Eubacterium eligens ATCC 27750 uid59171

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|238916584|ref|YP_002930101.1| thioredoxin 1 [Eubacterium eligens ATCC 27750]
    MAARANAENFEELVLKSELPVLVDFYSDSCIPCKMMAGVVGDIEDDYEGKLNVYKVNVNFDESLASKYEVLAAPTFVAFN
    KGAETGRIAGKTTKDALLGLFEGLV

    >gi|238916586|ref|YP_002930103.1| thiamine biosynthesis protein ThiF [Eubacterium eligens ATCC 27750]
    MAFTNEQLERYSRHIILKEVGAKGQKKLLNASVLIIGAGGLGAPAAMYLAAAGVGTIGIVDADEVDLSNLQRQIIHSTAD
    IGKAKVKSAKETMEAINPDVTVKTYREFVTSENVMELIKDYDFIIDGTDNFPAKFLINDACVMAGKPFSHAGIIRFKGQL
    MTYVPGEGPCYRCVFKNPPPKDAVPT
    CKQAGVIGAMGGVIGSLQAMEAIKYIIGKGDLLTGRLLTYDALKMEFHTIKLPK
    DHHCAICGDNPTIHELIDYEQAECDMHM

    >gi|238916868|ref|YP_002930385.1| electron transport complex protein RnfE [Eubacterium eligens ATCC 27750]
    MWQETREVRTLNKCIERLYNGIIKENPTLVLTLGMCPTLAVTTSAINGIGMGLSSTVVLALSNLMISLLRKAIPDGVRMP
    AFIVVVASFVTMVQFLMQGFLPSLYDSLGIYIPLIVVN
    CIILGRAEAYASKNPPIPSFFDGIGMGLGFTIAITILGAIRE
    LIGGGTIFSDGTNALFDLSTIGYTPASIFILAPGAFFVLAFMIAIMNRIKRKKGMKPAEVPDYTEEIEEAKAEAKNN

    >gi|238916869|ref|YP_002930386.1| electron transport complex protein RnfA [Eubacterium eligens ATCC 27750]
    MGYFSQLLLIAVSTAIVNNVVLSQFLGLCPFLGVSKKINTAAGMGGAVIGVITISSAVCSLIYDCILTPLKLTYLNTIVF
    ILVIAALVQFVEMFLKKTSPSLYEALGVYLPLITTN
    CAVLGIALTNVQNYNTAAGLNIGQKLLDSVVSGLGTAVGFTIAI
    IIMAGIRERNEFNDVPESFKGMPIVLLTAGLMAIAFFGFSGII

    >gi|238917357|ref|YP_002930874.1| hypothetical protein EUBELI_01434 [Eubacterium eligens ATCC 27750]
    MKKTYKIDVDCANCANKMEDAAKNTAGVKDATVNFMALKMIVEFEEGQDPKAVMQDVLKNCKKVEDDCEIYL

    >gi|238917387|ref|YP_002930904.1| Cu2+-exporting ATPase [Eubacterium eligens ATCC 27750]
    MEQYNVTGMSCAACQARVEKAVSKVPGVESCSVSLLTNSMGVEGTAPTDVIIKAVEAAGYGASVKGAKNSSPSMQEQEDA
    LADKTTPVLKKRLTASVIFLIVLMYFSMGHMMWGWPLPSVLEGNHVAMGLIQMLLTIIIMVINQHFFISGFKGLLHRSPN
    MDTLVALGSGAAFVWSTYALFAMTDCQVRGDMAGVMHYMDEFYFESAAMILTLITVGKMLEARSKGKTTDALKSLMKLAA
    KTAVLYADGQETCVPVEQVMTGDIFIVRPGENIPVDGVIIEGNTAVNESALTGESIPVDKQEGDQVSAATLNTSGYIKCR
    ATRVGEDTTLSKIIQMVSDAAATKAPIAKIADKVSGVFVPAVITIAVITTIVWLLCGKDLGFALARGISVLVISCPCALG
    LATPVAIMVGNGVGAKNGIMFKTAISLEQTGKMQIVALDKTGTITEGEPKVTDIITGDGILQNELLTIAYGLERKSEHPL
    AKAVVNYVEESGDKNSFAEEVTGFKVVAGNGLKGMLDTNVVAGGNLKFISEYCNVSDDLRNKADDLSSEGKTPLFFARDN
    ELMGIIAVADTIKKDSPHAIKELQNMGIRVVMITGDNERSAKAIGKLAGVDEVIAGVLPEGKEKEIARLKEQGSVIMVGD
    GINDAPALTRADIGIAIGAGTDVAIDAADIVLMKSRLSDVPAAIRLSKRTLTNIHENLFWAFFYNCIGIPLAAGVWIPVF
    GWTLNPMFGAAAMSLSSFCVVTNALRLNLIKIYDTGKDHIYKKKSRKNKNKTTKGDMAMTKTMNIEGMMCGHCEAAVKKA
    LEAVDGVTEAVVSHENGTAVVTLSKEVDNDVLKKAVEDKDYKVTAVK

    >gi|238917573|ref|YP_002931090.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Eubacterium eligens ATCC 27750]
    MTTREEALEYGLSFPDTYQEAPFHDQNWQLVRVKGCKKAFLWTYERDGYINLNVKVSPEWRDLWRSTYSSVIAGWHQNKE
    HWNTIILDGTVPDEDIRRMIAESYDLVSYSPTKRIYEAVKKIPRGQVATYGQIAELAGDRKMARAVGNALHKNPDPLHIP
    CYRVVNSKGELAGEFAFGGAGKQAALLMADGIEVVNGRVDLKKYGMKF

    >gi|238917758|ref|YP_002931275.1| hypothetical protein EUBELI_01839 [Eubacterium eligens ATCC 27750]
    MMKTIIDYQNDEREKVLLDVRDKQEFEKETYPGARNWYWEELIKVLEETPEEFTQQFDKSVPIYLLCYTGLHSDDLADIL
    EEMGYEVYSLYGGWGAYMKWKFENYVKKAQAENELSGEERVKEIERSIVKKFRKPIWRKFTQALNEYDLIQDGDKIAVCI
    SGGKDSMLMAKLFQELKRHGKNNFELVFLVMNPGYNNINYQVILNNAKILDIPITVFKSEIFDTVADIEESPCYLCARMR
    RGYLYSKAKELGCNKIALGHHYDDVIETILMGMLYGAQIQTMMPKLHSTNFEGMELIRPLYLIREADIIHWRDYNNLAFI
    QCACRLTESCASCGGTEKGSKRGEIKQLIKDLTKVSPYIEKNIFRSVENVNLDTVIAYKQYGVKHNFLERYEEMGRLNGA
    SGSQTADNKEME

    >gi|238921796|ref|YP_002935310.1| peroxiredoxin (alkyl hydroperoxide reductase subunit C) [Eubacterium eligens ATCC 27750]
    MLEVGKKAPDFELPDQNGEMHKLSDYAGKKVILYFYPKDNTPGCTKQACGFSERYPQFTEKGAVILGVSKDSVASHKRFE
    EKYGLAFTLLADPDRKVIEAYDVWKEKKNYGKVSMGVVRTTYLIDEQGIIIKANDKVKAADDPENMLKELA

    >gi|238921823|ref|YP_002935337.1| thioredoxin 1 [Eubacterium eligens ATCC 27750]
    MEIKHVKASEFNNEVLKADKPVLVDFWADWCGPCKMLGPVLEQVAAKVDDVQIVKINVDEESSVAEKYNIMSIPTLLLFK
    SGECVAKSVGFISEGQVMEFIGK

    >gi|238922123|ref|YP_002935637.1| thioredoxin reductase (NADPH) [Eubacterium eligens ATCC 27750]
    MYDLMIIGSGPAGISAALTAKARNLNFIWFGSRALSTKIEKAEKIMNYPGLPAVTGSEMQSVFLKQIDDCGITITESQVN
    SIYDCGGYFAAGADNEIYEAKAVIMTVGMTTTREIEGEARLLGCGVSY
    CATCDGALYKNKDIAVICASPKFEDEVTFLAG
    LANHIYLFTPYKETTLQYDNITHFNGLPASVDGDKKVASVTFKGEAIPVSGAFFLKDSINPGVLLSGLDMAGGHIIVDRT
    QMTNIDGVYAAGDCTGRPYQYAKAVGEGNVAVHSVLEYLKEHKDN

    >gi|238922406|ref|YP_002935920.1| hypothetical protein EUBELI_20642 [Eubacterium eligens ATCC 27750]
    MEETIVNIQIFGTKKCNDTKKAERFFKERGIKYQFIDMKEKGMSKGEFNSVAQVNGGLQGMINWDGKDKDLLALIKYTAD
    EDKLEKVMENPSVIKTPVVRNGKASTLGYQPDVWKNWS