Erwinia tasmaniensis Et1 99 uid59029

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188532188|ref|YP_001905985.1| periplasmic protein disulfide isomerase I [Erwinia tasmaniensis Et1/99]
    MKKIWLALVGMVLAFSASAAQFTNGQQYVTLDKSVTGEPQVLEFFSFYCPHCYEFERVWHVSDTVKKNLPANVKVTKYHV
    DFLGGDMGKTVTQAWAVAIALGVEDKVTAPIFEGIQKTQSIMDPATLKEAFVKAAGIKPADYDAAWNSFVVKSLVAQQEK
    AAADMDLRGVPAMFVNGKYMVNSGGLDTSSMDNYVQQYANLVNFLITQK

    >gi|188532249|ref|YP_001906046.1| hypothetical protein ETA_00880 [Erwinia tasmaniensis Et1/99]
    MQDIMQFAGNHTILALAWVVLLVLVIVTTVKGMFSKVKVISRGEATRLINKEEAVVVDVRGRDDYRKGHISNAINVLAAD
    IKKGNFGELEKHKAQPLIVA
    CATGTSAVESAAQLNAAGYEQVFVLKDGVSGWSSENLPLVRGK

    >gi|188532250|ref|YP_001906047.1| glutaredoxin 3 [Erwinia tasmaniensis Et1/99]
    MATVEIYTKATCPFCHRAKALLDQKGVSYQEIPIDGDAALREVMIKRSGRTTVPQIFINAQHVGGCDDLFALDGRNGLEP
    LLK

    >gi|188532297|ref|YP_001906094.1| Putative peroxiredoxin/glutaredoxin family protein [Erwinia tasmaniensis Et1/99]
    MFASQEGKSIPQVTFHTRQGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELSDVFKQHGVDSILCVSVND
    TFVMNAWKADQRAEHITFIPDGNGDFTRGMEMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    RYVAPEYKVQESVSLFTKPG
    CPFCAKAKQMLLDRGIPFEEIVLGQDATTVSLRAVSGRATVPQVFIGGRHIGGSDDLEQY
    FSA

    >gi|188532299|ref|YP_001906096.1| soluble pyridine nucleotide transhydrogenase [Erwinia tasmaniensis Et1/99]
    MQKSYDYDAIVIGSGPGGEGAAMGLVKQGARIAVIERYHNIGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHTRLLR
    SSFADILNHTENVVSQQTHMRQGFYERNHCEIFQGDARFIDANTLEIETHDGSIERLTAEKFVIACGSRPYHPPDVDFTH
    PRIYDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLAVKVDLINTRDRLLAFLDQEMSDSLSYHFWNNGVVIRHNEEF
    EKVEGVADGVIMHLKSGKKLKADCLLYANGRTGNTDSLSLENVGLEADGRGLLKVNSMYQTAQPNIYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|188532352|ref|YP_001906149.1| Thioredoxin 1 [Erwinia tasmaniensis Et1/99]
    MSDKIVHLTDDSFENDVLKADGLTLVDFWAEWCGPCKMIAPILDEVAAEYEGKLTIAKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLNANLG

    >gi|188532921|ref|YP_001906718.1| Thiamine biosynthesis protein ThiF [Erwinia tasmaniensis Et1/99]
    MSRYQRQSMLPEIGESGQQRLAQARVLVIGAGGLGSALLPLLAAAGVGYLRLYDGDRVEEHNLHRQTLYGMQDIGEEKVF
    CARRALATRNPECVVDARPHALTASATEAALDGIDLAIDAADNFALTWQLSDACLAHHIPLVSASVLGRRGYVGGFCAGA
    PSYRALFPQLPGSAAN
    CNTAGVMGPAVATLGAMQAQMALSILLNFSPSPLGCLVNCDFVQWHFRPFRFDSATEPDQPPVP
    FIDRHLLTAQDCVVELRSVDEAPDSVTDAVQRVLPQQLSDWQPPTDRRIVLVCASGLRAAKAATELELRGFSHLAIIAAG
    R

    >gi|188532926|ref|YP_001906723.1| Peptide methionine sulfoxide reductase [Erwinia tasmaniensis Et1/99]
    MATEYAIIAGGCFWCTEAVFKQIHGVVSVESGYIGGHTENPTYKQVCGGDTGHAEAIRIGFDPEKVSFGDLLDISFATHD
    PTQLNRQGNDIGTQYRSAIFPVSEEQLEEAKMAIARAQSEHNDAIVTTIEAHSTWYPAEDYHQDYWAGEGQGNRYCLAVI
    PPKLQKLHKRFAAYTAPE

    >gi|188532963|ref|YP_001906760.1| dihydrolipoamide dehydrogenase [Erwinia tasmaniensis Et1/99]
    MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALEAHGIVFGKPQ
    TDVDKIRGWKEKVISQLTGGLAGMAKGRKVNVVNGLGQFTGANTLEVTAEDGSKTTITFDNAIIAAGSRPIELPFIPHED
    PRVWDSTDALELKDVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPSEPQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKATHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|188533027|ref|YP_001906824.1| HesB/YadR/YfhF family protein [Erwinia tasmaniensis Et1/99]
    MTDDVALPLQFTDAAASKVKNLISDENNPDLKLRVYITGGGCSGFQYGFTFDDKVNEGDMTIEKSGVALVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|188533074|ref|YP_001906871.1| thioredoxin 2 [Erwinia tasmaniensis Et1/99]
    MNTVCSSCQATNRVPVERVADDAKCGRCGDNLFDGKVVNATAATLDKYLQGDLPVVIDFWAPWCGPCVNFAPVYEAVARE
    RGRQIRFLKVNTEAEPALSARFRIRSIPTIMLFKQGEVADVLSGAMPKAPFEAWLDENL

    >gi|188533087|ref|YP_001906884.1| Putative glutaredoxin [Erwinia tasmaniensis Et1/99]
    MRIIIYTKDNCVQCNATKNAMDKKGIAYQLINLDQEPAHTETLKSLGYRQVPVVMAEQEHWSGFRPDKIQALSHIATVRG


    >gi|188533169|ref|YP_001906966.1| 3-mercaptopyruvate sulfurtransferase [Erwinia tasmaniensis Et1/99]
    MIAKKIADTALFLNNKEAAMTTPSLFISAEWLAQRLNDENIQILDARMLAPGLEKTRDIHAEYLTAHLPGAPFFDIEALS
    DHTSPYPHMMPRAESFAVAMRELGVASNRHLVVYDEGNLFSAPRAWWMLRYFGVERVSILAGGLAGWQQAQLPLASGAVD
    VAEAEFDVGPNNGEIKRATEVLLISHEGGAQIIDARAANRFHGEVDEPRPGLHRGRIPGSLNVAWNTLVSEGRLKPADEL
    RAIFSQQGVDFSQPLIAS
    CGSGVTAVVVILALTSLGVKNVALYDGSWGEWGSRHDLPIVNDAQST

    >gi|188533207|ref|YP_001907004.1| Arsenate reductase [Erwinia tasmaniensis Et1/99]
    MSNVQIYHNPRCSKSRETLALLRAQGIEPQVILYLETPPDIATLATLLQQLGMSSARELMRIKENDYITLGLDDVQVGES
    QLMHAMASRPKLIERPIVVANGQARIGRPPRKVLEIL

    >gi|188533210|ref|YP_001907007.1| thioredoxin-dependent thiol peroxidase [Erwinia tasmaniensis Et1/99]
    MNPLKAGDMAPKFSLPDQDGEQINLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDSMDQLKNVGVDVLGISTDKPEKLSR
    FAEKELLNFTLLSDEDHQVSNQFGIWGEKTFMGKTYDGIHRTSFLIDAEGKVEKVFDDFKTSNHHDIVMNYLQNA

    >gi|188533219|ref|YP_001907016.1| hypothetical protein ETA_10730 [Erwinia tasmaniensis Et1/99]
    MKDNAQKGVLRLYGIKNCDTIKKARRYLDASGVDYQFHDYRADGLDAELLQSFIAKLGWEAMLNTRGTTWRKLDESERAA
    VNNSSSAQALMLAHPAIIKRPLLHAPDGSMLLGFSESTYQTFIQEKS

    >gi|188533286|ref|YP_001907083.1| Cytochrome c biogenesis protein CcmG (Thiol:disulfide interchange protein DsbE) [Erwinia tasmaniensis Et1/99]
    MSKKILYIPLVLFLLLAAALLWQLNRNANGDDPTRLESALLGKPVPIFKLESLDEPGKTFDQSVLKDGKPLLLNVWATWC
    PTCRAEHQYLNSLAAQGVRVVGLNYKDDRQKAIHWLNTLGNPYALSLYDGDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GDLNERVWNQEVKPLWRKYGQEGGA

    >gi|188533307|ref|YP_001907104.1| Probable rhodanese-related sulfurtransferase [Erwinia tasmaniensis Et1/99]
    MIARHDVNQEFPMSHFSAVLQFPPPSPRQSEAWLAEKLAYYADAWDVAQDLANGVAEIVVIDTRSPQHYHAGHICAAISF
    PHRTMNADSLAALDRDKVYVTY
    CDGIGCNGSTRGAWKLAAAGFKVKELIGGLDFWRRDRHPVTTGDEPGSWPETTTGPDC
    GC

    >gi|188533683|ref|YP_001907480.1| disulfide bond formation protein B [Erwinia tasmaniensis Et1/99]
    MLRYLNRCSKGRGAWLLLALTAFALEMSALFFQHVMQLPPCVMCIYERCALFGVMGAGIVGAIAPKTPLRWAAILLWLYG
    AWEGLRLSWEHTMMQLHPSPFVT
    CDFAARFPSWLPLDKWLPSVFVASGDCAVKSWSFLTLSMPQWMAGIFAAYLAVAVLI
    LIAQAFVTKKRDLFSR

    >gi|188533703|ref|YP_001907500.1| methionine sulfoxide reductase B [Erwinia tasmaniensis Et1/99]
    MAKQDNSSSHENTLTEMQRYVTQEHGTEPPYSGKLLHNKDEGIYHCLICRAPLFLSDSKYDSGCGWPSFYQPFSPEAIRY
    LEDDSHGMQRVEIRCGSCDAHLGHVFPDGPQPTGERF
    CVNSASLSFTDDNGNKTLG

    >gi|188533788|ref|YP_001907585.1| thiol peroxidase [Erwinia tasmaniensis Et1/99]
    MSQTVHLQGNPVSVDGQLPTSGQTARPFTLVAKDLSDVSLAHYAGKRKVLNIFPSVDTGVCATSVRKFNQLASELTNTVV
    LCISADLPFAQSRFCGSDGLSNVVTLSTLRGNAFLKDYGVAIIDGPLNGLAARAVVVLDENDRVIYSQLVDEISSEPDYD
    AALASLK

    >gi|188533873|ref|YP_001907670.1| hypothetical protein ETA_17350 [Erwinia tasmaniensis Et1/99]
    MTALPTVTIHYCSQCNWMLRASWMAQELLHTFNTDLGGVTLIPGTGGIYEIRVDRQLIWDRKVDIGFPDAAEIKRRLRAV
    CFPQRDLGHIDGHTEKT

    >gi|188533912|ref|YP_001907709.1| Electron transport complex protein [Erwinia tasmaniensis Et1/99]
    MTEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVITLASICAWLVNHLILLPLDLVYLRTMAYILV
    IAVVVQFTEMVVRKTSPDLYRLLGIFLPLITTN
    CAVLGVPLLSVNLNHTFMQAAIYGFSASIGFSLVMVLFAGVRERLVL
    ADVPAPFKGSSIALVTAGLMALAFMGFAGLVKF

    >gi|188533917|ref|YP_001907714.1| electron transport complex RsxE subunit [Erwinia tasmaniensis Et1/99]
    MSEAKTLLVGGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTCTNSAISLSRRWVPAEIRIPIYVMIIAAVV
    SCVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVVGRAEAVASKSSVPLSALDGMAIGLGATSVMVVLGSIREIIGNGTIFNG
    ADQLLGPWAKAMHIQVVHFDSPMLLAMLPPGAFIGLGMLLAAKYLIDNKMKQRATLKAESQAQGLPEGKTGAL

    >gi|188533942|ref|YP_001907739.1| hypothetical protein ETA_18040 [Erwinia tasmaniensis Et1/99]
    MSTVEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAEMPKYANWPTFPQLWVDGELV
    GGCDIIIEMYQRGELQQLIKETAEKYPADTAE

    >gi|188533956|ref|YP_001907753.1| iron-sulfur cluster assembly scaffold protein [Erwinia tasmaniensis Et1/99]
    MQSANPATFSPDDYIWKGLTLTDSAAKQIISLAAGDPDIKGLKLGVKTSGCAGFGYTMDMVKESAADDLVFSHNGATLFV
    PLQAMPYIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVE

    >gi|188533967|ref|YP_001907764.1| hypothetical protein ETA_18310 [Erwinia tasmaniensis Et1/99]
    MQFNNTWLNELNGFHTTLRPMPLKNARLLYYSAELAQDLGLDERLFDAQNVGLWSGERLAEGMQPLAQVYSGHQFGVWAG
    QLGDGRGLLLGEQQLPDGRKFDWHLKGAGLTPYSRMGDGRAVLRSTLREFLAGEAMYHLGIPTSRALTVVTSDEPVYRET
    TEAGAMLLRVAESHVRFGHFEHYYYQGQTEKVTQLADYVIRHHWPELVQEKDRYLLWFSDVVQRTARMIAGWQSVGFAHG
    VMNTDNMSILGLTFDYGPYGFLDDYRPDLICNHSDHQGRYSFENQPMIGLWNLNRLAHALSGLMSPQQLKQALAGYEPEL
    MRCWGEKMRAKLGLLTPAKDDNNILTGLLSLMTKEGSDYTRTFRQLSQSEQLQLRSPMRDEFIDRDAFDSWYNVWRQRVL
    QEERSDEERQQTMKLANPALVLRNYLAQQAIERAEQDDISVLARLHQALSRPFDDAPEYADLAQRPPDWGKKLEVS
    CSS

    >gi|188533970|ref|YP_001907767.1| Glutathione peroxidase [Erwinia tasmaniensis Et1/99]
    MSLFETELVTLDGEKTTLAQWQGEVLLVVNVASKCGLTPQYEQLENLQKKLHSLGLTILGFPCNAFLEQEPGSEAEIKTF
    CSTTYGVSFPMFSKIEVNGPQRHSLYAKLIAARPDTVAPENSGFAAKMASKGRAPKEYGDVLWNFEKFIIDRDGQVVGRF
    SPDMEPNDPRLLECIGKALGH

    >gi|188534180|ref|YP_001907977.1| glutaredoxin 2 [Erwinia tasmaniensis Et1/99]
    MKLYIYDHCPFCVKARMIFGLKNIPVELVVMMNDDEATPQRMIGQKMAPILMKEDGSCMAESLDIVHYVDASDRQPLLTG
    STHAAISDWLRHISSYVNKLLIPRVAEAPFAEFATPEARRYFKNKKQGVYGDFAELKEHSPGLIKNVNDDLRKLDRLIVQ
    SNAVNGELSLDDIHLFPLLRSLSLVAGIEYPTRVADYRDNMAKQTQINLLSSLAS

    >gi|188534189|ref|YP_001907986.1| hypothetical protein ETA_20590 [Erwinia tasmaniensis Et1/99]
    MPVLHNLVSNEELKARMLAETEPRTTVSFYKYFTIEDPRAFRDALYVALTRLKVFGRVYVAAEGINAQVSVPASLYEEMK
    ATLYGFHPALDKLRMNIALDDDGKSFWVLRLKVRERIVADGITDESFDASDVGAYLKAAEVNAMLDDPEAVFVDMRNHYE
    YEVGHFDNALEIPADTFRDQLPMAVDMLEQDKDKKIVMY
    CTGGIRCEKASAWMRHNGYENVYHIEGGIIEYARRAREQGL
    PVRFKGKNFVFDERMGERISDDVIAHCHQCGEPCDNHVNCLNDGCHLLFIQCPACAVKFNHCCSPLCMEELALTPEEQRA
    RRAGRENGNKIFNKSRGLLSTTMHIPSPKE

    >gi|188534283|ref|YP_001908080.1| Thioredoxin reductase [Erwinia tasmaniensis Et1/99]
    MAQAFSLIVNKIAECFFCLVKFPTILISVCQLNNEGLMSTAKHSKLLILGSGPAGYTAAVYAARANLNPVLITGLEKGGQ
    LTTTTDVENWPGDAHDLTGPLLMERMQEHALKFNTEIIFDHIHSVDLQNRPFRLIGDEGEYTADALIIATGASARYLGLP
    SEEEFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVEEALYLANIAAEVHLIHRRDSFRAEKILIDRLNEKVKNGNIVLH
    TDHTLDEVLGDQMGVSALRLRSTKDDRSKDLAVAGLFVAIGHSPNTAIFDGQLALENGYIKVQSGTHGNATQTSIPGVFA
    AGDVMDHIYRQAITSAGTGCMAALDAERYLDGLVKNNQ

    >gi|188534308|ref|YP_001908105.1| glutaredoxin 1 [Erwinia tasmaniensis Et1/99]
    MFAVIFGRPACPYCVRAKELAEKLTEEREDFNFRYIDIHAEGITKADLEKTVGKPVETVPQIFLDQNHIGGCTEFEAYAK
    ENLGLFQ

    >gi|188534321|ref|YP_001908118.1| molybdopterin biosynthesis protein MoeB [Erwinia tasmaniensis Et1/99]
    MLPELSDKEMLRYNRQIVLRGFDLDGQEQLKAARVLVVGLGGLGCAASQYLAAAGIGQLTLLDFDEVTLSNLQRQVLHGE
    AQLGMAKVDSARARLATINSSIAIEAVNARLDDDGMAQLIARHQLVIDCCDNLETREQLNRLCFASKTPLVSGAAIRMEG
    QISVFSWGREEPCYRCISRLFGAATLS
    CVEAGVMAPLVGVIGSLQAMEAIRALTHYGSPVAGKLLLYDAMTLQFRSIKVA
    KDAGCEVCGDGGQREG

    >gi|188534416|ref|YP_001908213.1| Methylated-DNA-(Protein)-cysteine S-methyltransferase [Erwinia tasmaniensis Et1/99]
    MAFSYKKMHSPTGELTLIAAENSLIAVRWENDEPSTARFYPREEDQHHMILIEAERQLGEYFDGKRQQFALPLTFIGTDF
    QKKVWNALIAIPFGETRSYRQIAQQIGHSAAVRAVGAANGRNPLPIFAP
    CHRVIGSNGKLTGFAGGLANKAFLLRLEAGQ
    LRV

    >gi|188534522|ref|YP_001908319.1| Osmotically inducible protein C [Erwinia tasmaniensis Et1/99]
    MTIHKKGQAHWEGNIKQGKGTVSTESGALSQQPYGFNTRFEGKPGTNPEELIGAAHASCFSMALSLMLGDAGYTPESIDT
    TADVSLDKVDGGFAITNVALQSKVKLPGIDTSTFDGIIQQAKAG
    CPISKLLNTEITLDYQLEN

    >gi|188534576|ref|YP_001908373.1| Putative thioredoxin-like protein [Erwinia tasmaniensis Et1/99]
    MSSQAQIVEINETNLQQTLEQSMQIPVLFYFWSERSQHCQQLTPLLGRLAQEYAGQFILARLDCDAEPAVAQQFGLRSIP
    TVYLFQNGQPVDGFQGPQPEEAVRALLEKVLPKEEELKAQQAMQLMDEGKAIEALPLLKDAWALSKQRSDIGFLLAEVLI
    GLNRSEEAEAVLKVVPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQIEAEPDNAELATQLALQFHQVGRNEEALELL
    FSHLKKDLSAADGQARKMLQEILAALGTGDALAAKYRRQLYSLLY

    >gi|188534580|ref|YP_001908377.1| copper exporting ATPase [Erwinia tasmaniensis Et1/99]
    MPQTTLLTLDGLSCGHCVKRVKEALEQRADVEQAEVSIAEARVIGSASAEALIATVAEAGYHASLVEAATPPKPDPLTDS
    DIQPEALTAAKTELPAQRHDSYQLLIDGMS
    CASCVSRVENALQHVPGVSQARVNLAERSALVMGSALPSALLDAVSRAGY
    SAEIIEDETERREKQQQSALAAVKRFRWKAALALTLGVPLMIWGMLGDNMMLTADNRASWLVAGILTLLVMIVAGGHFYR
    SAWKSLLNRRATMDTLVALGTAAAWLYSVTVTLWPDLFPMAARHLYYEASAMIIGLINLGHMLEQRARQRSSQALEKLLD
    LTPPTARVVTETGEQTLPLGEVQLAMTLRVVTGDRIPVDGTIIQGEAWLDEAMLTGEAIPQQKSVGDTLHAGTLLQDGSV
    LLRAGAIGKNTTLARIIQLVRQAQSSKPEIGKLADKISAVFVPVVVAIALLSAAVWYLFGPAPQLVYTLVIATTVLIIAC
    PCALGLATPMSIIAGVGHAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGSPRVVEIVLLSDAKRPTVLRQAAALEQG
    ASHPLARAIVEHAGLTALPEVAQFRTIAGKGVSGVVDGTALLLGNAALMAQQHIATDSVAPTIAELAAQGVTPVLLAADG
    EIVALFAIRDALRKESVSALQRLHRLGYRLVMLTGDNEITANAIAREAGIERVIAGVLPDGKAAAISALQQQGRQVAMIG
    DGINDAPALAQADVGIAMGSGSDVAIETAAITLMRQDLNALVDGLAIAKATLRNMKQNLLGAFIYNACGIPLAAGVLYPF
    TGTLLSPVVAGAAMALSSITVVSNANRLIRYRPPK

    >gi|188534667|ref|YP_001908464.1| Putative alkyl hydroperoxide reductase subunit C [Erwinia tasmaniensis Et1/99]
    MVLVTRPAPDFTAAAVLGNGEIVENFNFKKHTAGKATVVFFWPMDFTFVCPSELIAFDKRYAEFQKRGVEVIGVSFDSEF
    VHNAWRKTPVDKGGIGEVQYAMVADIKREIQKAWGIEHPEAGVALRGSFLIDQAGVVRHQVVNDLPLGRNVDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKKGMGASPDGVAKYLSENASKL

    >gi|188534795|ref|YP_001908592.1| Thiol:disulfide interchange protein DsbA [Erwinia tasmaniensis Et1/99]
    MSTRANRYTLLFFFCISALFSSLTTAADYKENDRYFLQKSPVTTVPDVVEFFSFYCGPCFQFSHTYKVTDAIVKRLPAGT
    KLTKYHVGLMGPLGHELTEAWSVAMVLGIENKVETLLFEKIQQEHAVKSVADIMKVFSSVGVEAGQYENTRRSLPVQALV
    KKQYDAVESMNVTSTPSFYVQGKYRVNNAAVTSSSPDDYAKEFADIIRFLLDKKP

    >gi|188534906|ref|YP_001908703.1| thiol:disulfide interchange protein DsbC [Erwinia tasmaniensis Et1/99]
    MKKHLLLPILLAAFSGLANADDAAIQQSLSKLGLQQTEIQPSPLPGFKTVLSESGVLYVTDDGKHFIQGPLYDVSGSRPV
    NVTNQLLDKKVDALSKEMIVYKAAKEQHVVTVFTDIT
    CGYCHKLHQQMADYNALGITVRYLAFPREGMEGPVAQKMKSIW
    CAADRNKALDAAMKGEEVKAADCKIDLAQQFKLGAQYGIQGTPAILLQDGTLIPGYQGPQELKKYLDGQKKGG

    >gi|188534954|ref|YP_001908751.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Erwinia tasmaniensis Et1/99]
    MRQKSTLNTLAAAAILSLTLPVTSALAALQTGVKAPDFQLNAALAGKPTTFSLQQSLQKGPVVLYFFPAAFSAGCTLEAH
    AFAEATDEFKKQGATVIGVTAGNVDQIAKFSQLECRDKFTIAADPGAKVAGEYQSTMQFNGKTLSDRTSYVIAPDGKILL
    SYSDKNPQAHIQKAMDAVKKYRQANPA

    >gi|188534955|ref|YP_001908752.1| Putative thio:disulfide interchange protein, probable fragment [Erwinia tasmaniensis Et1/99]
    MLTAIAAALLGGIILNLMPCVFPVISLKALSLIRHHDRPAQARAEGLAFLGGVVITMLALAGALMLARSGGSAVGWGFQL
    QSPLVIALLALVMLASALNLFGLFEIGLSVQRVGEVGGTRSGLTGSALTGALAIIVATPCSAPFMASAIGYALTQPTPVS
    LVIFIALALGFAAPFTLISFFPLLARILPAPGAWMVTLKHGLAFPMLGAVAWLIWVLERQAGSLALAAILACCIILSFAA
    WLYGKAQKRRMMGKRHWPMHIASAIFALLVVPPLANIGTFSHRDTPAENAEAAATVAWSPQKVDAVKGQGQPVLVNFTAS
    W
    CITCQVNDRTSLSTEAVKSAIARTGTIYMIADSTNYNPDVEQALSDFGRGGLPLYVVYPADGGKPVVLPQVLTPHIVIS
    ALESATMNRKKT

    >gi|188535106|ref|YP_001908903.1| thiol:disulfide interchange protein precursor [Erwinia tasmaniensis Et1/99]
    MAQRITPFIFLLLTVLLNLNAGAAPFGQNNTSQFVTVNQAFAFDFAQKNERLTLSWQVKPGYYLYRQQVKISLRGATLAE
    WNLPAGQPHEDEFYGKTAVYTDNLTLPLTLIQASDGAQLTVSYQGCAAAGFCYPPETRNVPLNAVTARVSPDNVPMPVSP
    EQAGDEHALPFSALWALLIGIGVAFTPCVLPMYPLISAIILGGNRQYSLGRLFALAMLYVQGMALTYTLMGVVVAAAGLR
    FQAALQAPAVLIVLSVLFILLALSMFGLFNLQLPSALQTRLTQWSNRQQGGSLPGVFLMGALAGLICSPCTTAPLSAILL
    YIAQSGNMLAGAGTLYLYALGMGLPLIAITLFGNRLLPKNGPWMQTVKEGFGFVILALPVFLLERVVGESWGLRMWSGLG
    VAFFGWAFISSLKSSRGWLRVLQILLLGAILIAARPLQDWAFGHAPAAQSGAPVSFKPITHIEELNQQLQNSTGKITMLD
    LYADW
    CVACKEFDKYTFRDAQVRAALDNMQLLQANVTANNASDSALLQHLHVLGLPTILFFAADGHEIPGSRVTGFMTPQ
    DFRIHLQKLAR

    >gi|188535132|ref|YP_001908929.1| Thiol:disulfide interchange protein DsbA [Erwinia tasmaniensis Et1/99]
    MSMKFKPIAIVGYSLFLVVTSSLITVLYYHLFVFNTFAGDNSQTQSLREVSREQVVSSPIKEDHSIIEVMSYGCHYCAAN
    EEDLAKFSRSLPAGSVFKTIHIAGGGSGLAAYAPIFATLTEMGVEEQYRDSAYNAIIARNIDLNNENALVSWLKKNDIDV
    EKYQSVRQSDAVKQRIDDMADITRHYAINATPMFIINKRYVVAQDRDFPEFAQRMQKLLKKDN

    >gi|188535352|ref|YP_001909149.1| Thiosulfate sulfurtransferase GlpE [Erwinia tasmaniensis Et1/99]
    MEQFECINIQQAQQKLADDNALLVDIRDAQSFAAAHASGAFHLSNESLPPFLAQSDLARPVLVMCYHGNSSKGAAQYLLG
    QGFSAAYSIDGGFEAWRIAFPQQVSAQ

    >gi|188535392|ref|YP_001909189.1| zinc/cadmium/mercury/lead-transporting ATPase [Erwinia tasmaniensis Et1/99]
    MQQHSSCGCGHHHARKQHGCATRSRPVIKKVTAVGADAPCCGDTACSPADPPDEEGDRLAQTARFSWQVQGMDCPSCAQK
    VETAVKNLANVRAARVVFVSEKLLVDASADVRSEVERAVARVGFRLRRSHAAAAAAEAGFWRENRSAVLLALLMAASWLL
    GTLHPGAGNVAFTLTTLVGVWPVAHRALRLIRGGSPFSIETLMSVAAVGALFIGATAEAAMVLLLFTLGERLESFAAGRA
    RKGVTALMALKPDQALRVRSGQRENVAVSDLRPGDVIEVAAGGRLPADAKLLTPFASFDESALTGESVPVDRQRNDAIAA
    GSMSVDRLVQLEVMSEPGHSAIDRILHLIEEAGERRAPIERFLNRFSRIYTPIVMLLALVVALLPPLLMAAEWQPWIYKG
    LTLLLIGCPCALVISTPAAVTSALAAAARRGALIKGGAALESLGKVRTMAFDKTGTLTEGKPRLIAITALDGSDENSLLA
    VAAAVEQGSSHPLARAIVAAADARQLAIPAASDQRALAGSGIQAKVSGRLLFISSPHRVSEELLAPQRKAIEALEDGGNT
    VVILHDERQMLATFALRDTLRADARGALAELQALNIQAVMLTGDNPRAAAAIAAGLGIDYRAGLLPEDKVNAIRALQQQQ
    AVAMVGDGINDAPAMKAATVGIAMGSGSDVALETADAALPHNRLAGLATMIRLSRAAHANIRQNIALALGLKALFLITTL
    LGITGLWLAVLADSGATALVTANALRLLAKR

    >gi|188535439|ref|YP_001909236.1| glutathione reductase [Erwinia tasmaniensis Et1/99]
    MTKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKDLGGTCVNVGCVPKKVMWHAAQIAEAIHNYGPDYGFDTTVNQFN
    WDVLVKNRSAYIDRIHTSYDNVLGKNKVDVIKGFARFVDAHTVEVNGEKITADHILIATGGRPSLPAIPGAEHGINSDGF
    FELAALPKRTAVVGAGYIAVEIAGVLNALGSETHLYVRKHAPLRSFDPLIVDTLVEVMNSEGPTLHTESTPEAVVKNADG
    SLTLKLENGKEQTVDCLVWAIGREPMTDNLNLDVTGVQLNEKGYISVDKFQNTNVKGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDFSNVPTVVFSHPPIGTVGLSEPEAREKFGDDQVKVYQSSFTAMYTAVTQHRQPCRMKLVCMGNDE
    KIVGIHGIGYGMDEMLQGFAVALKMGATKKDFDNTVAIHPTGSEEFVTMR

    >gi|188535510|ref|YP_001909307.1| Organic hydroperoxide resistance protein [Erwinia tasmaniensis Et1/99]
    MSLEKVIYRAKAKATGGRDGRATSSDGVLDIKLGVPKEMGGAGGEATNPEQLFAAGYSACFLGAMKFVAGRDKFTMPKDA
    FIEGEVGIGPLPTGFGIEATLNIHLPGMDSAEAQKLVDAAHIV
    CPYSNATRGNIDVTLNIIN

    >gi|188535983|ref|YP_001911095.1| Putative thiol-disulfide isomerase [Erwinia tasmaniensis Et1/99]
    MKKLLALAIAASLLLSCTALADTGTTFSPAQQQEIQKITEQWLTAHPEILIKMGKKLQQRQQKAQQTQLSDGVVKLAAQL
    QQVKGIPHAGPEDASVIVTEFFDYQ
    CVYCHRDARIVEKLIQDNPKVKFVFRDWPIFAGQYPLSNTAALTGIGIYREAGAD
    AYLKYHNGIFATGHDEGKLREQDIADVAAKAMGKTPKLDDLKSYTATIDKNDMLAKAIGANGTPLFIVMPASNPTAENIT
    VIPGAASLDVLQTAINHAR