Alkalilimnicola ehrlichii MLHE 1 uid58467

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114319188|ref|YP_740871.1| cytochrome c biogenesis protein, transmembrane region [Alkalilimnicola ehrlichii MLHE-1]
    MTALARPLPAATPLRWPLYWLLVLLLALPLWGADARANPLDQLGGGQQQILPAEEAFPLFLERIGEHRLLLTVDVAEGYY
    LYREKLAFEVRNGGVALTDVAIPEGREKDDPFFGQTTILRGVAQVQLQFDGPVPDDLRLEVAYRGCADIGVCYPPLTADL
    GLDGQGAIASGVGGGGGGTAGGAEGRLSSLLQDGSAWMILGGFFVAGLLLAFTACLYPMIPILSGLIAGDSQRGSGRALL
    LSFVYVQSVAITYALAGAAAGLTGRVVQAELQNLWVLGGFSLVLVLMAMAMFGLFTVQMPGVLQNRLDALSRRQKGGRLL
    GVAVMGMLSALIVGACSGPALIAALSFIGTTGEVGLGALALYVMALGMGLPLLLIGTAAGKWLPRSGAWMDGVRQLFGFV
    LLGVAIWMIERLLSDAFALALWGLLLIAFAVWVGWRLRGGRLLWRWSGRAVGLAALLWGAAALVGAGTGAHQLSQPLAGL
    SGESRTELAWVDAHSLDELDALREQAQAEGRPVMLDVTADW
    CIYCQQLKDRTFPDPGVQAALSDAKLVRVDVTAMDDAER
    ALLEALGVFLPPAIIFYRADGSEARGQRVSGFLGAEEFRQRVDAALNGEPGPRG

    >gi|114319189|ref|YP_740872.1| redoxin domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MTRALLFTVVILLGAVAGVFGYQVWDQDRPEPRPDLTLPDLQEQPRSLSEWDGRLIVLNFWATWCPPCVEEMPLFQRLQD
    EYGDRGLQFIGVAVDRPDAVAEFVAEHDIRYPILYGRQAAMSAGQDFGNQAGTLPWTVIIDREGHIRHVFDREVSREQIE
    PVLLDLL

    >gi|114319259|ref|YP_740942.1| UBA/THIF-type NAD/FAD binding protein [Alkalilimnicola ehrlichii MLHE-1]
    MNDEQLLRYNRQIMLPEVDLAGQEQLLASRVLVVGLGGLGSPVTLYLAAAGVGQLVLADFDRVEMSNLQRQIAHTTQDLG
    RMKVESARDAVARLNPGVVVETVEQRLDPAALAEWVSRVDLVLDGSDNFATRYAVNAACVAAGKPLVTAAVIRMQGQLAN
    FRFDLRPAPCYQCIFPDTGEEARQT
    CSDTGVLAPLAGVMGCLQAVEAVKVLLDRDEASRGRLYTFDAMGLEWRGLGVRPD
    PDCPICAAAGAAVER

    >gi|114319269|ref|YP_740952.1| methyltransferase type 11 [Alkalilimnicola ehrlichii MLHE-1]
    MRDSSFEQRWRRRFAQRGAQLDDDAGIAGWTPTGLAGRVRQFRTLWSMSARAPGRWLDIGCGAGTYTRLLHAEGHQVAGL
    DYSAPSLHKARARSPAGIPWLAANIRQLPLADGVADGVLCFGVMQALARPDEALAEMHRVLKPGGEVWVDALNAR
    CLPTA
    WREYRRQRAGAPPHLRYDRPDEFLEAARVAGLEPLHLHWLPLLPGRLAPLQGVAEWTGTRRVMEKIPTVGARLSHSFILR
    AHRPLNE

    >gi|114319387|ref|YP_741070.1| hypothetical protein Mlg_0225 [Alkalilimnicola ehrlichii MLHE-1]
    MAAVGNRLGDATSPYLLQHADNPVHWQPWDDRALALAREQGKPILLSIGYSACHWCHVMAHESFEDPAIARLMNERFINI
    KVDREERPDLDRIYQTAHQLLTRRPGGWPLTLVLTPDDQTPVFAGTYFPPDTRGGMPGFADVLRQVDEAIRSQPQAVADQ
    NRALRHALGRLAHAPADGGDAALGNAPLRAARDALADSFDRVHGGFGAAPKFPHPGGIERLLRHYALTLVTGDGPDRDAL
    HMACHTLRRMALGGIYDQVGGGFARYSVDEYWMIPHFEKMLCDNALLLGLYADAWHATGDGLYARVVQETAEWVRAEMER
    PEGGYCTSLDADSEGGEGRYYLWTPDEVRELLDEDEWRLVEHRFGLDEPANFEGRWHLHVQASFSESARRLGRPREQVVA
    LWQSARQKLQRARGQRVRPGRDDKVLTAWNGLMIAALARAGRLLDEPAWTASALRALGFLRERLADDQGRLYASWRAGRA
    AHQACLEDYAYLLEGVLECLQSEWSDDRLGFALHLADTLLERFQDKDEGGFWMTADDHEPLIHRPRPLADDSLPSGNAVA
    LRALQRLGHLLGEPRYLEAVARGLRAAAGAIARMPEAHASLLTALEEYLYPPEIVVIRGAPEVTGPWRTRALKYYTPNRL
    VFALPADAAPPGVLSGRQTEGAAPAAWVCSGKTCRAPVRSLDELERVLAHPDFRSMD

    >gi|114319410|ref|YP_741093.1| thioredoxin reductase [Alkalilimnicola ehrlichii MLHE-1]
    MSETKHCKLLILGSGPAGYTAAIYAARANLNPVLVTGLEMGGQLTTTTDVDNWPGDAEGVQGPELMERMKRHAERFETEV
    VFDHIHTAHLKAKPFRLEGDAGSYTCDALIIATGATAKYLGLDSEQAFMGKGVSA
    CATCDGFFYKNQPVAVIGGGNTAVE
    EALYLSNIASHVTLVHRRDSLRAEKILQRQLMERVEAGKVSIVWDHNLDEVLGDDAGVTGLRLKHTQTGETRQVDVHGVF
    IAIGHAPNTGLFQDQLEMNGGYIVVKSGLNGNATATSIPGVFAAGDVMDHVYRQAVTSAGTGCMAALDAEKYLDALHLE

    >gi|114319433|ref|YP_741116.1| dihydrolipoamide dehydrogenase [Alkalilimnicola ehrlichii MLHE-1]
    MADLVEVKVPDIGDFDAVDVIEVLVSPGDEIEVEQSLITLESDKASMEVPSSHAGVVKEVKVKVGDKVSEGDVVCTLEAA
    EATAGGEAPATGGGRAEKPAEPEPPAAATRPAPAAAPQGDAPVDADCDVLVLGAGPGGYTAAFRAADLGLKTVLVERYPT
    LGGV
    CLNVGCIPSKALLHAAKVIDEAEQFADHGITFGKPKIDIRKLADWKSSVVKKLTGGLAGLAKQRKVEVVTGKGAFK
    DAYHLEVDGKEGKRTISFRHCIIAAGSRPVVPPPLAVDDPRVMDSTGALELEEVPERLLVVGGGIIGLEMACVYDALGSK
    VTVVELADRLMPGADADLVKVLRKRIDKRYDAIHLNTLVKELKPNKKSITVKFEGKDAPESDRFDRVLLSVGRRPNTDLI
    GLEATGLKPNDQGYIDVDEYMRTGVSHIHAIGDIVGQPMLAHKASHEGKVAAEVIAGEKSAWDARAIPSVAYTDPEVAWV
    GITEEEAKAQGIAYEKGAFPWAANGRSLSLNYQDGISKLLFDEQSGQLIGAGIVGPNAGDLIAEAALALEMGAEAADIGL
    TVHPHPTLSETVAMAAEAAEGTLTDLYIPKKKK

    >gi|114319480|ref|YP_741163.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
    MTNSPYIVDITMDNFQSEVLEGSMQQPVLVDFWAEWCEPCKTLMPLLEKLAEEFRGAFRLARVNCDEQQAIAAQVGVRSL
    PTVILVSQGQVLDQFTGALPEGELRRFLEQHVEPPQADPLEQAREHLAAGEPQAAVPLLEALHGQRPDDQDVALELAHAL
    MQAGEPDRAEAIVAELPDEARHDPRCKGIKARRAFAEQLADLPGREALAARVEQDPRDSEARHGLALHQVLAGEHDAALE
    NLLWIVRHDRAWDNDRGRQTLLAVFDLLGADDPLVRQYRSRLFQSLY

    >gi|114319487|ref|YP_741170.1| heavy metal translocating P-type ATPase [Alkalilimnicola ehrlichii MLHE-1]
    MSTETGNARGFDLGVQGMTCASCVARVERVLGRVPGVRSVSVNLATERARVEASEGLELGALLDAVGKAGFEPVVQDLDL
    TVEGMT
    CASCVGRVERVLARQPGVISASVNLATGKARLRTLPGVAEPQALIRAVEKAGFGAVLETDETEPGGPSPAEREL
    QQLRIAKRVALLLTVPLVMIAMGPMMIPPLAEVMHRLLPPAGWRWVEAVLATPVLFWAGARFFRHGWPALRRLNPDMNSL
    VMLGASSAWLYSMLVLLAPGLFPEAARGVYFEAVGVIVTLILVGRYFELRVRGRASDAIRQLLALQVREARVRREGGLVS
    VPLEALQPGDVVVVRPGERIPVDGEVLDGGSYVDESMVTGEPVPVEKGVGASVVGGTVNGSGSFSFRATGIGEDSVLGRI
    VHMVEEAQASKPPIQALVDRIAGVVVWGAIAIALVAALIWFAVGPGPHYALVTAASVLLIACPCAMGLATPMAIMVGSGR
    GARQGILFRRGAAFQAIAGVDTVVVDKTGTLTEGRPALTEFERHGGWSQDALAPLVAALESRSEHPVAEAIVRGLDDPGE
    RVVEGFTAHAGLGVEGRVEGRHLQVGADRYMSRSGLDLSPFADRARALADRGRTPLYVAVDGELVALLAVADPVKSGSPE
    AVRALKALGLRVVMITGDNRRTAEAVARETGIEEVIAEVMPEDKAREVGALQAAGHSVVFVGDGINDAPALARADVGMAI
    GTGTDIAIEAGEVVLMSGDLRGVAAGIRLARRTFRTIRQNLFWAFFYNITLMPVAAGLLYPAFGLLLSPMMAAAAMSLSS
    ILVVSNSLRLRRARLGGPLEV

    >gi|114319530|ref|YP_741213.1| thioredoxin [Alkalilimnicola ehrlichii MLHE-1]
    MSGQIVHATDQNFEDEVIKAGEPVLVDYWADWCGPCKMITPILDEVASEYAGKLKVVKLNIDENPETPPKYGIRGIPTLM
    LFKNGGVEATKVGALSKSQLTAFIDSNL

    >gi|114319593|ref|YP_741276.1| redoxin domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MSNTRKMLAVAAGAVALVAVALLVIAPWEGKSRPDVTFNTLEGETVALETLRGQPVLVTFWATDCPTCIDEIPHLQALHD
    DMAERGVKVIGVAMHYDDPELIKALVEAREMSYLIAHDQDRSVSQGFGEVRVTPTSYLIDPDGRVVWQRLGLLDMERVRG
    QIERMLERG

    >gi|114319596|ref|YP_741279.1| iron-sulfur cluster insertion protein ErpA [Alkalilimnicola ehrlichii MLHE-1]
    MSETAQSYDPTEDFQALVVTDSAAARVAQLIAQEESDDLKLRVFVSGGGCSGFQYGFTFDERIEEGDSVVEKDGVTFLVD
    PMSSQYLMGAEIDFVEGIEGEQFVIRNPNATTTCGCGSSFSI

    >gi|114319672|ref|YP_741355.1| redoxin domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MMMSVNLGPLALPLDRLPLLVALLAALLLSWLIGRRQGGNADGPLLVTGLIALIAGRLGFVLQYRNDYLAAPLSFINIAD
    GGFSPVAAVVAIAGVGGFYALRRPLQRPALIGALVGGLLTWGAGMAAVQQLSPEPPALPEAHLQTLDGQPQPLADYRDGP
    LVINLWASW
    CPPCRREMPVLSAVQQARDDVTILLVNQGETADTIRTFLDELDSPLDHVLLDPRSGLSAHYGSGALPTTLF
    IDAEGRVIDSHLGELSRARLSRGIDAITGD

    >gi|114319756|ref|YP_741439.1| glutaredoxin-like protein [Alkalilimnicola ehrlichii MLHE-1]
    MDQVQETIAKQVKENPILLYMKGSPQQPQCGFSMRAAQALAGCGKEFAYVDVLQDEAIRQGIKEFGNWPTIPQLYLNGEL
    VGGCDIIMEMYESGDLQKMVDQAAESASN

    >gi|114319784|ref|YP_741467.1| ArsR family transcriptional regulator [Alkalilimnicola ehrlichii MLHE-1]
    MSHTPETTRKRDLLAQIATVGKALGHAYRLELLEYVAQGERTVEALTQLTGLHLATVSQHLQHLRRAGLVRTRREGKYIH
    YRVAGDDVVNLVNSLRCVAENNLSEVQRLVQDYFDDTEALEALPTADLLERLREGSVTLLDVRPEEEYRVGHLPGAINIP
    ASELAQRLRDLPPGREVVAY
    CRGPYCALSHDAVRLLRERGVKALRLEAGYPEWKAAGLPVEDR

    >gi|114319786|ref|YP_741469.1| DsrE family protein [Alkalilimnicola ehrlichii MLHE-1]
    MHYLILINDPPYGTERVFNGLRLAHALLKKADDNRVDVFLMADAVVGANAGQKTPDGFYNVERMLRRVLAGDRGRVLLCG
    TCMDARGMSDDDTMDGPRRSTMDELAQITADADKVIVF

    >gi|114319911|ref|YP_741594.1| radical SAM domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MSATFPQLQPTTFPAIRRRRLETLQVNVGYVCNQTCFHCHVNAGPNRKEKMDRATADLVLAYLRHSGARTLDLTGGAPEL
    NPQFHYLVEQAHGLGVQVMDRCNLTVLEQPGQEGLANFLAAHRVEVVASLPCYSADNVDSQRGEGVFEQSIRGLRQLNAV
    GYGQPGSGLPLNLVYNPLGATLPPPQDQLEADYKQHLADEFGIVFNGLFTITNMPIHRFAKQLYKSGQYEAYMALLKSAY
    RPENLANVMCRSLLSVDWRGYVYDCDFNQMLAIPLGAGHRPRSHLRDLIGRDLSGEPIAVADHCYGCTAGQGSS
    CGGAL

    >gi|114319912|ref|YP_741595.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Alkalilimnicola ehrlichii MLHE-1]
    MKQDLIIIGGGVGGLVTASVAGQLGVKTVLIDAGANLGGDCLHYGCVPSKTLIRSAEVAALTRRAGEFGLQAELGPVDLG
    AVMDRVRQVIDQIQVHDDPDRFRGYGVDVRFGHARFLDRDTVSVDGERLQARRFVIATGSAPAVPPVPGLAEAGFHTNET
    IFQLRTLPRRLAVMGGGPIGIELAQAFSRLGSQVTVVEMAAQILPRDDAEQAAELRSVLDAEGITVHTATTVERVEQSEG
    ITRLACRNGESHWTVTADALLLAAGRKPNLDLGLEAAGVAYGPRGIRVDRRQRSSVRHIYAVGDCCGPYPFTHMAEYQAG
    IVIANALFRIPKKVDYRVVPWVTYTAPELATVGLTEDEARARNLKVEVLRFPFREVDRALAEGETAGQAKLIVRRGRLVG
    ASVLGPHAGELIHEAVLAIQARLRVGTLAAAIHAYPTLAQVFRRAVNTRYTEQLYSDRTRKLVAFLQRWLPGR

    >gi|114319917|ref|YP_741600.1| ArsR family transcriptional regulator [Alkalilimnicola ehrlichii MLHE-1]
    MSRIRPEKRDLLEQLATLGKALGHPYRLELLEYVAQGERTVEALTELTRLPVATVSQHLQHLRRAGLVRPRREGKYVHYR
    ITDDNVVGLLAALRGVAEHNIVEMQQLLESYFEGSQTLEAIHADDLTARLRDGLVTLLDVRPEQEYRTGHLPGAINIPAA
    ELERRLRDLPPDREVVAYCRGPY
    CALAHKAVRVLREHGLQARRLADGYPEWRAAGLPVEEH

    >gi|114319972|ref|YP_741655.1| electron transport complex, RnfABCDGE type, E subunit [Alkalilimnicola ehrlichii MLHE-1]
    MTTDTLPTTETPGRAPSAFQEIARKGLWENNPALVQLLGLCPLLAVTGTVVNAAGLALATLLVLVASNLTVSLIRNQVRT
    EVRIPVFVLVIASFVTAVELIMEAWFHQLYLVLGIFIPLIVTN
    CAILGRAEAFAARNPPGRAALDGLMMGVGFGAVLLLL
    GAMREALGQGTLLSNAHLLLGEAGRGLEITLIPDYPGYLIALLPPGAFIGLGLILAGKNWLEQRRSGA

    >gi|114319977|ref|YP_741660.1| electron transport complex, RnfABCDGE type, A subunit [Alkalilimnicola ehrlichii MLHE-1]
    MTELALILVSTVLVNNFVLVKFLGLCPFMGVSRQLETAMGMALATTFVLTLSAVCSYLAYEYLLAPLGVEYLRTITFIMV
    IAVVVQFTEMAVRKTSPLLHQVLGIYLPLITTN
    CAVLGVALLNLQEQNSLLQSAVYGFGAAAGFSLVLVLFAALRERLEV
    ADVPLPFRGASVALVTAGILSMGFMGFAGLVRL

    >gi|114319987|ref|YP_741670.1| arsenate reductase [Alkalilimnicola ehrlichii MLHE-1]
    METGLREETLMRYYHNPRCSKSREGLKLLQAHGVEPEVIQYLKTPPGTDELASLMERLDIHDPRGMMRRKEKLYKELALD
    DPGLDRETLLQAIAEHPRLLERPIGVSDRGAVIGRPPERLLELLA

    >gi|114319990|ref|YP_741673.1| 1-Cys peroxiredoxin [Alkalilimnicola ehrlichii MLHE-1]
    MTEEVNEQQEPVLAMPQLNKPAPDFEAQTTHGPKKLSDYRGKWVVLFSHPADFTPVCTTEFMAFAQRSEDFKALNTELLG
    LSIDGIHAHVAWVRNIKENFGVEINFPIIADLNMKVANAYGMVQPGASDTSAVRATFFIDPEGILRAMIYYPMTNGRSID
    EALRLVKSLQTSQEHGVATPEAWQPGDPVIVPPPATVEEAEARKDQGYDYVDWYFCKKTL

    >gi|114320075|ref|YP_741758.1| soluble pyridine nucleotide transhydrogenase [Alkalilimnicola ehrlichii MLHE-1]
    MVGGAVKEQHYDAVVIGSGPGGEGAALALSKSGRDVVVVESHGEVGGGCTHWGTIPSKALRHNVRRMMEYNTNPLFHDVA
    APKRLSFPRVLKFAERVINRQVNLRAGYYSRNEIPVLHGRARFLDAHTVEVHGAEGKVLRLRAGHFLIATGSRPYRPEGV
    PFDHPRVCDSDKILSLDHTPRTIAIYGAGVIGCEYASIFRGLGVKVDLIDTRERLLTFLDNEISDALSYHLRELGVLIRH
    DEAFTQVVPRDDHVVVHLDSGKQIKVDILLWANGRSGNSEDMGLEALGIEPNSRGQIQVNDNYQTAQEHIYAVGDVIGYP
    SLASAAFDQGRFAASHMLCGQRDYRLVQDIPTGIYTIPEISSLGKTEQELTAAKVPYEVGHAFFKDLARAQIANQGVGML
    KLLFHPETLEILGIHCFGDQAAEIVHIGQAIMAQTGEANTLMYFLNTTFNYPTMAEAYRVAALNGYNRLG

    >gi|114320186|ref|YP_741869.1| DSBA oxidoreductase [Alkalilimnicola ehrlichii MLHE-1]
    MTSSDTGRILGDSPSCRVGLMSVDIELFSDLVCPWCYLGKHRLERALAQLPDGPPVRIIWRSLELFPARSRHRPPLPPRS
    QELDRDFLDQAHTDALPLARHPPPLVDAYDAHRLVQVAREQGLDPLRVADALFHAGFVEGGDLSNHQVLEMAGAEAGMPR
    ELIRETLAGDGGTAGLTADLAHARELNVRAVPFYLMDGRIEIIGAETTDVLLEALSTVVAECDHP

    >gi|114320192|ref|YP_741875.1| glutaredoxin [Alkalilimnicola ehrlichii MLHE-1]
    MRILIRYFFRGVRLVLTPFMIAGSRLMMPKGIERDPEDQRAVDAQTRRLALYHYPACPFCIKVRRVMHRLSLDIELRNAQ
    GPGEYRETLRREGGRVMVPCLRIEQEDGSVRWLYESDDIIEYLLDHFEPE

    >gi|114320285|ref|YP_741968.1| OsmC family protein [Alkalilimnicola ehrlichii MLHE-1]
    MTDLRSIQAPLKEQYRQSPESALVTLKAEGRVGEGVSCSLATGKALVEAGLHPATGGPGTQACSGDMLLEALVACAGVTL
    SAVATSLEIPIEECTLRAEGDLDFRGTLGISKEAPVGFKEIRLEIALQSPASAEQLDTLLELTERYCVVAQTLKAAVPVH
    ASYRDNAQ

    >gi|114320316|ref|YP_741999.1| molybdopterin biosynthesis protein MoeB [Alkalilimnicola ehrlichii MLHE-1]
    MSETSVTVRLPAPLRPFAGDQPELHVPGASVGEVLEALARDYPLLHARLVDPDGELRAFVNLFRGEQDVRELAGQRTPLR
    PGDVLTVLPAVAGGAPSALERLSARIRREVPEVTPAEAQKLAAQGAVLLDVREAGEVAEGSPTGALRIDRNWLELRIEEA
    VPEPERPILTL
    CAVGQRSLLAADDLRRLGYRDVRNIAGGFNRWKDEGLPFEVPRVLDDASRARYARHLRMPEVGEAGQLR
    LGESRVVLVGAGGLGSPAALYLAAAGVGTLVLVDHDVVDRSNLQRQILHTDDRVGQPKTESGRQAVAALNPQVRVEAVQA
    RLNSENIEAVLAGADLVIDGSDNFPTRYLVNDACVKLGLPLVYGAVYRFEGQVTVFNVDDGPCYRCLYPEPPPAELAPS
    C
    AQAGVLGVLPGVIGLLQATEAVKLLLGVGEPLSGRLVHYDALRGQFQQLRMKANPDCPVCAPGRPFPGYVDYEAFCSSSA


    >gi|114320335|ref|YP_742018.1| protein of unknown function DUF395, YeeE/YedE [Alkalilimnicola ehrlichii MLHE-1]
    MASTATSVTAQVQEDRGGIDRFIVATALLGFALLGGLIWLETAPFMAVLFLIGGLLGVALYHGAFGFTGGWRRFVVERRS
    AGLRAQLALLALATVLFVPVLAGAEAGSMTGALAPVGVSLVLGSFLFGLGMQLGGGCGSGTLFTVGAGNIRMVLTLVFFI
    VGSVVGTFHLPWWLDQPGADPVNLSISLSPVGAIGVQLAVIAALTAWISHLERRHHGDVERKVFVGPGPDQGWLQTFFTG
    QWPLIWAVVVLALGNLAILLLSGHPWGITFAFGLWGAKVLQAVGVDLAQFEFWTWDYPALALRDSVLVNVTSVTNFGVFL
    GAMLAAGLANKYNKASAGRIPPRSLLAAILGGLLMGYGARLGFG
    CNIGALFSGIASASLHGWVWFAAAWVGSLIGIRLRP
    FFNLSNR

    >gi|114320336|ref|YP_742019.1| thiosulfate sulfurtransferase [Alkalilimnicola ehrlichii MLHE-1]
    MKILTSLFAAALLALAPHAGAGDPEARPLAEPEWLQGQLERDDLVVLDVRNALDGGGHDTYLEGHIPGAIHSDYLKAGWR
    TERQGVPAQLPDVASLERLIRELGISNDDHVVITAAGTDGLDFGSAARIYWTFKVLGHDRVSILNGGFRAWQEAGLPVAT
    GGHERPRSDFAADFRPEMVGTTERLLEWRERGAQLVDNRPQAHYLGRGGHPAARAHGTIPGAKNVEEARLIVDESGRAVD
    SQRLQQLLAEAGVDPQREIVTF
    CNTGHWASVGWFALSEIAGHDDVLMYDGSMVEWSADAERPLQVERQGLARLIERFFN

    >gi|114320337|ref|YP_742020.1| dihydrolipoamide dehydrogenase [Alkalilimnicola ehrlichii MLHE-1]
    MREIEVDVAVIGAGSAGLRAYRSAAQYAKRVVLIEGGDYGTTCARVGCMPSKLLIAAAESAHHARGAAKFGIRVAEPEVD
    GRAVMERVRTERDRFVGKATAVTQKIPEADRLHGHARFEDRNTLRVGDDLRVRAGSVVIATGSRPQVLPMFEGLGDRLVV
    NDDIFDWMDLPESVVVFGPGVIGLELGQALQRLGVRVRMFGIGGFVGPLTDPDVKAMAERHFQSEFPLDADSRVESVARE
    GDQVVVRFRDGEDELREEHFEYLLAATGRRPNVDRLDIGNAGLALDDQGLPVFDRYTLQCGDSSVFIAGDANNHLPLLHE
    AADEGVIAGRNAARFPEVAPGHRHCPLSIVFTDPQIAMVGDARAELEEGTYAVGELDFSAQARARVMGEDHGLMRVYGRY
    SDGRFLGAEIFTPRAEHMAHLLAWCREQGLTVAEMIDKPYYHPVLEEGLRNALQMLQSRLEQGRGQVRP

    >gi|114320380|ref|YP_742063.1| glutaredoxin family protein [Alkalilimnicola ehrlichii MLHE-1]
    MLENREGQRVPEVVFRTRKDGEWVDVDSRDLFNGRTVAVFSLPGAFTPTCSSTHLPRFNELAPVFFENGVDEIVCISVND
    AFVMNEWARDQHAENITLIPDGNGEFTEGMGMLVDKTDLGFGKRSWRYSMLVKDGVIEKMFIEPQKPGDPFEVSDADTML
    RYINPEAPHPEFVTLFAKAG
    CPHCARAKALLESHQMAYEEITLGEGVTTRSVRAATGSGSVPQVFVDGRLIGSADALERF
    LEERRKVA

    >gi|114320403|ref|YP_742086.1| iron-sulfur cluster assembly accessory protein [Alkalilimnicola ehrlichii MLHE-1]
    MANIQLTDKAVRHVKDYLARHEGGVGLRLGVKTTGCSGLAYTVDYADRIEASDEVIEQDGVKVLVNRKSLPFLEGTEVDF
    VRDGLNQRFDFRNPNVKETCGCGESFTV

    >gi|114320424|ref|YP_742107.1| protein of unknown function DUF395, YeeE/YedE [Alkalilimnicola ehrlichii MLHE-1]
    MREGAPGARYVWEEHFLEAVEHTTLVNLGGLVIGLVFGIVGRRSGFCLTRGLQRCFQAGDGGKLRTFALAVVTALVGSQL
    LASLGVIDLGRTHYLAPEFSWLLVPLGGVLFGYGMVMANG
    CGARAAVLLGGGNLRSFVVLTCLGVAAFMALTGVFAGWRL
    ALAEATGLRLALGAGLHGWLASAGLPELLARWLMVLVLAIPLLVYVFSDQGYRHRRQEWAAGILVGLLVPAGWWVTGSLG
    ADDFDPVPVVSLTFVAPIGDGIQYLMLASGTDLSFGVTVVAGVLLGSLATALVTGSFQLEGFPSPQRMLRAMGGGALMGI
    GGALALGCSIGQGITGLSTLALPSLLAASGIVVGALVGLRGPARLPAL

    >gi|114320459|ref|YP_742142.1| alkylhydroperoxidase [Alkalilimnicola ehrlichii MLHE-1]
    MAEDWAKLAELMSGRMKEVAKGVPETARGFNQLKQVSGREGALDPATKSLIALALGIAAHCEGCLAFHAQAAAKHGATRE
    QVQEMIAVAVQMGGGPAFVYGGMALEAFDEFAG

    >gi|114320464|ref|YP_742147.1| peptide methionine sulfoxide reductase [Alkalilimnicola ehrlichii MLHE-1]
    MTGEGATTERATLGGGCFWCLEAVFQRLRGVRSVVSGYAGGRRAHPSYAQVCSGATGHAEVVQIEYDPGTISYRELLQVF
    FTIHDPTTPNRQGADVGSQYRSVIFYHDDQQAAVAREVMSREAGRRADPIVTELTPLPAFYPAEADHQDYYRRHGGQPYC
    QMVIAPKLEKAARHFGRLTGDDRP

    >gi|114320643|ref|YP_742326.1| thiol-disulfide interchange protein DsbC [Alkalilimnicola ehrlichii MLHE-1]
    MSKTLPVLLVLWSLPMLAWADNVHERIDEALHGLSPELSADAVNETPVDGLYEVIVSGDVVYMTGDGRFLFQGELVDLES
    RQSLTELRRGEQRAARIAELGSDQLLIYPANGETRYVVNVFTDIE
    CPYCQRMHQEIDDYTDKGIEIRYLFMPRAGEGSES
    YRQSEAVWCAEDRHAAMTKAKRGEPVESGAECETPIADHLALARELQVRGTPTMISSEGVMQQGYASPENLLQVLEAAAN
    SSKQP

    >gi|114320668|ref|YP_742351.1| rhodanese domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MSWADWWPFGDVPEIAPGPLSRAVHMGEVQVLDVRSRPEFRRDHIRGAVHLPVWSCSPRQLQRLGLDRDRPVVVICLSAH
    RSIPVVRRLRRMGFEAMQLKGGMRAWWRHQS

    >gi|114320778|ref|YP_742461.1| carboxymuconolactone decarboxylase [Alkalilimnicola ehrlichii MLHE-1]
    MRAPYQMNLPLRTTEDSDPAVAAPLKKARENLGFVPNMYAGMANLPALLETYMTGYERFRAEAGFSPQEQEVIFLTISRG
    NGCDY
    CMAAHSVIADSMSGVPTEVTDALRDGEPLPDERLEALRRFTEVMRDTRGRPDTADVNAFLEAGYEEKHILGVILA
    LAVKTLSNYSNHLFGPEVDAAFQSRIWRP

    >gi|114320786|ref|YP_742469.1| methyltransferase type 11 [Alkalilimnicola ehrlichii MLHE-1]
    MVALLGYSREQIRAAVCDMYSQVARAPTSGFHFPVGRQIAEALGYPPARLQGLPEATLRAFAGVGYPFRAEAVRPGDTVL
    DIGAGAGNDSLIAAGLVGSAGRVIALDLTPAMTATLYHAAQAGGCDNVAVVQGSAERLPLSDGSVDVVTSNGALNLVPDK
    RRAVAEMFRVLRPGGRLQMADVVIRRPVTVDCGEDPRLWVE
    CVVGATVDEELLHLFREAGFEAVEVLRRHDYFAHSPSAQ
    TREIAESFGAHSLDLGMRRAATAPSTLQRWLWRADPRHWLAALRRRGFLGVAALLLALLSCYGTLAALALLPLLGYSLAV
    DEGAWAVAIAAFALLTLAAVAAGVRRHGRWAVVALAATGVSVILYALFIQYSLVVELAGFLLLAGGVVLDAWLRRRHQAR
    VLGLEAAPR

    >gi|114320789|ref|YP_742472.1| methyltransferase type 11 [Alkalilimnicola ehrlichii MLHE-1]
    MSTVDERTGVDRQALEAKVKEMYSRVANEPDTDFHFEMGRGLAERLGYRPDDLDRIPREAVDSFAGVGYHLDLAGIEAGQ
    VVVDLGSGSGMDTFIAALKALPGGHVIGVDMTEAQRTKASHLAATARIDNVEFREGYIETPPVRDGSADVVISNGVINLS
    AEKERVFAEAARLLRPGGRLALSDIVTEAQLPGSVKCDATLWAA
    CIGGAMQQDDYLAAITRAALEVAEVRANPQYHFLTE
    AAQGASRRFGVKSVSVLAIKR

    >gi|114320800|ref|YP_742483.1| rhodanese domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MTAAGGHAILRPHITGYGYIMRRIILLTALALLLPLSAAARQGDPLPGPLVSADWLAAHLDDVVVLDIRTDIDSFSTGLA
    PSDDEEGMGLCSDPLPMGSHRIEGHIPGARLVRLADITGQYPGPNGPIGGMLAEPAAFQAAMQAAGVNAGQPVVVTSQGL
    SISDMANATRLYFALRHFGHDSVALLDGGVAGWIDAGHDFATRQLPFEPGDFQAGPGDATLLATRGQIEAGEAGALVDGR
    SGGEFRGLLDSSSVAGRGHLPGALHIPMGDLGSSGRPAYLHDTERQQATFSAVPDGPLTVY
    CDTGRRATLHWFVLNELLG
    KPARLYDGSLHEWTHQGGDLARP

    >gi|114320808|ref|YP_742491.1| DsrE family protein [Alkalilimnicola ehrlichii MLHE-1]
    MKFGILVNEGPYQHQAADSAYLFAKAALEMGHEVPRVFFYMDGVNNANKLQEPQQDDRNVVQRWSELAESHEVDLVVCVA
    AALRRGIKDEILAPGFRISGLGQLVEIGVEADRLVTFGD

    >gi|114320820|ref|YP_742503.1| protein of unknown function DUF395, YeeE/YedE [Alkalilimnicola ehrlichii MLHE-1]
    MIFESFNTALTAYFAAVFVLAVILGAVVNKTNFCTMGAVSDVVNMQDWGRMRAWFLAILVAMLGVILFEAAGLIDLSSTQ
    PPYRRAQFPVVEYILGGLIFGIGMTLASG
    CGNKTLIRVGGGNIKSILVMVVLGIVAYYTINPIPGTEHNLRGLLVWWWSS
    PLAIEFSVAQDVGHVLAGPDNATGVRLMIGLALVAGVGWWIFRSAEFRSNRDNIVAGVVIGLCIALAWLVTDNIRLQDSW
    GDEHSLPGYVQEWDFVTDGEEAFRPASAGGVNTQSFTFIGPIAQTINYLARGADNAYLTFGVVSVSGVILGSLLWALLSR
    SFRVEWFVNGRDVLNHLVGAALMGFGGVMAMG
    CTIGQGVTGLSTLALSGFFTLGSIILGSALTMKIQYYKMLYDEEATFA
    KALITGLVDMKLLPGSLRKLEAL

    >gi|114320833|ref|YP_742516.1| rhodanese domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MTRPMTYQTLVDEALQQVPEVFPCELMEALEAGERPLLLDVREPDEFRALHIPGSLHVPRGVLEPAAEEGYEETEPELVA
    ARDRVVILI
    CRSGRRSALAGVNLQRMGFARVRSLKLGLKGWNADGGPLQDHEDRPLDDDEAEARLDAGAEGGAR

    >gi|114320841|ref|YP_742524.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Alkalilimnicola ehrlichii MLHE-1]
    MLRAGLPLLVLLSLAALLWVGLGLNPRAIPSPLIDREAPAFHLPDLQDPTRTVSRDDLLGRVTVVNVWASWCTSCRQEHP
    VLQQLADRGVHLIGLNYKDDPAAARELLAEAGNPYARTARDGDGRAGIDWGVYATPETFVVDREGVVRHKHTGPLTAEIA
    REQILPLIRELEATP

    >gi|114320933|ref|YP_742616.1| methionine-R-sulfoxide reductase [Alkalilimnicola ehrlichii MLHE-1]
    MGRLEVREFHRVTGRAWDLGTLAHDPAFWRAHVPHAAWRILFRGGTERPFSSPLDERYEDGTYVCAACHLPLFSSDTKFD
    SRTGWPSFYQPFPGHVGTKQDRLLWMVRTEYHCIRCRGHQGHVFEDGPAPTGRRW
    CNNGLALRFAPATGHADDEERATAL
    FAGG
    CFWCVEEAFDGGGQFCDRSTFYPAEEYHQNYYQKNPLRYRFYVTRCGRYARLDQLWGSEARPGKD

    >gi|114321026|ref|YP_742709.1| heavy metal translocating P-type ATPase [Alkalilimnicola ehrlichii MLHE-1]
    MSGQKCFHCGEQVPPGEDRTVTVNGREEPVCCTGCHAVANMILGSGLEKFYQVRTSAGARPDDEAVASSPDQWSAYDRDE
    VQRDFVRIGDGPREGSFLVENLY
    CAACGWLIEHLLSQVDGVLDVRVNAATGRAIIRWEQERAPLSFLLREMARLGYRAHP
    LRADKVRSMADQERRKALRRLIVSGLGTMQVMMLGIGLYLGDYYGMDAVHEQFLRLVSLLVATPVLFYAGAPFFIGAYRD
    IRARTVGMDVPVSLAIGITYTASLWWTLTDGPKVYFDSVVMFIFFLGVARFAEMAARHKANETTDALARLIPSNATRVTE
    QGEEQVPVADLRTGDILLVRSGETVPADGELIWGEGNLDESLLTGESMPQSRGEGERLVGGSLNTAGVFRMRVEALGQDT
    VLSSISRLLARAQADRPRLARVANWVAARFISVVLVAAVGVFAWWWQHDPVQAFPVLMAVLAATCPCALAMATPMAIAGG
    TNRLARSGLLITQRDALETMTKVGHVVFDKTGTLTRGELRVERIELLTDEPGLDETRALALAGGLERHSEHPIARAFDGH
    GQRLAFDDVEAVRGDGVRGALDGDEYRIGLPRFACDQAVGEGEPSDEGSWVVLARNGQPLARFQLADRPREDAAELVAAL
    KARGLTVELASGDHPAVVEAVARRLGIDRWQARMRPDDKLARIREIQAQGVKVAMVGDGLNDAPVLAGADVAIAMNTGTA
    LAQTSADMVLLGERLTPVERGFHWAHQSRRIMIQNLTLSACYNFSALPLAAVGFLTPWMAALGMAGSSILVILNASRLSR
    GQRPVAACPVPVGRGKIQAQPVPGRS

    >gi|114321048|ref|YP_742731.1| thiosulfate sulfurtransferase [Alkalilimnicola ehrlichii MLHE-1]
    MAEALPLVLEPARLQEALAQRDGLLVVDLSDGNDYREAHIPGAVHLDFPHLLRQVPPAMGLLPDLRTLSAVLSGIGLTPE
    THVVACDRNGGGRAGRLIWTLDLLGHPHRAWLNGGVTAWAGEGRPLEGGVVTPRHSDYRAELRHPEYRADCAWVLAHLDS
    PSVAVLDSRSAPEYRGEDVRAMRGGHIPGAANLDWLETMDRGNHLKLLPDERLRAMLAERGIQPEQEVVTH
    CQTHHRSSH
    AYVMLRHLGFDRVRGYDGSWSEWGNRTDTPVEK

    >gi|114321089|ref|YP_742772.1| redoxin domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MLKPGRAGRRNAWRATQRVNQGADTMVRTESTMMPLGTAAPDFTLPSTEGGEVSLEQVRGGRGLLVAFICNHCPYVKHIR
    GGLAAFARDYASKGINTVAISANDIEAYPQDNLEAMAEEKRVAGYDFPYLLDETQEVAKAYGAACTPDFFLFDADLKLVY
    RGRFDAATPGNDQPVDGRDLRAAADALLRGETLPEEQQRPSMGCNIKWKPGNEPAYF

    >gi|114321186|ref|YP_742869.1| methylated-DNA--protein-cysteine methyltransferase [Alkalilimnicola ehrlichii MLHE-1]
    MTSPWRCTLETPIGRLVLSGDDRALNGVAWVEGADGHSESCRHPLAERACTRLSAWFADPRTPLDLPLAPSGTPYQQRVW
    SLLRTIPAGQSQTYGELAERLGSAPRAVGGACAANPLLLLIP
    CHRVVARQGLGGFSAGVGREGSLALKRWLLDHESSLRS


    >gi|114321188|ref|YP_742871.1| methionine-R-sulfoxide reductase [Alkalilimnicola ehrlichii MLHE-1]
    MVEVEKSDAEWRAQLTDEQYAVCRQGGTEQPFSGAYYHCKEPGTYHCVCCDAPLFSSRAKYDSGSGWPSFWAPISDDHLR
    ILEDRSLGMVREEVRCARCDAHLGHVFPDGPMPTGLRY
    CINSVCLDLKRSG

    >gi|114321394|ref|YP_743077.1| OsmC family protein [Alkalilimnicola ehrlichii MLHE-1]
    MKASVKWLGNAAFEAETGSGHTLVMDGPADAGGENRGPRPMEMLLLGTAGCSAFDVVHILQRGRHPVADCQVRVEAERAE
    QPPKVFTRIHLHFQVAGEGLSEKAVARAVQLSAEKYCSASIMLSKAAKVTHSHELV

    >gi|114321611|ref|YP_743294.1| glutaredoxin family protein [Alkalilimnicola ehrlichii MLHE-1]
    MSENREGQRVPEVVFRTRKDGEWVDVDSRDLFNGRTVAVFSLPGAFTPTCSSTHLPRFNELAPVFFENGVDEIVCISVND
    AFVMNEWARDQHAENITLIPDGNGEFTEGMGMLVDKTDLGFGKRSWRYSMLVKDGVIEKMFIEPQKPGDPFEVSDADTML
    RYINPEAPHPEFVTLFAKAG
    CPHCARAKALLESHQMAYEEITLGEGVITRSVRAATGSGSVPQVFVDGRLIGSADALEAF
    LTQRRQAA

    >gi|114321627|ref|YP_743310.1| redoxin domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MTTIQVEQPVPDFHAEATGGDPVTLAGLRGQWVVLFFYPRANTPGCTLEGQDFRDLHDDFRKAGAVVLGASRDKLRTQEN
    FKAKHGFPYPLLADPNESLCEQFGVMKDKNMYGKKVRGIERSTFLIDPSGVLRREWRKVQVKGHAQEVLETLRSMQ

    >gi|114321681|ref|YP_743364.1| NADPH-glutathione reductase [Alkalilimnicola ehrlichii MLHE-1]
    MEPHYDLLVIGGGSGGMATARRAASYGAKVALVERSRLGGTCVNVGCVPKKVMWSAAHTADALHRAADYGFRVGPATLDW
    AELKRRRDAYIRRLNGIYERNIDKSGITLLTGEARLADARTVEVNGERYTASHILLATGGRPSRPDIPGQELGIDSDGFF
    ELAQQPRRVAVVGAGYIAVELAGVLHHLGTQTDLVVRREAALRSFDPLVRDSLLEAMDQDGITLQTHSVPKALERADDGT
    LTLALEDGRHIGGYDQVIWAIGRDLCTDGLGLEAAGVARNADGSIPVNAYQETNVQGVYAVGDIIGHHPLTPVAIAAGRR
    LADRLFGGQADRHLDYRYVPTVVFTHPPIGTVGLTEPEARAEYGDDEVEVFTTRFVAMDYALGEDKRRSAMKLVTVGDNR
    RVVGAHLFGVGSDEMLQGFAVAIRMGATKQDLDDTVAIHPTAAEELVTLPG

    >gi|114321726|ref|YP_743409.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Alkalilimnicola ehrlichii MLHE-1]
    MATITLGGEPIQTCGDLPAVGSTAPDFTLTDVDLKDVSLADFRGRKVLLNIVPSLDTGVCSTSAKKFNDAAKERDNLVAL
    TISADLPFAQKRFCEAEKIDRVKTLSMMRDRHFAKDYGVLVETGPTAGICARAVVIIDEQGQVRYTEQVPEISQEPDYEA
    ALKALD

    >gi|114321754|ref|YP_743437.1| dihydrolipoamide dehydrogenase [Alkalilimnicola ehrlichii MLHE-1]
    MANSYDVIVIGAGPAGYVAAIRCAQLGMTTAVIDEFRYKDGKPQPGGTCLNVGCIPSKALLDSSEHYHKAKDGGLSVHGI
    TAKDVSIDVKKMIARKDKVVKDLTGGIHQLLKANKIDFKTGHGKLISNSTVEFTPHEGKAEELKGEYIILATGSKPIDIG
    AAPADEKDILTSNGALDMEAVPKRLGVIGAGVIGLEMGSVWNRLGSKVVLLEAQDEFLAPVDRQVARMAHKAFTDQGLDI
    RLGCRVTDTKVGKQVSVHYEDKDGKHTLQVDKLIVSVGRRPNTDGLAADDVDLLLDERGFVHVDDECRTNLPNVYAVGDV
    VRGPMLAHKGSEEGVMVAELIAGHPGHLNYDTIPWVIYTHPEIAWVGKTEAQLKSEGVPYKSGTFNFAANGRARAMEEST
    GMVKIISHAETDRILGVHMVGAATSELIAEAVVAMEFAGSAEDLARICHAHPTLSESVHEAALAVSKQAIHKAN

    >gi|114321881|ref|YP_743564.1| rhodanese domain-containing protein [Alkalilimnicola ehrlichii MLHE-1]
    MVCNSRHHREGKGWRRSGTVPALVVCGLLLSGLLIPGVAATVDDADDPIWHHPHINAEGYRYARYRAATPDSVPEGETVD
    TGRAQALWAAGEVVAIDVMPVLERKGPDGKPEWVVLEERRHIPGSIWLPNVGAGRLSPEMEAWFADALAELTAGDSNQPL
    LFYCITD
    CWMAWNAVRRAAALGYTSLYWYPPGADGWQRAGLPTEPAQPKPRH

    >gi|114321997|ref|YP_743680.1| DSBA oxidoreductase [Alkalilimnicola ehrlichii MLHE-1]
    MKPMRLLSALFLALLALPALAADFEAGRDYHVFDEPRRTTSGDQVEVTEFFAYSCPACRRFNGPLHDWYQQTERDVSLVR
    VPIPLRPQDQAHVRAYFTAQALGVVDEVHDDIYVALHDQGRALVSQGEVRDFFAERGVSPEAFDEAWDSRAVQTRTRRAM
    ALARDYQVRSTPTVAVDGRYRITGGQAGSQARMIEAIEYLAGEREAARAAE

    >gi|114322006|ref|YP_743689.1| disulphide bond formation protein DsbB [Alkalilimnicola ehrlichii MLHE-1]
    MGDWLLRRRGLALLLVLTLLLNLGALGLEYLADMPPCPLCWVQRGVFGLMSLVALVGLVYFPRGWGRWPLAGALGLSALT
    GVIIALRHLYIQANPDAVS
    CGMSPEVLAQFLPWWEVLLEILSGTTDCTQVDAVLGVPLPGWTLVGYLALGALGLYAVLAR
    RA