Escherichia coli APEC O1 uid58623

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|117622403|ref|YP_851316.1| dihydrolipoamide dehydrogenase [Escherichia coli APEC O1]
    MMSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEP
    KTDIDKIRTWKEKVINQLTGGLAGMAKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHED
    PRIWDSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLDAGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
    IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|117622443|ref|YP_851356.1| iron-sulfur cluster insertion protein ErpA [Escherichia coli APEC O1]
    MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI

    >gi|117622581|ref|YP_851494.1| pyridine nucleotide-disulfide oxidoreductase [Escherichia coli APEC O1]
    MNAFRQEIIMNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCINIGCIPTKTLVHDAQQHTDFVRAIQRK
    NEVVNFLRNKNFHNLADMPNIDVIDGQAEFINNHSLRVHRPGRNLEIHGEKIFINTGAQAVVPPIPGITTTPGVYDSTGL
    LNLKELPGHLGILGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHVERISHHENQ
    VQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLHTTADNIWAMGDVTGGLQFTYISLDDYRIVR
    DELLGEGRRSTDDRKNVPYSVFMTPPLSRVGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILG
    ASLLCVDSHEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK

    >gi|117622744|ref|YP_851657.1| copper exporting ATPase [Escherichia coli APEC O1]
    MSQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTGTASAEQLIETIKQAGYDASVSHPKAKPLAESSIPS
    EALTAVSEALPAATADDDDSQQLLLSGMS
    CASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYG
    AEAIEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVIGLITLAVMVFAGGHFYRS
    AWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEARHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDL
    TPPTARLVTDEGEKNVPLADVQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGDSVHAGTVVQDGSVL
    FRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALISAAIWYFFGPAPQIVYTLVIATTVLIIACP
    CALGLATPMSIISGVGRAAEFGVLVRDADALQRASTLDTVVFDKTGTLTEGKPQVVAVKTFADVDEAQALRLAAALEQGS
    SHPLARAILDKAGDMQLPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNEQQVDTKAIEAEITAQASQGATPVLLAVDGK
    AVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIAGVLPDGKAEAIKRLQSEGRQVAMVGD
    GINDAPALAQADVGIAMGGGSDVAIETAAITLMRHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFT
    GTLLNPVVAGAAMALSSITVVSNANRLLRFKPKE

    >gi|117622755|ref|YP_851668.1| thioredoxin domain-containing protein [Escherichia coli APEC O1]
    MSKKISTTESDSMSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPILESLAAQYNGQFILAKLDCDAEQM
    IAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNG
    EIGLLLAETLIALNRSEDAEAVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQLALQLHQ
    VGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYALLY

    >gi|117622826|ref|YP_851739.1| disulfide isomerase/thiol-disulfide oxidase [Escherichia coli APEC O1]
    MTVIGYAFYSTFALTEKDKLMLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYL
    TPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPF
    CPYCKQFWQQARPWV
    DSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLSVPANVSTEQMKVLSDNEKLMDDLGANVTPAI
    YYMSKENTLQQAVGLPDQKTLNIIMGNK

    >gi|117622827|ref|YP_851740.1| alkyl hydroperoxide reductase subunit C [Escherichia coli APEC O1]
    MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVAS
    HPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|117622828|ref|YP_851741.1| alkyl hydroperoxide reductase subunit F [Escherichia coli APEC O1]
    MMMFKAQEINMLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPVRKPSFLITNP
    GSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFEFETYYSLS
    CHNCPDVVQALNLMSVLNPRIK
    HTAIDGGTFQNEITDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
    SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASG
    AVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEM
    KADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
    IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA

    >gi|117623005|ref|YP_851918.1| molybdopterin biosynthesis protein MoeB [Escherichia coli APEC O1]
    MAELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLVVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDA
    TVGQPKVESARDALTRINPHIAITPVNALLDDAELAAMIAKHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQ
    ITVFTYQDGEPCYHCLSRLFGENALT
    CVEAGVMAPLIGVIGSLQAMEAIKLLAGYGKPASGKIVMYDAMTCQFREMKLMR
    NPGCEVCGQ

    >gi|117623029|ref|YP_851942.1| glutaredoxin 1 [Escherichia coli APEC O1]
    MRREIMQTVIFGRPGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDF
    AAWAKENLDA

    >gi|117623072|ref|YP_851985.1| thioredoxin reductase [Escherichia coli APEC O1]
    MLPIAQIVNKIVILFFYVCKFPTILPLSANNYGDLMGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLT
    TTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLTGDSGEYTCDALIIATGASARYLGLPSE
    EAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTN
    RTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAA
    GDVMDHIYRQAITSAGTGCMAALDAERYLDGLADAK

    >gi|117623242|ref|YP_852155.1| hypothetical protein APECO1_138 [Escherichia coli APEC O1]
    MPVLHNRISNDALKAKMLAESEPRTTISFYKYFHIADPKVTRDALYQLFTALNVFGRVYLAHEGINAQISVPASNVETFR
    AQLYAFDPALEGLRLNIALDDDGKSFWVLRMKVRDRIVADGIDDPHFDASNVGEYLQAAEVNAMLDDPDALFIDMRNHYE
    YEVGHFENALEIPADTFREQLPKAVEMMQAHKDKKIVMY
    CTGGIRCEKASAWMKHNGFNKVWHIEGGVIEYARKAREQGL
    PVRFIGKNFVFDERMGERISDEIIAHCHQCGAPCDSHTNCKNDGCHLLFIQCPVCAEKYKGCCSEICCEESALPPDEQRR
    RRAGRENGNKIFNKSRGRLNTTLGIPDPTE

    >gi|117623250|ref|YP_852163.1| glutaredoxin 2 [Escherichia coli APEC O1]
    MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPILQKDDSRYMPESMDIVHYVDKLDGKPLLTG
    KRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVK
    PNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQINLLSSMAI

    >gi|117623399|ref|YP_852312.1| disulfide bond formation protein B [Escherichia coli APEC O1]
    MIMLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWL
    YSAFRGVQLTYEHTMLQLYPSPFAT
    CDFMARFPEWLPLDKWVPQVFVASGDCAERQWEFLGLEMPQWLLGIFIAYLIVAV
    LVVISQPFKAKKRDLFGR

    >gi|117623437|ref|YP_852350.1| hypothetical protein APECO1_336 [Escherichia coli APEC O1]
    MQKIVIVANGAPYGSESLFNSLRLAIALREQENNLDLRLFLMSDAVTAGLRGQKPGEGYNIQQMLEILTAQNVPVKLCKI
    CTDGRGISTLPLIDGVEIGTLVELAQWTLSADKVLTF

    >gi|117623561|ref|YP_852474.1| thiosulfate:cyanide sulfurtransferase (rhodanese) [Escherichia coli APEC O1]
    MFKKGLLALTLVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKNDTVKVYCNAGRQSGQAKEIL
    SEMGYTHVENAGGLKDIAMPKVKG

    >gi|117623577|ref|YP_852490.1| thiol peroxidase [Escherichia coli APEC O1]
    MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVV
    LCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYE
    AALAVLKA

    >gi|117623588|ref|YP_852501.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Escherichia coli APEC O1]
    MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEGYERISATNPGGLSDKLREYFAGNLSIIDTL
    PTATGGTPFQREVWKTLRTIPCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVP
    CHRVIGRNGTMTGYAGGVQRKE
    WLLRHEGYLLL

    >gi|117623718|ref|YP_852631.1| osmotically inducible protein OsmC [Escherichia coli APEC O1]
    MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDT
    TADVSLDRVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAG
    CPVSQVLKAEITLDYQLKS

    >gi|117623813|ref|YP_852726.1| Na(+)-translocating NADH-quinone reductase subunit E [Escherichia coli APEC O1]
    MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTMAFILV
    IAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTN
    CAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAV
    ADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL

    >gi|117623818|ref|YP_852731.1| SoxR-reducing system protein RsxE [Escherichia coli APEC O1]
    MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLRHWTPAEIRIPIYVMIIASVV
    SAVQMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAFAAKKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDG
    ADALLGSWAKVLRVEIFRTDSPFLLAMLPPGAFIGLGLMLAGKYLIDEKMKKRRTEAVAERALPNGETGNV

    >gi|117623821|ref|YP_852734.1| glutathionine S-transferase [Escherichia coli APEC O1]
    MKLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDNYFAVNPKGQVPALLLDDGTLLTEGVAIMQYLADSVPDR
    QLLAPVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKSTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFT
    VLRWAYAVKLNLEGLEHIAAFMQRMAERPEVQDALSAEGLK

    >gi|117623837|ref|YP_852750.1| hypothetical protein APECO1_735 [Escherichia coli APEC O1]
    MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    VGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

    >gi|117623863|ref|YP_852776.1| iron-sulfur cluster assembly scaffold protein [Escherichia coli APEC O1]
    MDMHSGTFNPQDFAWQGLTLTPAAAIHIRELVAKQPGMIGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVP
    LQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV

    >gi|117623883|ref|YP_852796.1| hypothetical protein APECO1_781 [Escherichia coli APEC O1]
    MTLSFITRWRDELPETYTALSPTPLNNARLIWHNTELANTLSIPSSLFKNGAGVWGGENLLPGMSPLAQVYSGHQFGVWA
    GQLGDGRGILLGEQLLADGTTMDWHLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSIVTSDSPVYRE
    TVESGAMLMRVAPSHLRFGHFEHFYYRREPEKVRQLADFAIRHYWSHLDDEEDKYRLWFTDVVARTASLIAQWQTVGFAH
    GVMNTDNMSLLGLTLDYGPFGFLDDYEPGFICNHSDHQGRYSFDNQPAVALWNLQRLAQTLSPFVAVDALNEALDSYQQV
    LLTHYGQRMRQKLGFMTEQKEDNALLNELFSLMARERSDYTRTFRMLSLTEQHSAASPLRDEFIDRAAFDDWFARYRGRL
    QQDEITDSERQQLMQSVNPALVLRNWLAQRAIEAAEKDDMTELHRLHEALRNPFSDRDDDYVSRPPDWGKRLEVS
    CSS

    >gi|117623887|ref|YP_852800.1| putative glutathione peroxidase [Escherichia coli APEC O1]
    MQDSILTTVVKDIDGKVTTLEKYAGNVLLIVNVASKCGLTPQYEQLENIQKAWADRGFVVLGFPCNQFLEQEPGSDEEIK
    TYCTTTWGVTFPMFSKIEVNGEGRHPLYQKLIAAAPTAVAPEESGFYARMVSKGRAPLYPDDILWNFEKFLVGRDGLVIQ
    RFSPDMTPEDPIVMESIKLALAK

    >gi|117623929|ref|YP_852842.1| putative thiosulfate sulfurtransferase YnjE precursor [Escherichia coli APEC O1]
    MSGFSMKRVSQMTALAMALGLACASSWAAELAKPLTLDQLQQQNGKAIDTRPSAFYNGWPQTLNGPSGHEPAALNLSASW
    LDKMSTEQLNEWIKQHNLKADAPVALYGNDKDVDAVKTRLQKAGFTHISILSDALSEPSRLQKLPHFEQLVYPQWLHDLQ
    QGKEVTAKPAGDWKVIEAAWGAPKFYLISHIPGADYIDTNEVESEPLWNKVSDEQLKAMLAKHGIRHDTTVILYGRDVYA
    AARVAQIMLYAGVKDVRLLDGGWQTWSDAGLPVERGTPPKVKAEPDFGVKIPAQPQLMLDMEQARGLLHRQDASLVSIRS
    WPEFIGTTSGYSYIKPKGEIAGARWGHAGSDSTHMEDFHNPDGTMRSADDITAMWKAWNIKPDQQVSFY
    CGTGWRASETF
    MYARAMGWNNVSVYDGGWYEWSSDPKNPVATGERGPDSSK

    >gi|117623935|ref|YP_852848.1| selenophosphate synthetase [Escherichia coli APEC O1]
    MSMSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNGTSVISTTDFFMPIVDNPF
    DFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIAREVTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVP
    TERVKKNSTAQAGCKLFLTKPLGIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLS
    EMCQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQTSGGLLLAVTPEAEDEVK
    ATAAEFGIELSAIGELVSARGGRAMVEIR

    >gi|117623948|ref|YP_852861.1| methionine sulfoxide reductase B [Escherichia coli APEC O1]
    MSTIKVRCEQMANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFY
    EPLSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLRFTDGENGEEING

    >gi|117624071|ref|YP_852984.1| putative inner membrane protein [Escherichia coli APEC O1]
    MSWQQFKHAWLIKFWAPIPAVIAAGILSTYYFGITGTFWAVTGEFTRWGGQLLQLFGVHAEEWGYFKIIHLEGSPLTRID
    GMMILGMFGGCFAAALWANNVKLRMPRSRIRIMQAIIGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFAIATAIGSW
    FGARFTLLPIFRIPVKMQKVSAASPLTQKPDQARRRFRLGMLVFFGMLGWALLTAMNQPKLGLAMLFGVGFGLLIERAQI
    CFTSAFRDMWITGRTHMAKAIIIGMAVSAIGIFSYVQLGVEPKIMWAGPNAVIGGLLFGFGIVLAGG
    CETGWMYRAVEGQ
    VHYWWVGLGNVIGSTILAYYWDDFAPALATDWDKINLLKTFGPMGGLLVTYLLLFAALMLIIGWEKRFFRRAAPQIAKEI
    A

    >gi|117624216|ref|YP_853129.1| inner membrane protein [Escherichia coli APEC O1]
    MFSMILSGLICGALLGFVMQRGRFCLTGGFRDMYIAKNNRMFYALLIAISVQSVGVFALIQAGLLTYEAGGFPWLGTVIG
    GYLFGLGIVLAGG
    CATGTWYRAGEGLIGSWIALFTYMVMSAVMRSPHASGLNQTLQHYTTEHNSIADTFNLSVWPLVAVL
    LVITLWVVMKELKKPKLKVATLPPRRTGIAHILFEKRWHPFVTAVLIGLIALLAWPLSEATGRMFGLGITSPTANILQFL
    VAGDVKYINWGVFLVLGIFVGSFIAAKASREFRVRAADAQTTLRSGLGGVLMGFGASIAGG
    CSIGNGLVMTAMMTWQGWI
    GLVFMILGVWTASWLVYVRPQRKARLATAAAN

    >gi|117624390|ref|YP_853303.1| periplasmic thioredoxin of cytochrome c-type biogenesis [Escherichia coli APEC O1]
    MKRKVLLIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFYQADVLTQGKPVLLNVWATWC
    PTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHA
    GDLNPRVWEEEIKPLWEKYSKEAAQ

    >gi|117624407|ref|YP_853320.1| Ada transcriptional dual regulator / O-6-methylguanine-DNA methyltransferase [Escherichia coli APEC O1]
    MKYATCLTDDQRWQSVLARDSNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPL
    QHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARRLRELLAKGVSVTTSILNAGFP
    DSSSYYRKADETLGMTAKQFRHGGENLAVRYALADCELGRCLVAESERGICAILLGDDDATLISELQQMFPAADSALADL
    TFQQHVREVIASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKPKAVRAVASACAANKLAIVIP
    CHRVVRGDGTLSGYRWGVSRKAQLLRREAENEER

    >gi|117624667|ref|YP_853580.1| hypothetical protein APECO1_4086 [Escherichia coli APEC O1]
    MVTLYGIKNCDTIKKARRWLEANNIDYRFHDYRVDGLDNELLNGFINELGWEALLNTRGTTWRKLDETTRNKITDAASAA
    TLMTEMPAIIKRPLLCAPGKPMLLGFSESSYQQFFHEV

    >gi|117624676|ref|YP_853589.1| thioredoxin-dependent thiol peroxidase [Escherichia coli APEC O1]
    MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKEHA

    >gi|117624679|ref|YP_853592.1| putative oxidoreductase YfgD [Escherichia coli APEC O1]
    MTKQVKIYHNPRCSKSRETLNLLKENGVEPEVVLYLETPADAATLRDLLKMLGMNSARELMRQKEDLYKELNLADSSLSE
    EVLIQAMVENPKLMERPIVVANGKARIGRPPEQVLEIVG

    >gi|117624750|ref|YP_853663.1| 3-mercaptopyruvate sulfurtransferase [Escherichia coli APEC O1]
    MRENLRYVIQYHAHTIRILVRIVAQTAKSASFACRFSLNIRQFSLTPAKMEMPMSTTWFVGADWLAEHIDDPEIQIIDAR
    MASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWM
    LRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVVKVTDVLLASHENTAQIIDARPATRFNAEVDEP
    RPGLRRGHIPGALNVPWTELVREGELKTTDELDAIFFGRGVSYDKPIIVS
    CGSGVTAAVVLLALATLDVTNVKLYDGAWS
    EWGARADLPVEPVK

    >gi|117624756|ref|YP_853669.1| iron-sulfur cluster assembly protein [Escherichia coli APEC O1]
    MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVVDGKSLQFLDGTQLDFV
    KEGLNEGFKFTNPNVKDECGCGESFHV

    >gi|117624804|ref|YP_853717.1| thioredoxin 2 [Escherichia coli APEC O1]
    MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQE
    RSGKVRFVKVNTEAERELSSRFGIRSIPTIMIFKNGQVVDMLNGAVPKAPFDSWLNESL

    >gi|117624903|ref|YP_853816.1| inner membrane protein with hydrolase activity [Escherichia coli APEC O1]
    MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRREQIIFHCQAGKRTSNNADKLAAI
    AAPAEIFLLEDGIDGWKKAGLPVAVNKSQPLPLMRQVQIAAGGLILIGVILGYTVNSGFFLLSGFVGAGLLFAGISGFCG
    MARLLDKMPWNQRA

    >gi|117624909|ref|YP_853848.1| hypothetical protein APECO1_3848 [Escherichia coli APEC O1]
    MTTLRQPYYELSPAVYNALVQAKTALENSTLDTTLMELVYLRVSQINGCAFCLEMHSKALRKSGVPQHKLDALAGWRVSH
    HFDERERAALAWAESVTEIARTHAEDEVYQPLLEHFSAAEISDLTFAIGLMNCFNRLAVSMRM

    >gi|117625124|ref|YP_854112.1| thiol:disulfide interchange protein DsbC [Escherichia coli APEC O1]
    MKKGFMLFTLLAAFSGFVQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPV
    NVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIW
    CAKDKNKAFDDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPPKDMKEFLDEHQKMTSGK

    >gi|117625353|ref|YP_854974.1| putative disulfide isomerase [Escherichia coli APEC O1]
    MSKLGISSLFKTILLTAALAVSFTASAFTEGTDYMVLEKPIPNADKTLIKVFSYACPFCYKYDKAVTGPVSEKVKDIVAF
    TPFHLETKGEYGKQASEVFAVLINKDKAAGISLFDANSQFKKAKFAYYAAYHDKKERWSDGKDPAAFIKTGLDAAGMSQA
    DFEAALKEPAVQETLKKWKASYDVAKIQGVPAYVVNGKYLIYTKSIKSIDAMADLIRELASK

    >gi|117625354|ref|YP_854977.1| putative disulfide oxidoreductase [Escherichia coli APEC O1]
    MGIKGMWKDLRTSPVDTLVRWQEQRLLWLLMAVAMGALIILAHSFFQIYLYMAPCEQCVYIRYAMFVMVIGGLVAAINPK
    NIILKLIGCVMAFYGSILGLKFSLKLNDIHHAVHNPDPDSLFGVQG
    CSTDPTFPFNLPLAQWAPNWFKPTGDCGYDAPIV
    PDGVTLSSTQQWFVEMYQQSEGWYLLPPWHFMNMAQACMLAFGMCLVLLVIMSGAWALKIIRG

    >gi|117625689|ref|YP_859012.1| thiosulfate sulfurtransferase [Escherichia coli APEC O1]
    MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAAQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQ
    QGYDVVYSIDGGFEAWQRQFPAEVAYGA

    >gi|117625746|ref|YP_859069.1| zinc/cadmium/mercury/lead-transporting ATPase [Escherichia coli APEC O1]
    MSTPDNHGKKAPQFAAFKPLTTVQNTNDCCCDGACSSTPTLSENVSGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQ
    VLFATEKLVVDADNDIRAQVESAVQKAGYSLRDEQASDEPQESRLKENLPLITLIVMMAISWGLEQFNHPFGQLAFIATT
    LVGLYPIARQALRLIKSGSYFAIETLMSIAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPETAT
    RLRNGEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPFASFDESALTGESIPVERATGDKVPAGATSVDRLVTLEVLSE
    PGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMAVALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVIST
    PAAITSGLAAAARRGALIKGGAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATGISESELLTLAAAVEQGATHPLAQA
    IVREAQVAELAIPTAQSQRALVGSGIEAQVNGERVLICAAGKHPADAFAGLINELESAGQTVVLVVRNDDVLGVIALQDT
    LRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLEFKAGLLPEDKVKAVTELNQHAPLAMVGDGINDAPAMKAAA
    IGIAMGSGTDVALETADAALTHNHLRGLVQMIELARATHANIRQNITIALGLKGVFLVTTLLGMTGLWLAVLADTGATVL
    VTANALRLLRRK

    >gi|117625778|ref|YP_859101.1| glutathione reductase [Escherichia coli APEC O1]
    MTKHYDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTINKFN
    WETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTIEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGF
    FALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMLSETLVEVMNAEGPQLHTNAIPKAVVKNADG
    SLTLELEDGRSETVDCLIWAIGREPANDNIDLEAAGVKTNEKGYIVVDKYQNTNVEGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGPEE
    KIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|117625779|ref|YP_859102.1| arsenate reductase [Escherichia coli APEC O1]
    MSNITIYHNPACGTSRNTLEMIRNSGTEPTIIYYLETPPTRDELVKLIADMGITVRALLRKNVEPYEELGLAEDKFTHDQ
    LIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLEILPDAQKGAFTKEDGEKVVDEAGNRLK

    >gi|117625889|ref|YP_859212.1| rhodanese-related sulfurtransferase [Escherichia coli APEC O1]
    MQEIMQFVGRHPILSIAWIALLVAVLVTTFKSLTSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGSINLLPSE
    IKANNVGELEKHKDKPVIVVDGSGMQ
    CQEPANALTKAGFAQVFVLKEGVAGWAGENLPLVRGK

    >gi|117626134|ref|YP_859457.1| periplasmic protein disulfide isomerase I [Escherichia coli APEC O1]
    MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHV
    NFMGGDLGKELTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKA
    AADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK

    >gi|117626233|ref|YP_859556.1| soluble pyridine nucleotide transhydrogenase [Escherichia coli APEC O1]
    MPHSYDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHSRLLR
    SSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFVDEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTH
    PRIYDSDSILSMHHEPRHVLIYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
    EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQTAQPHVYAVGDVIGYPSLAS
    AAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|117626254|ref|YP_859577.1| thiazole biosynthesis protein ThiF [Escherichia coli APEC O1]
    MSAVSPSSAPLLKPQTGVWQRHSCWKLQELAMNDRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAG
    AGVGTLVLADDDDVHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLMALQQRLTGETLKDAVAQADVVLDCTDNM
    ATRQEINATCVALNTPLITASAVGFGGQLMVLTPPWEQGCYRCLWPDNQEPERN
    CRTAGVVGPVVGVMGTLQALEAIKLL
    SGIETPAGELRLFDGKSSQWRSLALRRASGCPVCGGSNADPV

    >gi|117626329|ref|YP_859652.1| subunit of 2-oxoglutarate dehydrogenase [Escherichia coli APEC O1]
    MSTIFDVAVMGGGPGGYVAALRAAQNGLSVVCIDDGVNAQGEPSPGGTCLNVGCIPSKSLLQSSELYAQVQHEASIHGVN
    VEGVSFNAAAMIQRKDAIVSRLTMGISLLFKKNKVKHLCGLATLERAQDEIWQLRVNDQHIHARNVVIATGSQPRQLPGV
    TIDNQQILDNRGALALSEVPPRLGVIGAGVIGLELGSVWNRVGSDVTLLEMAPTFLPALEARLSNEVRKAMIASGMKMQL
    AVEIEAIEQRDDGVHVRWRQGEKREESRFDKLILAIGRVPRLSGVDLVQLGLEADNRGGIAVDNLCRTGKAGLWAIGDVV
    RGPMLAHKAMAEGVVVADQIAGLAVEPINFALIPSVIYTQPEVAWVGENEASLKAAGRVFNKGNSLFAGNGRALALGQEG
    GRCTLYSDKHTDRVLGGAIVGPQASELINEIALAMTFSASGEDIACAIHAHPTLSEVIHEAAMALNNKALHG

    >gi|117626486|ref|YP_859809.1| thiol:disulfide interchange protein precursor [Escherichia coli APEC O1]
    MPEVSSSISNPGTSGFTCYTRRHRLPLMAQRIFTLILLLCSTSVFAGLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQ
    IKDGYYLYRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPET
    KTVPLSEVVANNEASQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLTFIY
    VQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFIM
    GAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALP
    VFLLERVIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGETHTAQTQTHLNFTQI
    KTVDELNQALVEAKGKPVMLDLYADW
    CVACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTIL
    FFDGQGQEHPQARVTGFMDAETFSAHLRDRQP

    >gi|117626569|ref|YP_859892.1| methionine sulfoxide reductase A [Escherichia coli APEC O1]
    MTDFRESDTMSLFDKKHLVSPADALPGRNTPMPVATLHAVNGHSMTNVPDGMEIAIFAMGCFWGVERLFWQLPGVYSTAA
    GYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQDAAAR
    ASLERFQAAMLAADDDRRITTEIANATPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPEA

    >gi|117626638|ref|YP_859961.1| putative dihydrolipoamide dehydrogenase [Escherichia coli APEC O1]
    MVDMINESARQTPVIAQTDVLVIGGGPAGLSAAIAAGRLGARTMIVERYGSLGGVLTQVGVESFAWYRHPGTEDCEGICR
    EYEGRARALGFTRPEPQSISEVIDTEGFKVVADQMITESGVEPLYHSWVVDVIKDGDTLCGVIVENKSGRGAILAKRIVD
    CTGDADIAARAGAPWTKRSKDQLMGVTVMFSCAGVDVARFNRFVAEELKPTYADWGKNWTIQTTGKEDPMFSPYMEDIFT
    RAQQDGVIPGDAQAIAGTWSTFSESGEAFQMNMVYAFGFDCTDVFDLTKAEIAGRQQALWAIDALRHYVPGFENVRLRNF
    GATLGTRESRLIEGEIRIADDYVLNQGRCSDSVGIFPEFIDGSGYLILPTTGRFFQIPYGCLVPQKVENLLVAGRCISAG
    VVAHTSMRNMMCCAVTGEAAGTAAVVSLQQNCTVRQVAIPDLQNTLQQQGVRLA

    >gi|157412023|ref|YP_001481363.1| HtdT [Escherichia coli APEC O1]
    MQRLPLLYRIVLKSSLIWNLKIALKRYNQVLIMQRSRGHPIVKKLLFPLMAAFAIMANTVTYASEQVLTNSDAAALMAKA
    KEGGVSPSQISGALSKMKGYKPKDAIYIPSGGLYLFQDERSQLMAVTTDGRYSLTGGSLVDVIKRKPVLTVEEIRNSYFI
    SLDEAPFPLETVASIHLGNSKLKRQAAIFLTLD
    CDGCMELVKKFYADRDKYRIDIVLVPSPGEPKEELRRLWCSKEKGKI
    NNLDILRWLMGSKSDIEKRLLSQKEAEECPAEPLVASLMLAGIYKLQGVPSVVRQDGLAGNGIPKDFDYWLNQSVEPLLK
    NPFETN

    >gi|157412152|ref|YP_001481493.1| hypothetical protein APECO1_O1R137 [Escherichia coli APEC O1]
    MSKEFYLKPMATILISAVIATAASALIAATYFKPKVLSEEEIGKIAATYLVKNPHYLVEAGKALENQNVSASVERIIPYA
    PALLDTKETPNIGPDDADVAVIEFFDYQ
    CIYCMRVTPVVESVMNQSKDVKFFFKEFPIFAGSKPVSAMGAATGLHVYQNF
    GAEAYRKYHNNLMAVAHTFMTSQRKFELSDFNTVVDKSGFNSTFSDREKNRYENVISGNMQLGEALGITGTPGFIIMNMK
    KPNAATTTFIPGAMDAATLQGAIEKARGA

    >gi|157412156|ref|YP_001481497.1| DsbC [Escherichia coli APEC O1]
    MKKIIKASVLLLSLSTAFTMNAEPVNTMVLPDAARDKLKAIGLSIEHVEPSPVKDIFTVISREGVSYVSKDGDYIFTGSL
    FHVKGKDVVNTTEQAILMGVREFASKTKSIDYKSPNEKYRLAIFTDIT
    CGYCQKLHHDLKSYLDAGISIKFLAFPRAGLN
    SVVAGNMAKIWCSAKPNEALDAAMNPVSTIPEGRPDEACLNIIKSHFQVASTIPLQGTPTMVTLSGKPQLFTGWLSPENL
    VTQMGAAQK

    >gi|117622318|ref|YP_851231.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Escherichia coli APEC O1]
    MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAV
    RNEAKSRDLTVFDAT
    CPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEK
    LSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGK
    RAFLIDDATDIQEEWVKEAKCVGVTAGASAPDILVQNVVARLQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD