTIAKEVNDQLGIPVLTGMYPENPGADMYKKSVYIIETGNSAATMRKAIPAMAALALKMLK
    GESIGSPEDDKYISRGIRKNYFAEERGAKRAVDMLMKKLNKEDFVTEYPMPDFDRVEPNPAVKDLSTAKIALVTSGGIVP
    KHNPDRIESSSASKYGKYDISQFKDLTEADHETAHGGYDPTYANTDPDRVLPVDVLRDLETEGIIGKLHKYFYTTVGNGT
    SVGSSKLFAAEFAKELVADGVTAVILTST
    CGTCTRCGATMVKEIERAGIPVVHMCTIVPISLTVGANRIVPTIAIPHPLG
    NPALDEKDEKSLRKKLVVKALKALTTEVDGQTVFED

    >gi|150391324|ref|YP_001321373.1| glycine/sarcosine/betaine reductase complex protein A [Alkaliphilus metalliredigens QYMF]
    MSLFDGKKVIIIGDRDGIPGPAMEECLKGTGAEVVYSSTECFVCTAAGAMDLENQKRVMDLTEKHNAENVVVILGAAEAE
    AAGLAAETVTNGDPTFAGPLAGVQLGLRVYHAVEPQFKDAVNAEVYEDQIGMMEMVLEVDAIIEEMSNIRNEFGKFKD

    >gi|150391326|ref|YP_001321375.1| thioredoxin domain-containing protein [Alkaliphilus metalliredigens QYMF]
    MLAVDKETFEQEVLKAEGYVLVDFWSDGCEPCKALMPDVEALEAQYGDKVKFVKLNTTQARRLAIKEKVLGLPTISMYKD
    GVKVEEVTKDAANKENIEAMITKSL

    >gi|150391327|ref|YP_001321376.1| thioredoxin reductase [Alkaliphilus metalliredigens QYMF]
    MENVYDVVIIGGGPAGLSAGLYAARGKMTTLILEKEKTGGQIATTEEVANYPGSITDATGPALVARMVEQCNEFGAKIEK
    DTIKEVKLEGKIKILVGEKNTYHAKSIIVAPGASPRLLGVPGEKELTGKGVSY
    CATCDGDFFTDFEVFVIGGGDSAVEEA
    MFITKFARKVTIVHRREELRAAKSIQEKAFKHPKIDFIWNTTIKEIKGDGLVESVVFENLKTGEITEHHADEEDGTFGIF
    MFVGYIPQTDLFKGMLDMDRTGYIVTDDNMKTNVPGVFGAGDCRVKSLRQVVTAVSDGAIAAVQAEKYIENNFEE

    >gi|150391410|ref|YP_001321459.1| putative selenoprotein [Alkaliphilus metalliredigens QYMF]
    MKKLSIEYCTGCGYLPKALGLAEELLSKYKNDLPSLTLLPSSGGVFEVKVGEQLIFSKKEVGRFPEFNEIDDQL

    >gi|150391417|ref|YP_001321466.1| alkylhydroperoxidase [Alkaliphilus metalliredigens QYMF]
    MARIKPVSLENATEEAKEIFENFLEQRGNVPNMFRTLAHRPKILETAYEHFSTILQTGTVDIKLKEMVAVRVSQLNDCGY
    CLSSHTALAKRFGVSEEAMAQMEAGLKDPSKFTEREFVALEFAQVMTLDSNAVKDDLWNRLREHFDEGQVIEIACVIGCF
    NYFNRFNNALKVDITA

    >gi|150391427|ref|YP_001321476.1| methionine sulfoxide reductase A [Alkaliphilus metalliredigens QYMF]
    MKEIVLAGGCFWGVEAYMERIDGVVETKVGYANGHVENPSYEEVCSSQTGHAEVCYIKFDETKISLEILLNGFWKIIDPT
    VENRQGPDIGSQYRTGIYYGHEEDLDTIIKSKEMQQKKYDANIVTEIEPLKAFYDAEEYHQKYLKKNPGGYCHINLEI

    >gi|150391465|ref|YP_001321514.1| redoxin domain-containing protein [Alkaliphilus metalliredigens QYMF]
    MGINRVDIRNNDGDLRGDKYMDKRKDVVTMGGNPVTLIGNEIKVGVQGPDFTVLTNDMEPFSLQDAGKKVKIISVVPSLD
    TGV
    CEFQTTHFNEKASELGDVAILTVSVDLPFAQKRFCGAKGIDQVVTLSDHKDLSFGLNYGFVIEELRLLSRGIVILDK
    NNIVQYVEYVKEVKEHPNYERALEEAKKLV

    >gi|150391507|ref|YP_001321556.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF]
    MASIEVNIEAPDFEIEDFKGDKFKLSNFRGKSNILIVLNRGFVCPFCRKHMMQLHQNYDKFAEKDTVIVAIGPENANKFK
    TYWEENNLKFYGIPDEKHSVLKLYGQKVNLFKLGRMPAQMLVDKAGVLRYVHYGHSMKDIPETSEIVKLLDTL

    >gi|150391791|ref|YP_001321840.1| NADH dehydrogenase (quinone) [Alkaliphilus metalliredigens QYMF]
    MDLFRSHVLVCGGTGCASSDSFKMIDEFDEAFKKYGLEKEVKLVKTGCFGLCEAGPIVIVYPEGAFYSHVKLSDIDRITE
    EHLLKGRIVTDLLYKESYVGDQIKAIDEVGFYKKQTRIALRNCGVINPEVIEEYIAYDGYKALGKVLTEMQPEEVVDIMK
    RSGLRGRGGGGFPAGLKWEFTAKAEGDEKYVACNADEGDPGAFMDRSVLEGDPHVVIEAMAIAAYAAGANRGYVYIRAEY
    PIAVERLEIAIGQARENGLLGKDIFGTGFDFELEIRLGAGAFVCGEETALINSIEGKRGMPRPRPPFPAQKGIWNKPTLL
    NNVETYANVPRIILNGAEWFASIGTEKSKGTKVFALGGKINNTGLVEIAMGTTLKEVIYDIGGGIPDGKAFKAVQTGGPS
    GGCITAEHLDTPIDYDNLIELGSMMGSGGMIVMDEDNCMVDIARFFLDFTVEESCGKCTPCREGTKRMLELLDIISEGKG
    TVADLDKLESLAKTIKSSSL
    CGLGQTAPNPVLSTLKYFRDEYDAHVHDKSCPAGVCKALAKYLVVSELCKKCGICAKKCP
    VDCISGVKGKEVYLIDQEKCIKCGACLEACPFKAIVKK

    >gi|150391799|ref|YP_001321848.1| NADH dehydrogenase (quinone) [Alkaliphilus metalliredigens QYMF]
    MDVCRAHVLVCGGTGCASSDSFKMIDKFEEELKKVELEKEIKVVKTGCFGLCEAGPIVIVYPGGVFYSQVKLEDVERITK
    EHLLKGRIVTDLVYKESIEENLIKGIDEVGFYKKQKRVALRNCGIINPEVIEEYIAFDGYKALGKVLTEMKPEEVIDIIK
    RSGLRGRGGGGFPSGLKWEFTAKAEGDEKYVACNADEGDPGAFMDRSVLEGDPHVIIEAMAIAAYAAGANRGYVYIRAEY
    PIAVERLEIAIKQARENGLLGKNIFGTEFDFELEIRLGAGAFVCGEETALINSIEGKRGMPRPRPPFPAHKGIWNKPTLL
    NNVETYANVPQIILNGAEWFASMGTEKSKGTKVFALGGKINNTGLLEVAMGTTLREVIYDVGGGIPNGKAFKAVQTGGPS
    GGCITAEHLDTPIDYDNLIALGSMMGSGGMIVMDEDNCMVDIARFFLDFTVEESCGKCPPCRIGTKRMLELLDKITEGKG
    ELEDLDKLERLAESIKVASL
    CGLGQTAPNPVLSTLKYFRDEYEAHVKEKSCPAGVCQALTNYVITDDCKGCTLCVKACPV
    DAIHGERKAVHLINTDTCIKCGACVDKCPFKAIVKK

    >gi|150391926|ref|YP_001321975.1| thiamine biosynthesis protein ThiF [Alkaliphilus metalliredigens QYMF]
    MKLIVNEDEMDVKKGTTAFEVRNKVKKDADVVVYNGFIIKEDVLLQEGDLITLIQRGEIPIIEELEVLLTSRHTPGVHKK
    IKKASIGIAGLGGLGSNIAVSLARMGIGKLLLVDFDVVEPSNLNRQQYFIRHIGMLKTEALQQLIHEINPFVEVEVINIY
    LDQTNIEDCFKNMDVIVEAFDNPTSKSTLVNTVLEKMKEKPMVAASGMAGYFSNNSIKTKRITKKFYLIGDGVSAAKPG
    C
    GLMAPRVAIAANHQANTVVRILLGEEEV

    >gi|150392010|ref|YP_001322059.1| glutaredoxin [Alkaliphilus metalliredigens QYMF]
    MNKNVIIYTSNTCGYCHTAKEYFQEKGIDYEERNVSEDAAARKELMKKGFMGVPVIMIGEESIVGFDQDKIESLLK

    >gi|150392012|ref|YP_001322061.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF]
    MAERMVGLKAPYFEMKTVDGEGMEFGKVSLDDYKGQWLVLFFYPLDFTFVCPTEITGINERLVDFGRLNASVLGASTDSE
    HSHKAWINAAQDQGGLGKLSFPLASDMTQKVARDYGILIEEEGIALRGLFIIDPEGILRYSVVHDLNVGRSVEETLRVLQ
    GLQSGGLCPFNWSPGEDML

    >gi|150392014|ref|YP_001322063.1| glutaredoxin 3 [Alkaliphilus metalliredigens QYMF]
    MKKVVLYTKDFCPFCHRALDLLKSKEVEFTNVDVTHDLETFKTVIKRTGSDTVPQIFIDDEFIGGCDDLIALDQEDTLDS
    KLGL

    >gi|150392296|ref|YP_001322345.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alkaliphilus metalliredigens QYMF]
    MLRIGQPAPEFTVPSTQGELSLRDYRGKWVVLFFYPLDFTPVCSTEIPELNRNLPAFQRLNSIVLGANTDSVPTHEAWAK
    SIDGVSFPLLSDYDKKLSEKYEVLVKEAGGIALRGLFIIDPQGDLQYISVNNLAVGRNVGEILRVLAACQAGGACPINWE
    EGQETLS

    >gi|150392387|ref|YP_001322436.1| protein of unknown function DUF395, YeeE/YedE [Alkaliphilus metalliredigens QYMF]
    MRVYDKVVKDPWPYWIGGILLALLNICLLIVTGSTWRVSGGFLYWGAWGLEKIGFTPANWYYFSVYQNGVEEGQTFLNNP
    NTVLNIAVIVGALIAALWASEFKWKKIKNVKQLCFALIGGIVMGYGTILSFG
    CNISAYFSAIPSFSLHGWVFAAFMFVGS
    WIGSKVLIRYIL

    >gi|150392389|ref|YP_001322438.1| protein of unknown function DUF395, YeeE/YedE [Alkaliphilus metalliredigens QYMF]
    MSSSKIEELKKQRTKQLRKRKNQLPYARVVTVVALLVYIVLINYNLKFSSFWIIGILMGVTMQRARFCFTAGFRDPIMVG
    STSLLKAVLLAFMVSTIGFFIIQYHAVLMNPDYLLIDIPGQLKPVGVHTAFGGILFGGGMVIAGG
    CASGTLMRIGEGYML
    QLVVLMGFIVGALIGSWHFPFWDRLLISQAPVIYFPSYFGFFPSLIIQLVSLGSLYFIADWYDKKNNIMKMM