Erwinia pyrifoliae Ep1 96 uid40659

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|259906704|ref|YP_002647060.1| periplasmic protein disulfide isomerase I [Erwinia pyrifoliae Ep1/96]
    MKKIWLALVGMVLAFSASAAPFTNGQQYVTLDKPVTGEPQVLEFFSFYCPHCYEFERVWHVSEAVKKNLPANVKVTKYHV
    EFLGGDMGKAVTQAWAVAMALGVEDKVTAPVFEGIQKTQTITDPATLKETFVKAAGIKPADYDAAWNSFVVRSLVAQQEK
    AAADMDLRGVPAMFVNGKYMVNSGGLDTSSMDNYVQQYANLVNFLTTQK

    >gi|259906780|ref|YP_002647136.1| hypothetical protein EpC_00990 [Erwinia pyrifoliae Ep1/96]
    MQDIMQFAGNHTILALAWVVLLVLVIVTTVKGMFSKVKVISRGEATRLINKEEAVVVDVRGRDDYRKGHISNAINVLAAE
    IKKGSYGELEKHKAQPLIVV
    CATGTSAGESAAQLSAAGYEQVYVLKDGVSGWSSENLPLVRGK

    >gi|259906781|ref|YP_002647137.1| glutaredoxin 3 [Erwinia pyrifoliae Ep1/96]
    MATVEIYTKSTCPFCHRAKALLDQKGASYQEIPIDGDATLREVMIKRSGRTTVPQIFIDAQHIGGCDDLFALDGRNGLEA
    LLK

    >gi|259906841|ref|YP_002647197.1| peroxiredoxin/glutaredoxin family protein [Erwinia pyrifoliae Ep1/96]
    MFASQEGKSIPQVTFHTRQGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELSDVFKQHGVDSILCISVND
    TFVMNAWKADQRAEHITFIPDGNGEFTRGMEMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    RYVAPEYKVQESVSLFTKPG
    CPFCAKAKQMLLDRGIQFEEIVLGQDATTVSLRAVSGRATVPQVFIGGRHIGGSDDLEQY
    FSA

    >gi|259906843|ref|YP_002647199.1| soluble pyridine nucleotide transhydrogenase [Erwinia pyrifoliae Ep1/96]
    MQKSYDYDAIVIGSGPGGEGAAMGLVKQGARIAVIERYHNIGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDHTRLLR
    SSFADILNHTENVISQQTHMRQGFYERNHCELYQGDARFVDANTIEIETHDGSIERLTAEKFVIACGSRPYHPPDVDFSH
    PRIYDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLAVKVDLINTRDRLLAFLDQEMSDSLSYHFWNNGVVIRHNEEF
    EKIEGVTDGVIMHLKSGKKLKADCLLYANGRTGNTDSLSLENIGLEADGRGLLKVNSMYQTAQPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQAMIKGEATAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMDVGSLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|259906864|ref|YP_002647220.1| Thioredoxin 1 [Erwinia pyrifoliae Ep1/96]
    MSDKIVHLTDDSFETDVLKADGLTLVDFWAEWCGPCKMIAPILDEVAAEYEGKLTVAKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLNANLG

    >gi|259907154|ref|YP_002647510.1| thiol:disulfide interchange protein precursor [Erwinia pyrifoliae Ep1/96]
    MDQRITPFIFLLLTTLFSLNASASLFGQNNSAQFVTANQAFSFDFSQKNERLHLSWQIKPGYYLYRQQIKISLKGATLAQ
    WSLPAGQPHEDEFYGKMAVYPHSLTLPFTLIQAAAGAQLTVSYQGCAAAGFCYPPETRNVPLNAVAAQSSLANAAMPASL
    VEDSNEHSLPFSALWALLIGIGVAFTPCVLPMYPLISAIILGGNRQYSLSRLFALAMLYVQGMALTYTLMGVVVAAAGLR
    FQAALQAPAVLMVLSALFILLALSMFGLFNLQLPSALQTRLTLWSNRQQGGSLPGVFLMGALAGLICSPCTTAPLSAILL
    YIAQSGNMLTGAGTLYLYALGMGLPLIAITLFGNRLLPKNGPWMQTVKEGFGFVILALPVFLLERVVGESWGLRMWSGLG
    VAFFGWAFISSLKSNCGWLRVLQILLLGAMLIAARPLQDWAFGNAPAPQAAAPISFTPVTHAGLLNQQLQSSNGKITMLD
    LYADW
    CVACKEFDKYTFRDAPVRAALASMQLLQADVTANNARDSALLKHLNVLGLPTILFFAADGHEIPGSRVTGFMKPS
    DFHAHLQKLAR

    >gi|259907377|ref|YP_002647733.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Erwinia pyrifoliae Ep1/96]
    MYGAPIYVRHEVVHNRYVVNSLRERGAIFIEEIDEVPDGSILIFSAHGVSQAVRAEAKARKLTMLFDATCPLVTKVHMEV
    ARASRRGTEAVLIGHAGHPEVEGTMGQYNNPLGGMYLVEKPEDVSRLQVKNEDNLSFMTQTTLSVDDTSEVIDALRARFP
    KIVGPRKDDICYATTNRQEAVRNLARDADVVLVVGSKNSSNSNRLAELAQRAGKLARLIDSADDIQEQWLQGVTCVGVTA
    GASAPDILVQQVIQRLNELGGVDAVELIGREENIIFEVPKELRVEVRQLD

    >gi|259907466|ref|YP_002647822.1| dihydrolipoamide dehydrogenase [Erwinia pyrifoliae Ep1/96]
    MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKSLEAHGIVFGKPQ
    TDIDKVRGWKEKVISQLTGGLAGMAKGRKVNVVNGLGKFTGANTLEVTAEEGSKTTITFDNAIIAAGSRPIELPFIPHED
    PRVWDSTDALELKEVPERLLVMGGGIIGLEMATVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
    AVEAKEDGIYVTMEGKKAPSEPQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEQGISYETSTFPWAASGRAIASDCADGMTKL
    IFDKNTHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK

    >gi|259907532|ref|YP_002647888.1| HesB/YadR/YfhF family protein [Erwinia pyrifoliae Ep1/96]
    MTDDVALPLQFTDAAASKVKNLISDENNPDLKLRVYITGGGCSGFQYGFTFDDKINEGDMTIEKSGVALVVDPMSLQYLV
    GGSVDYTEGLEGSRFIVTNPNAKTTCGCGSSFSI

    >gi|259907579|ref|YP_002647935.1| thioredoxin 2 [Erwinia pyrifoliae Ep1/96]
    MNTVCSSCQATNRLPAERIAHGAKCGRCGDTLFDGQVVNATGETLDKYLQDDLPVVIDFWAPWCGPCVNFAPVYESVARQ
    RSGKIRFLKVNTEAEPALSARFRIRSIPTIMLFKQGQVADVLSGAMPKAPFEAWLDENL

    >gi|259907590|ref|YP_002647946.1| Putative glutaredoxin [Erwinia pyrifoliae Ep1/96]
    MRIIIYTKDNCVQCNATKNALDKKGIDYQLINLDHEPAHAETLRSLGYRQVPVVVAEQEHWSGFRPDKILALSHAATVRG


    >gi|259907713|ref|YP_002648069.1| 3-mercaptopyruvate sulfurtransferase [Erwinia pyrifoliae Ep1/96]
    MIAKKIADTASNVTDNEAAMTTPSFFVSADWLAQHLSDNDLQMLDARMLPPGQEKTRDVHAEYLAAHLPGAPFFNIEALS
    DHTSPYPHMMPRAESFAVAMRELGINSAKHLVVYDEGNLFSAPRAWWMLRYFGVERVSILAGGLAGWQKAQLPLSSGAVD
    VAEAEFEAVVGYGEIKRTTDVLLVSHEGGAQIVDARAANRFHGEVDEPRPGLHRGRIPGSLNVAWNTLVACGRLKPADEL
    RAIFSQQGVDLAQPVIAS
    CGSGVTAAVVILALASLGVKNIALYDGSWGEWGSRNDLPIINDALSA

    >gi|259907762|ref|YP_002648118.1| Arsenate reductase [Erwinia pyrifoliae Ep1/96]
    MCEVLIYHNPRCSRSRETLALLKARGMEPQIILYLETPPDLATLTALLQQLGLHSARQLMRQKEDEYIALGLDDAQLDEQ
    QLLSALAAQPSLIERPIVVANGHARIGRPPQQVLEIL

    >gi|259907765|ref|YP_002648121.1| thioredoxin-dependent thiol peroxidase [Erwinia pyrifoliae Ep1/96]
    MNPLKAGDTAPKFSLPDQDGEQINLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDSMEELKQAGVEVLGISTDKPEKLSR
    FVEKELLNFTLLSDEDHQVSEQFGIWGEKTFMGKTYDGIHRTSFLIDADGNVEKVFDNFKTSNHHDMVIDYLKTA

    >gi|259907788|ref|YP_002648144.1| hypothetical protein EpC_11190 [Erwinia pyrifoliae Ep1/96]
    MTNHIEPKFTLYGIKNCDTIKKARRYLETSGVDYQFHDYRVNGLDAELLQGFIDNLGWEALLNTRGTTWRKLDESERKAV
    NTPAGALALMLAQPAIIKRPLLCAPDGSMLLGFNETTYQSFIMEKS

    >gi|259907864|ref|YP_002648220.1| Cytochrome c biogenesis protein CcmG (Thiol:disulfide interchange protein DsbE) [Erwinia pyrifoliae Ep1/96]
    MSKKVLSIPLVLFLLLAAALLWQLNRNADGDDPTRLESALLGKPVPVFKLESLGEPGKTFDQSVLKDGKPLLLNVWATWC
    PTCRAEHQYLNSLAAQGVRVVGLNYKDDRQKAIHWLNTLGNPYGLSLYDGDGMLGLDLGVYGAPETFLIDGRGIIRYRHA
    GYLNERVWNQEVKPLWQKYSQEGAA

    >gi|259907887|ref|YP_002648243.1| Probable rhodanese-related sulfurtransferase [Erwinia pyrifoliae Ep1/96]
    MIARHPISQEFLMRHFSAVLQFPPPSPRQSEAWLAEKLAYYADAWDLAQDLASGVAEIVVIDTRSSQHYHAGHICGAISF
    PHRTMLADSLAALDRDKVYVTY
    CDGIGCNGSTRGAWKLAAAGFKVKELIGGLDFWRRDQHPVTTGDEPGCWPEATMQPDC
    GC

    >gi|259908273|ref|YP_002648629.1| disulfide bond formation protein B [Erwinia pyrifoliae Ep1/96]
    MLRYLNRCSQGRGAWLLLALTAFALEMSALYFQHVMQLPPCVMCIYERCALFGIMGAALVGAVAPKTPLRWGAILIWLYS
    AWQGLRLAREHTMIQLHPSPFVT
    CDFAARFPSWLPLDKWLPSVFVASGDCAVKSWSFLTLSMPQWLLGVFAAYLLVAVLV
    LIAQAFTAKRRDLFSR

    >gi|259908286|ref|YP_002648642.1| methionine sulfoxide reductase B [Erwinia pyrifoliae Ep1/96]
    MANEDTSFSSENALTEMQHYVTQQRGTEPPYSGKLLHNKSDGIYHCLVCRASLFLSGAKYDSGCGWPSFYQPYSDEAIRY
    LEDNTHGMQRIEIRCGSCDAHLGHVFPDGPQPTGERF
    CVNSASLSFTDDDGNKTPG

    >gi|259908365|ref|YP_002648721.1| thiol peroxidase [Erwinia pyrifoliae Ep1/96]
    MSQTVHLQGNPVSVDGQLPTKGQAAKPFTLVAKDLSDVSLSQYAGKRKVLNVFPSVDTGLCATSVRKFNQLASEIDNAVV
    LCISADLPFAQSRFCGSDGLNNVVTLSTLRGHAFLKDYGVAIVDGPLSGLAARAVIVLDENDMVIYSQLVNEISTEPDYD
    AALAALK

    >gi|259908480|ref|YP_002648836.1| Selenoprotein W-related protein [Erwinia pyrifoliae Ep1/96]
    MLRPLPVVTIHYCSQCNWMLRASWMAQELLHTFSTDLGAVTLVPGTGGIYEITVNQQIIWNRKIDNGFPDAAEIKRRVRA
    VCFPQRDLGHIDRHADKS

    >gi|259908515|ref|YP_002648871.1| Electron transport complex protein [Erwinia pyrifoliae Ep1/96]
    MTEYLLLFIGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVITLASICAWLVNHLILLPLDLVYLRTMAYILV
    IAVVVQFTEMVVRKTSPDLYRLLGIFLPLITTN
    CAVLGVPLLSVNLNHTFMQAAIYGFSASIGFSLVMVLFAGVRERLVL
    ADVPAPFKGSSIALVTAGLMALAFMGFAGLVKF

    >gi|259908520|ref|YP_002648876.1| electron transport complex RsxE subunit [Erwinia pyrifoliae Ep1/96]
    MSEAKTLLVGGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTCTNSAISLSRRWVPAEIRIPIYVMIIAAVV
    SCVEMLINAYAFGLYQSLGIFIPLIVTN
    CIVVGRAEAVASKSSVPLSALDGMAIGLGATSVMVVLGSIREIIGNGTVFNG
    ADRLLGPWAKAMRIEVVHFDSPMLLAMLPPGAFIGLGMLLAVKYLIDNKLKQRAAIKAESQMQTLPEGKTGAL

    >gi|259908543|ref|YP_002648899.1| hypothetical protein EpC_18930 [Erwinia pyrifoliae Ep1/96]
    MSTVEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAEMPKYANWPTFPQLWVDGELV
    GGCDIIIEMYQRGELQQLIKETAQKYPTDAAE

    >gi|259908558|ref|YP_002648914.1| Iron-sulfur cluster assembly scaffold protein [Erwinia pyrifoliae Ep1/96]
    MQSANPATFSPDDFIWKGLTLTDSAAKQIINLAAGDPDIKGLKLGVKTSGCAGFGYTMDMVKESAADDLVFSHNGAALFV
    PLQAMPYIDGTEVDYVREGLNQIFKFNNPKAQHACGCGESFGVE

    >gi|259908568|ref|YP_002648924.1| hypothetical protein EpC_19180 [Erwinia pyrifoliae Ep1/96]
    MKFNNTWYNELNGCYTALQPTPLKNARLLYHNAGLARELGLDERLFNAQNAGLWGGERLPDGMQPLAQVYSGHQFGVWAG
    QLGDGRGMLLGEQQLPDGRKFDWHLKGAGLTPYSRMGDGRAVLRSTLREFIAGEAMHHLGIATSRALTVVGSDEPVYRET
    TETGAMLLRVAESHVRFGHFEHFYYQGQPEKVTQLADYVIRHHWPQWVQERDKYLLWFSDVVQRTARLIAGWQSIGFAHG
    VMNTDNMSILGLTLDYGPFGFLDDYQPEFICNHSDHQGRYSFENQPMIGLWNLNRLAHALSGLMSPQQLEQALAGYEPEL
    MRCWGEKMRAKLGLLIPGKDDNHILTGLLSLMTREGSDYTRTFRQLSQSEQLQSRSPLRDEFIDRDAFDSWYNVWRQRLL
    KEECSDEERQRTMKLANPALILRNYLAQQAIERAEQEDISVLARLHQALSRPYDEAPEFADLARRPPDWGKKLEVS
    CSS

    >gi|259908570|ref|YP_002648926.1| Glutathione peroxidase [Erwinia pyrifoliae Ep1/96]
    MNLYETELMTLDGEKTSLAQWQGDVLLVVNVASKCGLTPQYEALEHLQKTLHHQGLTVLGFPCNAFLEQEPGSEAEIKTF
    CRTTYGVTFPMFSKINVNGPQRHPLYAQLIAAQPEATAPENSGFAERMASKGRAPKQYGDVLWNFEKFLIARDGRVVARF
    SPDMAPNDPLLLASVEKALAK

    >gi|259908824|ref|YP_002649180.1| glutaredoxin 2 [Erwinia pyrifoliae Ep1/96]
    MKLYIYEHCPFCVKARMIFGLKNIPLELVVMLNDDEATPQRMIGQKMAPILMKDDGSCMAESLDIVHYVDALDHQPLLTG
    SSNAAIADWLRHIGGYVNKLLIPRVAEAPFAEFATPQARGYFKNKKQGVYGDFAELKEHSPGLIKNVNDDLRKLDKLIMQ
    PNAVNGELSLDDIHLFPLLRSLSLVAGIEYPTRVADYRDNMAKQTQINLLSSVAS

    >gi|259908833|ref|YP_002649189.1| hypothetical protein EpC_21850 [Erwinia pyrifoliae Ep1/96]
    MPVLHNLVSNEELKARMLAETEPRTTVSFYKYFTIQDPRAFRDALYIELTRLKVFGRVYVAAEGINAQISVPASQYEQMK
    STLYGFHPALDNLRMNIALDDDGKSFWVLRLKVRERIVADGITDESFNASDVGAYLKAAEVNAMLDDPDAVFVDMRNHYE
    YEVGHFDKALEIPADTFRDQLPMAVDMLQQEKDKKIVMY
    CTGGIRCEKASAWMRHNGFDNVYHIEGGIIEYARRAREQGL
    PVRFKGKNFVFDERMGERISDEVIAHCHQCGESCDNHVNCLNDGCHLLFIQCPACAAKFNHCCSPLCMEELALPPEEQRA
    RRAGRENGNKIFNKSRGLLSTTMHIPSAKE

    >gi|259908932|ref|YP_002649288.1| Thioredoxin reductase [Erwinia pyrifoliae Ep1/96]
    MPPFSLIVNKIAECFFCLVKFPTILSSVCQLNNEGLMSTAKHSKLLILGSGPAGYTAAVYAARANLNPVLITGLEKGGQL
    TTTTDVENWPGDAHELTGPGLMDRMHEHAVKFNTEIVFDHIHSVDLQHRPFRLTGDEGEYTADALIIATGASARYLGLPS
    EEEFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVEEALYLANIAAEVHLIHRRDSFRAEKILIDRLNEKVKNGNIILHT
    DYTLYEVLGDQMGVSALRLRSTKDDQTKELAVAGLFVAIGHSPNTAIFNGQLALENGYIKVQSGIHGNATQTSIAGVFAA
    GDVMDHIYRQAITSAGTGCMAALDAERYLDGLVKNNQ

    >gi|259908958|ref|YP_002649314.1| glutaredoxin 1 [Erwinia pyrifoliae Ep1/96]
    MFAVIFGRPGCPFCVRAKELAEKLTEDREDFNFRYIDIHAEGITKADLEKTVGKPVETVPQIFLDQTHIGGCTDFEAYAK
    ENLGLFQ

    >gi|259908970|ref|YP_002649326.1| molybdopterin biosynthesis protein MoeB [Erwinia pyrifoliae Ep1/96]
    MLPELSDEEMLRYNRQIVLQGFDFDGQERLKVARVLVVGLGGLGCAASQYLAAAGVGQLTLLDFDQVALSNLQRQILHGE
    AQVGMAKVDSARARLAAINSLIAIEPVNARLDDDGMAQLIARHQLVIDCCDNLDTREQLNRLCFASKMPLVSGAAVRMEG
    QISVFSWGRDEPCYRCISRLFGAATLS
    CVEAGVMAPLVGVIGSLQAMEAIRALTHYGSPIAGKLLLYDAMTLQFRTIRVA
    KDAGCEVCGDGGESSD

    >gi|259909067|ref|YP_002649423.1| Methylated-DNA-(Protein)-cysteine S-methyltransferase [Erwinia pyrifoliae Ep1/96]
    MAFCYKKMHSPLGELTLVASQSSLVAVMWADARLPGARFPSLGMEPRHAILTEAERQLQQYFTGRLQQFDLPLEFVGTSF
    QKQVWAALIAIPYGETRSYRQIAQQIGHPAAVRAVGAANGRNPLPIVAP
    CHRVIGSNGKLTGFAGGLATKAFLLRLEDGQ
    RWGEEVL

    >gi|259909169|ref|YP_002649525.1| Osmotically inducible protein C [Erwinia pyrifoliae Ep1/96]
    MTIHKKGQAHWEGNIKQGKGTVSTESGALSQQPYGFNTRFEGKPGTNPEELIGAAHAACFSMALSLMLGEAGHTPESIDT
    TADVSLDKVDGGFAITKVALQSKIALPGIEKSTFDGIIQQAKAG
    CPISKLLNTEITLDYQLEN

    >gi|259909195|ref|YP_002649551.1| Putative thioredoxin-like protein [Erwinia pyrifoliae Ep1/96]
    MSSQAQIVEINETNLHQTLEQSMQVPVLFYFWSERSQHCQQLTPLLDRLAQEYAGQFVLARLDCDAEPAVAQQFGLRSIP
    TVYLFQNGQPVDGFQGPQPEEAVRALLEKVLPKEEELKAQQAMQLMDENKLIEALPLLKDAWALSKQRSDIGFLLAEVLI
    GLNRSEEAEAVLNVVPLQDQDTRYQGLVAQIDLLKQAADTPEIQQLQQQIGAEPDNAELATQLALQFHQVGRNEEALELL
    FSHLKQDLTAADGQARKMLQEILAALGTGDALAAKYRRQLYSLLY

    >gi|259909199|ref|YP_002649555.1| copper exporting ATPase [Erwinia pyrifoliae Ep1/96]
    MSQVTLLTLDGLSCGHCVKRVKEALEQRADVEQAEVSIAEARVSGSASAGALIATVAGAGYHASLAETPARPKADPLTDS
    DIQPEALTAATSELPAQQSESVQLLIEGMN
    CASCVSRVQNALQNVPGVSQARVNLALHSALVLGCALPGALIEAVSRAGY
    GAEIVEDETERREKQQQSAQAAVTRFRWQATLALALGVPLMVWGMGGGNMMLTAANRGGWLVAGVLTLLVMIVAGGHFYR
    SAWNSLLNRSATMDTLVALGTAAAWLYSITVNLWPELFPMAARHLYYEASVMIIGLINLGHMLEQRARQRSSQALEKLLD
    LTPPTARVVTEGGEQLRPLSEVQLGMTLRVMTGDRVPVDGTIVQGEAWLDEAMLTGEAIPQLKSPGDTLHAGTVLQDGSV
    LLRAGAVGKNTTLARIIQLVRQAQNSKPEIGQLADKISAVFVPVVMAVALLSAAVWFLFGPAPQLVYTLVVATTVLIIAC
    PCALGLATPMSIIAGVGRAAEFGVLVRDADALQRASTLDTLVFDKTGTLTEGTPRVVEVVLFNQADRQTVLQQAAALEQG
    ASHPLARAIVAHAGLATLPDVEQFRTLAGKGVSGVLDGRALLLGNAALMAQQQIATDAVSTQMSQLAAKGATPVLLAADG
    KIVALFAIRDALRKGSVSALQRLHQRGYRLVMLTGDNEITASAIAREAGIDRVIAGVLPDGKAAAISALQRQGQRVAMIG
    DGINDAPALAQADVGIAMGGGSDVAIETAAMTLMRQDLNALVDGLAIAKATLRNMKQNLLGAFIYNACGIPLAAGVLYPL
    TGTLLSPVVAGAAMALSSITVVSNANRLIRYRPPK

    >gi|259909291|ref|YP_002649647.1| Putative alkyl hydroperoxide reductase subunit C [Erwinia pyrifoliae Ep1/96]
    MVLVTRPAPDFTAAAVLGNGEIVENFNFKKHTAGKATVVFFWPMDFTFVCPSELIAFDKRYAEFQKRGVEVVGVSFDSEF
    VHNAWRKTPIDKGGIGEVKYAMVADIKREIQKAWGIEHPEAGVALRGSFLIDQAGVVRHQVVNDLPLGRNVDEMLRMVDA
    LQFHEEHGDVCPAQWEKGKEGMGASPDGVAKYLSENAAKL

    >gi|259909425|ref|YP_002649781.1| Thiol:disulfide interchange protein [Erwinia pyrifoliae Ep1/96]
    MFTQVNRYTLLCLFCFSAVFFPPANAASYKENDQYFVQEKSATTVPDVVEFFSFYCGPCFQFSHTYKVTDVISENLPSAT
    RLTKYHVGLMGPLGHELTEAWSVAMVLGIEHKVEKLLFEKIQQERSVNSVADIMKVFSSVGVEAGQYENTRRSLPVQALV
    KKQDDAVETLNVTSTPSFYVSGKYRVNNAAITSTSADDYAKEFAGIIRFLLEKQP

    >gi|259909554|ref|YP_002649910.1| thiol:disulfide interchange protein DsbC [Erwinia pyrifoliae Ep1/96]
    MKKHYLLLSVILAAASGLANADDAAIQQSLSKLGLQQTEIQPAPLPGFKTVLSESGVLYITDDGKHFIQGPLYDVSGGRP
    VNVTNKLLEKKVDALSKEMIVYKAAKEQHVVTVFTDIT
    CGYCHKLHQQMADYNALGITVRYLAFPREGMEGPVAKKMKSI
    WCAADRNKALDAAMKGEDVKATDCKIDLAQQFKLGAQYGIQGTPAMLLQDGTLVPGYQGAQELKKFLDGQKNGD

    >gi|259909609|ref|YP_002649965.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Erwinia pyrifoliae Ep1/96]
    MHMKKNLGALAAAAILSLTLPVTSALAALQVGEKAPDFQLKAALAGKPTTFSLRQSLQKGPVVLYFFPAAFSAGCTLEAH
    AFAEATDEFKKQGATVIGVTAGNVDQIAQFSQLECRDKFTVAADPGAKVAGEYQSTMRFNGKTLSDRISYVIAPGGKILL
    NYSDKNPEAHIQKAIDAVKTYRQANPA

    >gi|259909611|ref|YP_002649967.1| putative thio:disulfide interchange protein, fragment [Erwinia pyrifoliae Ep1/96]
    MLERQAGSLALAAILACCIALSFAAWLYGKAQQRRMMGKRHWAMHIASAAFILLTVPPLAHIEAFSRPVSQTETAEAAAT
    VVWSPQKVDAVKGQGQPVLVNFTASW
    CITCQVNDRSSLSTPAVKAAMARTGTIYMVADSTKYNPDVELALSDFGRGGLPL
    YVVYPADGGKPVVLPQVLTPRIVISALEHAAAGGKKA

    >gi|259910067|ref|YP_002650423.1| Thiosulfate sulfurtransferase [Erwinia pyrifoliae Ep1/96]
    MDQFECINIRQAQQKLAGGNALLVDIRDAQSFAAAHASGAFHLSNESLPLFIAQSDLSLPVLVMCYHGNSSKGAAQYLLG
    QGFSAAYSIDGGFEAWRTAFPQQVSAQ

    >gi|259910118|ref|YP_002650474.1| zinc/cadmium/mercury/lead-transporting ATPase [Erwinia pyrifoliae Ep1/96]
    MQQHSSCGCGHHHANKQPGCATRSRPVIKKVTAVSAETPCCGDADCGLADSPDEEADRLAQTARFSWRVQGMDCPSCAQK
    VETAVKQLANVSAARVVFASEKLLVDASDDVRSQVEQAVARVGFRLQRSDAAAPAVEARFWQENRSALVLALLMAASWLL
    GIIHPGAGTFAFTLTTLVGVCPVAHRALRLIRSGSPFSIETLMSVAAIGALFIGATAEAAMVLLLFTLGERLESFAAGRA
    RKGVTALMALKPDQALRIRCGQRESVAVSDLRPGDVIEVAAGGRLPADAKLLSPFASFDESALTGESVPVDRQQDEAIAA
    GSMSVDRPVQLEVISEPGRSAIDRILHLIEEAGERRAPIERFLTRFSRIYTPIVMVLALAVALLPPLLMATAWQPWIYKG
    LTLLLIGCPCALVISTPAAVTSALAAAARRGALIKGGAALENLGNVRTIAFDKTGTLTEGKPQLTAIIALDGSDENRLLA
    IAAAVEQGSSHPLARAIVAAADARQLAVPAASDRRVLAGSGIQAVVSNRLLSVSSPHRLPENLLAQRHKEIEALENGGNT
    VVILHDERQLLAIVVLRDTLRADARGALAELQALNIQAVMLTGDNPRAAAAIAAELGIDYRASLLPEDKVNAITRLQQQQ
    AVAMVGDGINDAPAMKAATIGIAMGSGSDVALETADAALPHNRLAGLATMIRLSRAAHANIRQNIALALGLKVLFLITTL
    LGITGLWLAVLADSGATALVTANALRLLGKR

    >gi|259910159|ref|YP_002650515.1| glutathione reductase [Erwinia pyrifoliae Ep1/96]
    MTKHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKDLGGTCVNVGCVPKKVMWHAAQIAEAIHNYGPDYGFDTTVNQFS
    WNVLVKNRSAYIDRIHTSYDNVLGKNKVDVVKGFARFVDARTVEVNGEKITADHILIATGGRPSLPAIPGAEYGINSDGF
    FELDALPKRTAVVGAGYIAVEIAGVLNALGSETHLYVRKHAPLRSFDPLIVDTLVEVMNSEGPTLHTESTPKAVVKNADG
    SLTLQLENGKEQTVDCLVWAIGREPMTDNLNLDVTGVKLNDKGYINVDKYQNTNVKGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNDKPDEHLDYSNVPTVVFSHPPIGTVGLSEPEAREKFGDDQLKVYTSSFTAMYTAVTQHRQPCRMKLVCVGEEE
    KIVGIHGIGYGMDEMLQGFAVALKMGATKKDFDNTVAIHPTGSEEFVTMRG

    >gi|259910237|ref|YP_002650593.1| Organic hydroperoxide resistance protein [Erwinia pyrifoliae Ep1/96]
    MSLEKVVYTAKAKATGGRDGRATSSDGVLDIKLGVPKEMGGAGGEATNPEQLFAAGYSACFLGAMKFVAGRDKFTMPKDA
    FIEGEVGIGPLPTGFGIEATLNIHLPGMDSTAAQKLVDAAHIV
    CPYSNATRGNIDVTLNIIN

    >gi|259910341|ref|YP_003208073.1| Thiamine biosynthesis protein ThiF [Erwinia pyrifoliae Ep1/96]
    MSRYQRQSMLPEIGESGQRRLAQARVLVIGAGGLGSALLPLLAAAGVGYLRLYDGDRVEEHNLHRQTLYGMQDIGEEKVF
    CARRALATRNPECVVDARPHALTASATEVALAGIDLAIDAADNFALTYPLSDACLAQRIPLVSASVLGRRGYVGGFCGGA
    PSYRALFPRLPDSAAN
    CNTAGVMGPAVATLGAMQAQMALSILLNFSPSPLGCLVNCDFAQWHFRQLRFDSATEPDHPPVP
    FIDRHLLTPEDCIVELRSVNEAPESVADAVQRVLPQQLSGWQPPAERRIVLVCASGIRAAKAAMALELRGFSHLAIIAAG
    R

    >gi|259910360|ref|YP_003208092.1| Peptide methionine sulfoxide reductase [Erwinia pyrifoliae Ep1/96]
    MATEYAIIAGGCFWCTEAVFKQINGVESVESGYIGGHTENPTYKQVCHGDTGHAEAIRIGFDPEKVSFGDLLDISFATHD
    PTQLNRQGNDIGTQYRSAIFPTGAQQAEEAKAAISRAQSEHSDPIVTSIEADAVWYPAEDYHQDYWAGEGQENRYCLAVI
    PPKLQKLRKRFAAYAVSK