Erythrobacter litoralis HTCC2594 uid58299

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|85372895|ref|YP_456957.1| glutathione S-transferase [Erythrobacter litoralis HTCC2594]
    MPTLYTMPGTCSLAANIAVAWTEAPISVRNMEYGDHKKDDYLAINPKGKVPALQFDDGEVLTELAAILSYIGAAHGTAGY
    ARDTKLGRKEAEALSYMISEVHAAYGPHFAAQNFAESEGAQHEVKQGAYHRLRGHYEWMEERLSDSGGGFYLGEKSFADA
    FLYVLTRWIDQTPLSLSDYPQLAEFRNRMEQDKGVQNALEQQAMEPMG

    >gi|85372897|ref|YP_456959.1| mercuric reductase, putative [Erythrobacter litoralis HTCC2594]
    MKFTHDVIVIGGGAAGLTAAGGCALFGLKVALIEGHKMGGECLNNGCVPSKALITAAKRAAEARKQKRFGVELAAPNVEW
    SGVHTHIHRAIAEIEPHDSAERFEEMGCEVIQDWARVTGKQSVEIGGRTLTAPRIVIATGSGPSVPPIPGLDAVPYLTNE
    NIFDLEAQPDHLVIIGGGVIGMEMAQSFARLGSKVTVIEPGRPMGRDDEDSVAVVMEVMKKEGVTFVQGKAEKVEGRNGA
    ITVHVDNGEQVSGSHLLIAVGRKARVSGFGLEDLGVELGNNGIKVDERRRTSVKNIYAIGDCREGPRLTHVSGYEGSNVA
    LEITLGIPTKVDYKALPWCTYTEPEVAQIGLTEAEAKEKFGDKVTVVKEGFDHNERAITEGDTKGHMKVILKGKKVLGAS
    IVGKNAGELLLPFSQTITGKSSTFAMGSAIVSYPTRSEITKAAAFAAWEPTVFGAIPKKYAGFVAKVRRAFA

    >gi|85372898|ref|YP_456960.1| hypothetical protein ELI_00355 [Erythrobacter litoralis HTCC2594]
    MNIENSRDYYGKVLQGSEDLKTDACCTAEAPPPAILSAMMNVHEDVRARYYGCGLVAPQAIEGCHILDLGSGSGQDAYIL
    AQLVGEHGSVTGVDTTPEQLAVASEHLEWHRERFGYAKSNVSFVEGDIEKLDQLSLPGGHFDVIVSNCVINLVADKQAVF
    AAAHKLLKEGGELYFSDVYADRRVPHHLQNDPVLHGE
    CLSGALYWGDFLAQAKAAGFADPRLVTSRPLGIGDAGVAAKLD
    GISFYSATYRLFKLGELEMQCEDYGQAVRYKGTVAHQPRVFELDGHHHIETGRLFPI
    CGNSWKMLANTRFAEHFEFFGDF
    SQHYGVFPDCGVSVPFGADEGSVPATAAACC

    >gi|85372905|ref|YP_456967.1| arsenate reductase [Erythrobacter litoralis HTCC2594]
    MTNAIDHSKGLTIPMKATIWHNPKCGTSRKTLAILENLSKVELTVVEYLKEPPTADKLRQLYTDAGIVPNEGLRLRGTDA
    EERGLPDADAESVLAAMVADPILINRPLVETEKGVRLCRPQDTVLEIL

    >gi|85373007|ref|YP_457069.1| thiol:disulfide interchange protein DsbC [Erythrobacter litoralis HTCC2594]
    MNFSHHRPGLKARAAHISLAAASAAALLTSGVAVLTAMPAQAAIARDVVQALKLRLPKTPIDALDCTSLAPWCEVVSGET
    LFYTDEAARYLFVGRLYDLEERRDVTATRLLELNPDLLAAGAARAAGRAEASHSEAAPAPAKTKVDLSQLPHEGAIRWGN
    PKGPRLVVFSDFQ
    CGYCKKLTGALEQAGVLVEERPISIFGAASRRLSESVLCASDPVAALHAAYTGKHVPRPASCKAIRA
    LDANEAFAKANGFAGTPVIVRASDGAVMHGYRDAATLNRFANQRAGAGQ

    >gi|85373208|ref|YP_457270.1| thiosulfate sulfurtransferase, putative [Erythrobacter litoralis HTCC2594]
    MDALVSTDWLAGQFGSPDLVVLDASLHLPQAGRDAEAEFEKGHIPGARFLHLAALHDPASSLPGKIPEPDALAERLSALG
    AEPESRIVLYDDSALRTACRAWALLRFAGLEKIAVLDGGFAKWRSENRAIETGPGECGHGAAPDLHVERARLRDKAQMLA
    NCADSAEQVIDARDAGRFAGTVEDTVHNLPGGHIPGACNLPFTALFREDGTFKPENELRTAFEDAGIDLSRPIVTS
    CGSG
    VTASVLIFALHLLGIEDAALYDGSWSEWGADPETPKATGVAG

    >gi|85373235|ref|YP_457297.1| thiol:disulfide interchange protein, putative [Erythrobacter litoralis HTCC2594]
    MSLTLAIVLLALAGCDRAAPDPAQGEGALGAEKASLAGEVDRSRAGELMPAETVRLPDGTQLNLGALQGQPVLLNLWATW
    CAPCKKEMPLLDELALERDGELRVLTVSQDLQGAEKVLPYFEQAGFQALEPWLDPHNGLGQHYDAGLPMTVLYDANGQEV
    WRIAGDYDWSSAEAAGLIDEGIGT

    >gi|85373483|ref|YP_457545.1| glutaredoxin-related protein [Erythrobacter litoralis HTCC2594]
    MSDTNAKISGIVGENDVVLFMKGTPLFPQCGFSSRAVSILDHCGVKYESVDVLQDMEIRQGIKTYSDWPTIPQLFVKGEF
    LGGSDIMMEMFEAGELQELLDEKDVARAE

    >gi|85373602|ref|YP_457664.1| cytochrome c biogenesis protein [Erythrobacter litoralis HTCC2594]
    MNKLLIWGPLALFLFFAGVAGYQLTQPKDETVRSAMVGKPLPAFDLPAYDPAGEGDGPARITDAIFRDGRPKLLNVWASW
    CLPCIAEAPQLEALEQMGVEIVGVAIRDKPEDIAQFLARHGNPYTAIARDDISEVQLGIGSSGVPETFVIDGEGVIRYQH
    IGDIRPEHISDLLRELEAAG

    >gi|85373635|ref|YP_457697.1| hypothetical protein ELI_04040 [Erythrobacter litoralis HTCC2594]
    MMSLADRWRAIAATLANKGFTEQQGASPEFRGSINVHGRAVDIELVIPDSKFVELPIVRLVDRKQLPAGAFGHISRDDIE
    GSVVCFAPATGLPLDFHDPGGSVLRVLRQTELSLEKSFAGQGGAEVAAEYQEYWIEKEPNFRVLVSRDGTTERQSGLQYA
    VFKPATGSPFFAIADTISLHDHEATRLSGAVIFHLDAELGPTADRVVPNNFLSLEQWFRAQTTVVADRWRECERALLSGK
    FVCLAANNCTLGVRIELPANIAMAVRTKKLRSSKLQPLLAKQKTKLDIKRSGGYWTGLAEIAQRNLHGIKTLDGKAIALV
    GCGTLGSHLAKFLIQSGAGAGAPLTLIDGQVLSAGNIGRHYLGHSRIGERKASALAEELRSFHPQCDIRATVGDALAQKA
    VLADSDLLVDATGDWNTQYALNELFYEDDISAEAILHCWISGNGAAVQAFLNVRGDDCCFRCLRPSMDAGPRFPALKPGV
    EANMAPAT
    CGDGNYIPYSVAAPAIAAGLACDMAIGWANDKPGARLRTIVLDHERGIERKPTSPSAHKTCPSCLSRDES

    >gi|85373696|ref|YP_457758.1| hypothetical protein ELI_04345 [Erythrobacter litoralis HTCC2594]
    MNYSNQRPGLKARAAHISLAAASAAALLTSGVAVVTAMPAQAAITQNVVEALKLRLPKTPIDALDCKTFAPWCEVVSGET
    LFYIDEAARYLFVGRLYDMEERRDVTAARLLELNPDLLAAGAARAAGEDTAGRHDVAEPRDRRAATHVDLKVLPAVGAIL
    WGNPKGPKLVVFSDFQ
    CGYCKRLTGELEKAGVLVEERPISIFGASSRRMSEAVLCAADPVGALHAAYTGKHLEPRAACKK
    AAALDANEAFAQANGFAGTPVIVRARDGAVLHGYRDAKTLRAFANAKTGLKQ

    >gi|85373707|ref|YP_457769.1| peroxidase [Erythrobacter litoralis HTCC2594]
    MTLSIGSTAPDFTAETTQGTITFHDWMGDNWAILFSHPKAFTPVCTTELGYMAGLGEEFAKRDTKILGLSVDSSQDNRDW
    LPDIEAVSGNKVDYPVVGDSDLKVAKLYNMLPAEETGSAEQRTAADNATVRAVYIVGPDKKIRAMLLYPMSSGRNFEEVL
    RLLDSVQLTESKGVATPVNWQSGDDVIIPPSVSDKEAKARFPQGFTTLRPYLRTVKID

    >gi|85373736|ref|YP_457798.1| hydrolase [Erythrobacter litoralis HTCC2594]
    MFLEKIKTPGLSHLSYIIGSGGKAAVIDPRRDCEVYVEKARAEGLEITHIFETHRNEDLLSGSPILANLTGATVYHGPNA
    AGEVIFARTAREGDCFELGQLKIEVLETPGHTDDHLAFVIHDSEYSEGPVGVFTGDALFVGDVGRTDFYPERKEEVAGLL
    FDSLQKLCGLGDQAIIYPAHGAGSVCGSGMADREFSTIGHERRNNPRLRISDRDEFIEAKVAEHHYQPPYFRLMERLNLA
    GSDAAPRVMRPRRLGLEDLSESGADHLVDVREPLAYAAGHLPGAMCLPVGMIPAFAGWFLGEGDRIALIASEEGQLAQAM
    AHLVRIGLDNVVGGYVGVVPAAAQGKAMRSIPMIGTEEVARRLDQDSGEWTLLDVRDADERQEASIDGSGHIYVGELNTR
    WEELDRDRHYTLM
    CASGMRASVAAGWLASKGFEHLDIYLGSMGAWTNASG

    >gi|85373741|ref|YP_457803.1| hypothetical protein ELI_04570 [Erythrobacter litoralis HTCC2594]
    MERFMTTRTAAVYRMVMEDHVCPYGIKTVDLLTRQGFEVEDHHLTSREETDAFKDKHNVETTPQTFIEDKRIGGYDDVRE
    FFGKSRSQPEEGETSYQPVIAIFAVALLLALGLSWAFFDDLFTVRAAEWFVSLSMTLLAVQKLQDVRSFSTMFLNYDLLA
    RRWVPYGFVYPFGEAAAGILMTAGALTWLSAPLALFIGTVGAVSVFKAVYIDKRELKCACVGGSSNVPLGFVSLTENLFM
    IGMGLWMGAKLLA

    >gi|85373767|ref|YP_457829.1| thioredoxin reductase [Erythrobacter litoralis HTCC2594]
    MTTHRTKMLIIGSGPAGYSAAIYGARAMMEPIVVQGIQPGGQLTITTDVENYPGFEEVIQGPWLMEQMQKQAEHVGTRMM
    WDTIVDVDIENGSPFRAVGDSGDEYIGDVLIIATGAQAKWLGVPGEQELGGKGVSA
    CATCDGFFYRGKKVAVIGGGNTAV
    EEALYLTNHSDDVTLIHRRDELRSEKILQERLFKSDKISTLWNKTVESFEAGEDGMLSHLVLKDTQTGELSNLEVDGAFV
    AIGHAPATELFKGKLPMDETGYLLVEPGTPKTAIPGVFAAGDVMDHIYRQAVTAAGVGCMAALDAERFLANLEIDIDGHV
    HAPQTEAAE

    >gi|85373803|ref|YP_457865.1| pyruvate/2-oxoglutarate dehydrogenase complex [Erythrobacter litoralis HTCC2594]
    MAEYDYDLFTIGGGSGGVRASRVAAAHGARVAIAEEHRIGGTCVIRGCVPKKMLVYGAHFAEDLEDCQKFGWEIEGKSFD
    WIKLRDNVLADVDRLEDAYTDTLESHDVAIFKERAEITGDHEITLASGKTVTAKYILIATGARPRLPECAGVEHGITSNE
    AFHLDELPKKVIIAGGGYIANEFAGIFNEFGSKVCIVNRGDQLLRGYDEALRDRLLQISVMKGIDFEFNTVFEYIKPCED
    GGYFVKLKNNDEERVDLVMFAIGRVPNTEKLGLDTVGVALGDNGEIKVDEFSKTSVNYIYAVGDVTDRVQLTPVAIREGQ
    AFADSVFGPNDPYAVDHSCIASAVFSHPPIAAVGMTEGEAKNKLGSVRVYQSDFRPMKNVLAQRNERSLFKMVCEGDNDR
    IVGIHMIAPDAPEMMQAAAIAVKAGLTKADFDATTAIHPTMAEELVLMK

    >gi|85373834|ref|YP_457896.1| AhpC/TSA family protein [Erythrobacter litoralis HTCC2594]
    MSISKGDTLPDVTLVKPTDAGPEQVKSSEFFAGKKVALFAVPGAFTPTCSAKHLPGYVEKAEELKAKGVDEIAVTSVNDP
    FVMGAWQKADGSDEITFLADGNGEFAEAIGLTMDGSGFGLGTRSQRYSMIVEDGKVTELNVEAPGDFSVSSAEHMLGQL

    >gi|85373842|ref|YP_457904.1| thiol-disulfide isomerase [Erythrobacter litoralis HTCC2594]
    MATVNVTDASFKADVLESDKPVLVDFWAEWCGPCKMIAPALEEISEELGEQVTIAKMDIMENTDTASEMGVQSIPLMVLF
    KNGEAVARKVGAAPKSQLKDWIESEI

    >gi|85373988|ref|YP_458050.1| hypothetical protein ELI_05805 [Erythrobacter litoralis HTCC2594]
    MSKTAKLYRMVMDKHVCPYGTKSKWLLESQGFDVEDHHLTTREETDAFKEKHGVETTPQTFIDGERIGGYDALRKHFGKE
    KDTGGKSYRPVLAVFAVGLALALSLSQFAFGTPFTIRSVEWFVAFSMAMLAMLKLQDVEQFSTMFVGYDLLGQRWVPYAY
    LYPYLEATAAVLMAGRVLPWISIPVAFTIGTIGAVSVFYAVYIQKRDIKCACVGGSGDVPLGFISLSENLAMVGMAVWML
    LRPTL

    >gi|85374019|ref|YP_458081.1| hydrolase [Erythrobacter litoralis HTCC2594]
    MPTEQLKITTDAGHELSGSLELPTGLVRGAALFAHCFTCTKQSKAAVEVTRALAREGIATLRFDFTGLGGSEGDFGRAGF
    ASDIDDLLASARALCERFGDGILLVGHSLGGAAVLAAAGMMARGKVAAVATIGAPSDVPHVLHNVEGDIDAIERDGEGDV
    TIGGRPFKLSKDFLDKTREADLLERVKALRVPLMVCHSPTDEIVGIDHASNLFLAAKHPKSFISLAGADHLLTKVEDAGF
    VASVIASWAHRYLPMKADWPMPQEGVIVCTGHGKFGTEVHTTGHRFVADEPKSYGGNDTGPTPYDLLNAALGT
    CTAMTMK
    MYADRKGLPLEGVSIHVTHERDHVEDCDHAHAMEEGEQIQSLNRAITIRGDDLTEGDRSKLVEIADKCPVHRTLEGHLHI
    HTERTE

    >gi|85374051|ref|YP_458113.1| hypothetical protein ELI_06120 [Erythrobacter litoralis HTCC2594]
    MLKPGQKVPDLELPLTIDAKFQLSAQSPDAFTMLVFYRGKHCPICKKYLTELSGKLDDFTKRGVNVFAVSMDNEERAQVV
    HRKWETGDVPLAWNLSEEQAREWGLYISEKRPDSDEPEMFSEPGLFLVRPDMTLYFAETQSAPFTRPPLDELLQAVAFIQ
    EKNYPARGTLT

    >gi|85374056|ref|YP_458118.1| pyruvate dehydrogenase complex, E3 component, lipoamidedehydrogenase, putative [Erythrobacter litoralis HTCC2594]
    MAENYDVIVLGSGPGGYVAAIRCAQLGLKTAIVERELLGGICLNWGCIPTKALLRSAEIKHYMEHAKDYGLKVAGEIEAD
    LEAVVKRSRGVAKQLNQGVTHLMKKNKIAVHMGEGTLTGPTSLTVKGEKGEEKLSAKHVIVATGARARDLPFAPADGKRV
    WTYRTAMTPPEMPKKLLVIGSGAIGIEFASFYNDMGAEVTVVEMLDRIVPVEDHEVSAFLEKSLGKQGMTILTGAGVEDL
    KVSAKGVKAKIKTKDGKTGEHDFTHAIVAIGIQPNTENIGLEKLADMDRGFIQIDPYGRTKSKGLWAIGDCTPGPWLAHK
    ASHEGVTAAEAIAQELGKDGLHPHPLNRDAIPGCTYCHPQIASVGLTEAKAKEAGYEVKVGNFPFIGNGKAIALGEAEGF
    TKTVFDAETGELLGAHMVGAEVTEMIQGYTIGKTLETTETELMQTVFPHPTISESMHESVLGAYGRALHI

    >gi|85374117|ref|YP_458179.1| glutaredoxin [Erythrobacter litoralis HTCC2594]
    MSEPKVDIYTKFGCGYCVRAKRLLDEKGVDYEEFDITMGGPKRDEMRERAPGAMTVPQIFIGDTHVGGSDELHALEREGK
    LDPLLAG

    >gi|85374225|ref|YP_458287.1| glutathione peroxidase [Erythrobacter litoralis HTCC2594]
    MTTIADFTVTTNRGEELDLAEKKGKVLLVVNTASKCGFTPQYDGLEELYQQYKNQGFEVLGFPCNQFGAQEPGSADEIAE
    FCKVNFGVTFPLMEKVEVNGPDASPVFDWMKGEAEGLMGSTGIKWNFTKFLIDREGNVVKRFAPQDSPSSIARHVEKLL

    >gi|85374429|ref|YP_458491.1| 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase [Erythrobacter litoralis HTCC2594]
    MADHSFDYDVLVIGAGPGGYVAAIRAAQLGLKTACAEGRETLGGTCLNVGCIPSKAMLHASEYFDAAANGTMESMGIEVK
    PKLNLDKMHGQRLDAVDGLTKGIEFLFKKNKVDWKKGYATFQDAHTVKIGDETVTAKDIVIATGSSVTPLPGVEVDNAKG
    VVVDSTGALELAKVPRKMVVIGGGVIGLELGSVWRRLGAEVTCVEFLDEILPGMDGDIRKESRKIFKKQGIEFKLKTKVT
    GVTVKGKKAHLTLEPADGGDEETMEADCVLVSIGRRPNTEGLGLDSIGLDVNKRGQIETDHDFRTSVEGVWAIGDVVPGP
    MLAHKAEDEGIAVAENIAGQTGIVNHAVIPSVVYTLPEIAGVGLTTEQAIEAAGGDKTKVKVGKFPMMANSRAKTNHEPD
    GLVKVIADAETDRVLGIWAIASVAGTMIAEAGIAMEFGATSEDIAYTCHAHPTHAEAMKEAAMAVQGKPIHI

    >gi|85374502|ref|YP_458564.1| hypothetical protein ELI_08375 [Erythrobacter litoralis HTCC2594]
    MSGHPPITVAALYQFTRFDDPASVRAPLLAACEEAGIKGTLLLAREGINGTIAGSHNGIGAVLGHIRQLPGCAGLEVKFS
    GADELPFHRMKVRLKREIVTMGEPDIDPTLSVGHYVDPHDWNALISDPDTVVIDTRNDYEVAAGTFRGAVDPETKSFRDF
    PEWFRAHRAELEGKKVAMFCTGGIRCEKSTSFLRQEGIEDVYHLKGGILKYLEAVPEEETLWDGECFVFDERVTVKHGLE
    QGTHALCRACRRPVSLEDQQSQAYEEGISCPACIDERDEAQRARYRERQRQEELARKRGAAHVGAEFPPGE

    >gi|85374503|ref|YP_458565.1| hypothetical protein ELI_08380 [Erythrobacter litoralis HTCC2594]
    MSKLPILYSFRRCPYAMRARMALWIGGTTCELREVKLADKPAAMLEASPKGTVPILALHDGRVLDESLDIMRWALDQRDP
    EGWLAGDDTALVARNDGPFKHHLDRYKYSTRHDTDPLEHRAAGLVSLQDLDARLEYQPQLCGPKRTLADIALFPFVRQFA
    NHDRAWFDALDLPHLQSWLDGHLASDLFAAIMPKFAPWRDGDEPVVFAA

    >gi|85374539|ref|YP_458601.1| 2-hydroxychromene-2-carboxylateisomerase family protein [Erythrobacter litoralis HTCC2594]
    MTETDPRRMTIDIWSDVMCPWCAIGYGQLQKALGQLEGEIEADIRWHAFELNPDMPESGEEQAAHIQRKYNRTAEEGAAV
    RSQMRSIAEGAGVSLDYEGEGEAPPAMMWNTFAAHCLLTWALETAGPEKQTELKLALFRAHFNERRNIGQRDVLLDVAES
    VGLDRAGALAALNDMELAQRVRAEERKAWDLNISGVPAMVVEGKFMIPGAQPPETYVNVLRRVAEKTEA

    >gi|85374545|ref|YP_458607.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
    MIASRRLTAGMLAVAALATMGMMKNWVTEVERTEVSHIVGNPEAEGTLTEFVSYTCPACGNFARQGEEVVKLGYVGPGKA
    RLEIRHVQRNVVDIAATLLAWCGPKEKFLQNHSALMWQQDKWLTKAQQATQGQQQRWFSGAEAARYKAIANDLSLYELFE
    GRGYDRPQLDRCLSDTALAAKFRESTVADAETFGVRATPSFAIDGEFQSDVTGWSTLAPKLSEKF

    >gi|85374546|ref|YP_458608.1| protein-disulfide isomerase [Erythrobacter litoralis HTCC2594]
    MKELTIMTPFRRVVFATFAAPLALGLAACGDTATDEGVVEGEPVAEVPAPEGQQWADVTTVTDLQGHMIGNPDAPIKLVE
    YGSLT
    CGTCANFTQTGFEELRSEYINTGRVSFELRPLVLNPLDLVMVNLARCSSDEAVVPLSEQVWMNFQEVMGQAQQAG
    QAFEQAIGLPEEQRYVAAAEATGLLDFFAARGLSRDQARTCLQDVEKVKAIAERSAQQGEEFNVTGTPTFFVNGNKLADV
    YSWEALEPVLQRAGAR

    >gi|85374576|ref|YP_458638.1| ada regulatory of adaptative response protein [Erythrobacter litoralis HTCC2594]
    MTNQAISPDHAWAAVQRRDRSFDGRFVTGVLTTGIYCRPSCAARHPARENVRFFADGAEARAAGLRACERCLPDDIGRDE
    AAVLAAVDEIKASEGRPTLDELATLTGYSPSHFQRVFKRATGLSPAAYARALREERAKDALGEAKRVTDAIYDAGYEAPS
    RFYEGMQGKMGMSASDWKNGGEGREIHYAVIETSIAPMLVAATDRGVCCLSFNEGEEELRARFPKADLVEGSDKFRDLFE
    RVAAAVEQPGTGQDVPLDVKGTAFQQRCWQALREIPLGETRSYGEQAAMLGNPKASRAVGSANGANNIAVLIP
    CHRVVQA
    DGSIGGYAYGPEIKAELLRRESTRR

    >gi|85374654|ref|YP_458716.1| thiol:disulfide interchange protein [Erythrobacter litoralis HTCC2594]
    MFALLALLLAALAAVPAAAQGQNIRVALVAEGPVAPGGETTLAFKFAPVSEEWHGYWANPGDAGLPMQLEWDLPEGVSVG
    EPLYPTPKRLVIDGLMNHIFEGDYAVLLPLRLTEDYAGPDVLQVSVEAFYLACTDQICVPEDAQLQVSIPVGESTASGTE
    FAAFRSALAPLIDSTARFEQTASLLRLAIPLPAAVDPGEPHVFIANRDLVNYVQAQGFRRNGDWLIAEIPLARTGEQPET
    VEGIVRLGSGQGLRFVAEAGEVPSGDRVLMARDAELPSLWLLLGGALLGGLILNIMPCVFPILSLKALSLAKAGAGAQEA
    RMEGLAYTAGVILACVALGGAMLALRAAGEQVGWAFQLQEPGVVVALLVLASLITANLLGFFELPGLSISEGSTPRGAFS
    TGLLAAFVATPCTGPFMAAALGAALLLPAETALLLFAVLGLGLALPFLLLGFIPAFRRLLPKPGAWMETFRKVLAVPMGL
    TALALVWLVWRIGGVGFALSAMSIAFIATLAAVLFRGRNQRLRGAVTALGAVLMAVGVLASFESPTRAQAETVLASKPFT
    LAALDEARASGAPVFVYFTADW
    CVSCKVNERVAIEREATREAFEQAGVTTLRGDWTLRQPEITEFLNAQGVAGVPLYLWY
    DPGVAEPRQLQQLLGPDSLVTLAREAGPRAARRPEGRVRPLPRQAQR

    >gi|85374823|ref|YP_458885.1| regulatory protein [Erythrobacter litoralis HTCC2594]
    MAEAFDFVAIGSGTAAQVAVHQMANAGKRCAVIDYRPYGGTCALRGCDPKKMMVSGEEALAAYRRMKGKGIKGSVSIDWA
    DLQAFKRSFTDPVPEKQEARYERKGVATFHGAARFAGPDRIVIGDRELSFSHALIATGAEPRPLGIEGEELLIHSDAFLE
    LKTLPDRIVFVGGGYIAAEFAHLAARAGAKVTIFQRGRILKAFDPDTVDWLMPSFDDLGIEIVDAEVDRVTKKGSVLTVH
    AGDRRIEGSLVVHAAGRIPAIGSLDLEAGDVACDAGRLALTAQLRSQSNPKVFAAGDAAANGPPLTPVSSNDAKVVVENI
    LDDTGRTPNYRGVPSALFTEPPAARVGMLESEAREAGLDFTVHAGSHPGWFSARRLNEEIYGHKLLVENGTGRILGAHLV
    GPDADELVNIFGLAMRHGLNADDIKSTMFAYPTAASDAGYMLG

    >gi|85374908|ref|YP_458970.1| putative rhodanese-like protein [Erythrobacter litoralis HTCC2594]
    MRSLIVTAMAIAILGATPAFAQGAPVNPQIDYSGFMQLTLEVAPYRETRRVSLDDFMGKAGDEGAIILDTRSAEAFSQGH
    LKGAINLPFSDFTEEKLAKVLGANTSRPILIY
    CNNNFSDGVAPVATKRAPLALNIPTFINLYGYGYTNIWELADVVKIAE
    VEWVTSSSQT

    >gi|85374917|ref|YP_458979.1| alkyl hydroperoxide reductase (small subunit) [Erythrobacter litoralis HTCC2594]
    MGIIGSTIKPFKATAFKAGEDFCDVTDEDVKGKWAVFFFYPADFTFVCPTELEDLGEKYAMLQDMDVEVYAVSTDTHFSH
    KAWHDTSERIGKLTFPFLGDQNHQLARNFDVLREGVGLADRATFVVDPDGVIQLVEQTCEGVGRNANELTRKIKAAQYVR
    ANPGQVCPAAWEEGSETLAPSLDLVGKI

    >gi|85374918|ref|YP_458980.1| alkyl hydroperoxide reductase, subunit f [Erythrobacter litoralis HTCC2594]
    MLDASMKQQLQTYFANLREPIELVATLGEDDKSRQTRELLEEIADLHDLVGARFDGDAARTPSFTIQRADDTSRAVTFAG
    LPMGHEFTSLVLALLWGGGHPPKVEQDVLEQIRALEGPLDFEMFFSLS
    CHNCPDVVQALTLMALENPNISATLIEGGTFQ
    DEVDRRDVMAVPATFLNGEPFFNGKMSLEEVLAKVDSGADDKAAARLDAKEPFEVLIVGGGPAGVAAGIYTARKGFTTGI
    AAERFGGQLQDTLGIENLPGTAYTEGPKLANELEKQVGENAIDLMNLAEARKLVPAESKGGLHKVELANGATLKARSLIL
    ATGARWRELGVPGEAEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAKIVEHVTLIEFDSKLRADEVLQAKL
    ASLGNVELIKNAKTTEITGTNGRMNGLVYEDRASGESHTVELAGVFVQIGLVPNTEWLKDSGIALSEYGEIEIDEEGATN
    LPGIFAAGDCTTVPYKQIVVAMGEGSKAGLSAFDYLIRTAPAEEIAEAA

    >gi|85374941|ref|YP_459003.1| molybdopterin biosynthesis protein [Erythrobacter litoralis HTCC2594]
    MSLSPERLERFARHIVLPEIGGAGQAALIDKHIVLVGLGGIGSPALQYLAGAGIGRLTLVDSDTVDASNLQRQTLFSERD
    VGHGKAVSARRWVQNFDRSLRVTISDKRITADNAPDLMTSADLVLDGTDNFATRLAVSDACVAAQVPLLTAAVGRFQGQV
    AAFAGHLPNQPCYRCFVGDAFDAEDCDT
    CAEDGVLGAMVGWVGTFAAMQAVRVLLAGVSRFGDPQWGKLQLMDGLKPGMR
    AIAIPKDPGCKGCGEGR

    >gi|85374986|ref|YP_459048.1| periplasmic substrate-binding protein [Erythrobacter litoralis HTCC2594]
    MAHPRIVSLLPSATEIAVALGLGQNLVGRSHECDYPPSVKGLPVVTSTKLEKGLTSCQIDDRVQGIVRQGLSVYEVDTAL
    LRDLRPDLILTQSQCAV
    CAVTPADLEEALSEWTGTAPVLLSLAPDTLEDVWGDFAKVAEAAGLSERTSSVVDGLRRRMAG
    LAENRGRRIDRPSVAAIEWIDPLMAAGNWVPELIEAAGGRPLFARAGEHSPWLEWDDLIAADPELIVAMPCGYQLPKTLA
    DLGSLVDRSGWKDLTAVRKGKVFAVDGHHYFNRPGPRLVESAELIAQLLGTSSIRAFEMGRDWMVIGGD

    >gi|85375085|ref|YP_459147.1| peptide methionine sulfoxide reductase [Erythrobacter litoralis HTCC2594]
    MSNLQQAIIAGGCFWCTEAVFKDVIGVTEVESGYIGGHVADPTYKEVCSGTTGHAEGIRVTFDPDVVSLPEIYDMFLGTH
    DPTQLNRQGNDVGTQYRSAIFPLDDEQRQEAEAAIARWNESNGGTAVTTIEGPAEWYPAEDYHQDYWDGEGQRNPYCQAT
    IPPKLMKLRKSFAKYVKDDA

    >gi|85375097|ref|YP_459159.1| hypothetical protein ELI_11350 [Erythrobacter litoralis HTCC2594]
    MTDPKATPDSDWREKLTPEQFHVLREKGTERAFTGQYDKFYEDGEYYCAGCGAKLFESDAKYNSGCGWPAFTKPAEGEAV
    EEHRDVSHGMIRTEVTCANCDGHLGHVFPDGPQDQGGLRY
    CINSAALDFAKDDDASG

    >gi|85375098|ref|YP_459160.1| glutathione S-transferase family protein [Erythrobacter litoralis HTCC2594]
    MWRVYCFPLCPFSRKIRLLMSEKGIGYEIWRTDPWDAGEEFWDMNPAGRTPVVRDAVKDITLADSRAIAEYFEETVDKAP
    MINGTAKNRAEIRRLVALFDENFYHDVTMPLLHERMKKRLILRQPPDSRMLRDAMKMAHGHLDYIDYLVDTRPWLGGPQM
    SLADLAAAAQISVADYLGGIDWRDHAEAHSWYTTVKSRPSFGPLLSERMEVIQPPRHYALLDE

    >gi|85375129|ref|YP_459191.1| thioredoxin [Erythrobacter litoralis HTCC2594]
    MGLNIDEQKAVDKFRQQVVEPSMTKLVVLDFWAEWCGPCKQLTPVLEKVVGEYADKGVVLEKVNVDEEQFIASQFQVRSI
    PTVYAMFQGQPVADMTSARTESQVKQMLDQLLEKLPINADGGPDGAPQGPSEEEIKQFIAMGEQALSDGDAERAVGIFQQ
    VIEFAPTSIEAMSGYLRALIEAGHAEQAEAMLKEMPEDVAKDPAIERVKAALELSANKVDDSELAALKDKAAGGDMDARY
    AYAEAAFAAGQRDAAADELLAMIEADREWNDGAARTKLLQIFEAVGLEDEWVVATRRKLSKILFG

    >gi|85375294|ref|YP_459356.1| putative bacterioferritin comigratory protein [Erythrobacter litoralis HTCC2594]
    MSERPHEGDPMPDIVMETPDGGSVKPSDYAGRKLVLFFYPKDNTPGCTTEATEFSAAKADFEKAGCAILGVSKDSPKKHQ
    NFIAKHGLTVDLATDAQDAGLSDALEIWTEKKMYGKTFMGMVRTTYLVDTDGTIARVWDKVKVKGHVDEALAAAQSL

    >gi|85375317|ref|YP_459379.1| putative methionine sulfoxide reductase, SelR [Erythrobacter litoralis HTCC2594]
    MTKDPNRRQMLGWFGAGASLAALTACGVNPAQAKSFPVQKSEAQWRKQLTAQEFRILRQAGTERPYSSPLDDQERAGTFV
    CAGCNNRLYSSKHKFDSGTGWPSFWQPIGRGAVGTSTDYKLGYPRTEVHCADCGGHLGHIFNDGPKPTGKRH
    CINGVAMD
    FIPA

    >gi|85375333|ref|YP_459395.1| methionine sulfoxide reductase A [Erythrobacter litoralis HTCC2594]
    MKRGFPLFAAVGLALAGCGQVALAKENHVRAPAPKVTAAEKGSTQTAIFAGGCFWGIEAIFSHVKGVESAISGYHGGTAR
    SAKYSIVTSGVTDHAESVKVVYDPRVVSYDELVRIFFSVGADPTLRNRQGPDVGAHYRAALIPVNAQQRKVAAAYLRQME
    RSDVWSKPIMTKIESYKAFYPAETYHQDFMAKNPNHGYIRRWDAPKVRALKQFYPEHFRASFKRG

    >gi|85375355|ref|YP_459417.1| 27kDa outer membrane protein [Erythrobacter litoralis HTCC2594]
    MVRNALLVLAALVAGFAGAGIFSWSGLGDRHVERYLVANPDLLPQMMAALERKRAEDRLASVGGDVRTPYGGAVLGNPNG
    SKTLVKFTDYN
    CGYCRASAGEVQKMIAADPDLRVVIREWPIFEGSDIAARMALAAAKQGKYREYHLALFESGDTSMAGLE
    AAAQKAGLDLARLKNDAGSAEIGFELSRNAQFAQELGFTGTPSWVAGSRIIEGAVPAEALASALSESAASES

    >gi|85375375|ref|YP_459437.1| hypothetical protein ELI_12740 [Erythrobacter litoralis HTCC2594]
    MADTKTRPAPKAAVILTPAAEQRVADLMAKAPEDAIGVKLSTPRRGCSGLAYSVDYVTEEAKFDEKIETPGGVFYIDGAS
    VLYLIGSTMDWVEDDFTAGFVFENPNAKGACGCGESFMV

    >gi|85375416|ref|YP_459478.1| hypothetical protein ELI_12945 [Erythrobacter litoralis HTCC2594]
    MSETLTPAAEKIPALTEAAAARVRWIAEKQGKPAILRLAVEGGGCSGFQYKFELADAPEDDDLQSETEGVALVVDPVSLE
    LVEGSTVDFVESLGGAAFQVTNPQAAAGCGCGSSFGI

    >gi|85375477|ref|YP_459539.1| disulfide bond formation protein [Erythrobacter litoralis HTCC2594]
    MTETASQKLARQLALAIPALLLGGAYIGEFAFGLYPCEMCWWQRWPHFAALGFGLLASFFRPNTFWIALAAIAILVSGAI
    GAFHAGVEYGWWQGITA
    CTAAIEAGGDPLEAIMNAPIVRCDVAPWSFLGISLAGWNFVISTLVGLVILFLLARNDTEADQ
    GIAAA

    >gi|85375641|ref|YP_459703.1| osmotically inducible protein C [Erythrobacter litoralis HTCC2594]
    MKTTNTGSATYEGLGKSGKGLVSTGSGALSAQPYGFQTRFEDEPGTNPEELIAAAHASCFTMALSFKLAEEGFENGTVTT
    SAEVTLEKDGDGFTVTKSALATKGKVAGLAQDRFEELAADAKAN
    CPISKLLDAEITLKTAFEG

    >gi|85375732|ref|YP_459794.1| hypothetical protein ELI_14525 [Erythrobacter litoralis HTCC2594]
    MTIHLYGIPNCDTVKKARKWLDAQGLEYDFHDYKKEGAERAKLERWADAVGWEVLLNRRGTTFRKLDDADKADIDRDKAI
    ALMLEHTSLIKRPVAEHEDGERILIGFNDSEWENAWC

    >gi|85375794|ref|YP_459856.1| disulfide isomerase [Erythrobacter litoralis HTCC2594]
    MNYNDHRPGLKARAAHLALACSGAAALLTLGVSAVTAIPASASSLAGDVAQALKLRLPKTPIDTIDCDRLGPWCEVVSND
    TLFYIDETARYLFVGRLYDMEERRDVTAARLLELNPDLLAAGAPRAGGEAQGGPNKTPTKAATTRVDLSTLPEDGAIHWG
    NPKGEKFVVFSDFQ
    CGYCQRLAGELAKAKVHVEERPISIFGAASRKLSEAVICAKDPAKALHAAYAGQAPANGKSCSRAK
    ALDANEAFAKANGFNGTPVIVRARDGAVLHGYRDAATIRRFAAGAKGSGQ