Erwinia billingiae Eb661 uid50547

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300781842|ref|YP_003739077.1| arsenate reductase [Erwinia billingiae Eb661]
    MQRLIGVPLMTDITIYHNPACGTSRNTLALIRNSGTEPTVILYLETPPSRDELKKLIADMGISVRTLLRKNTDPYGQLGL
    AEDRFTDDELLDAMLAHPILINRPVVVTPLGTKLCRPSEVVLDILPDPQQGAFIKEDGEAIIDEQGNRVSR

    >gi|300713351|ref|YP_003739390.1| DSBA oxidoreductase [Erwinia billingiae Eb661]
    MKHTMKAAMTAALLCCLSSAGAAQPAGTFTPEQQAQIGRIAGDYLLAHPEILLQVSQKLQAQQAERQSLAMRAAAVKLPG
    PLTTDPDVPAVGPDGARVAVIEFFDYQ
    CVFCSRMAPVVEQVMKARPDVKYIFKDWPIFAGKWETSRTAAERGLQVWKQKG
    PSAYMTYHNGIYATGHDEGQLTQADIDRVSATAGFDPKAPADISAEAVTGRNDGLAQATGLTGTPGFIIMPLSGATTENT
    TVLGGAVPAEQLQAAIDRAAN

    >gi|300714613|ref|YP_003739416.1| Thiol:disulfide interchange protein DsbA [Erwinia billingiae Eb661]
    MKKIWFALVGLVLAFSASAAQFTDGQQYVTMQKPVAGEPQVLEFFSFFCPHCYEFEHVWHVSDAVKKALPADTKVTKYHV
    EFLGGEMGKTVTQAWAVAMALGVEDKVTAPIFDGIQKTQTITDAASLKDVFVKAAGITPEAYDGAWNSFVVKSLVAQQEK
    AAADVQLQGVPAMFVNGKYMVNNGGLDTSSMDNYVQQYANVVKFLLTQK

    >gi|300714673|ref|YP_003739476.1| hypothetical protein EbC_00850 [Erwinia billingiae Eb661]
    MQDIMQFAGSHTILSLAWVVLLVLVIVTTVKGMFSKIKTISRGEATRLINKEEAVVVDVRGRDDYRKGHISNAINVLAAD
    IKKGSFGELEKHKAQPIIVV
    CANGTSAAEPAAQLNAAGFENVSILKDGVSGWSGENLPLVRGK

    >gi|300714730|ref|YP_003739533.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
    MSERIDYTQVAPAGMKALGGVYNYVAQCGLPQDLIELVFLRVSEINGCAYCIDMHTKALHKGGLPWDKIVLTQVWREAGD
    WFTSREKAALAWAESLTLIAQSHAPDAVFAEVEAAFSEKEISDMTIAIGLMNAYNRLAISHRKLPDSAPR

    >gi|300714761|ref|YP_003739564.1| Putative peroxiredoxin/glutaredoxin family protein [Erwinia billingiae Eb661]
    MFASQEGKSVPQVTFHTRQGDNWVDVTTDELFKDKTVILFSLPGAFTPTCSSSHLPRYNELSDVFKKHGVDSILCVSVND
    TFVMNAWKADQHASNITFIPDGNGDFTRGMEMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTML
    RYLAPEFKVQESVSLFTKPG
    CSFCAKAKQMLQDRGIQYEEIVLGQDATTVSLRAVTGRATVPQVFIGGRHIGGSDDLEKF
    FVA

    >gi|300714763|ref|YP_003739566.1| Soluble pyridine nucleotide transhydrogenase [Erwinia billingiae Eb661]
    MQQSYDYDAIVIGSGPGGEGAAMGLLKQGARIAVIERYHNIGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDQTRLLR
    SSFADILNHTENVISQQTRMRQGFYERNRCELYQGDARFIDANTIEIASHDGSLERLTAEKFVIACGSRPYHPADVDFTH
    PRVYDSDSILNLHHEPGHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDHLLAFLDQEISDSLSYHFWNSGVVIRHNEEF
    EKIEGVSDGVIMHLKSGKKVKADCLLYANGRTGNTDSLSLENVGLEADGRGLLKVNSMYQTAQPHIYAVGDVIGYPSLAS
    AAYDQGRIAAQALIKGEANAHLIEDIPTGIYTIPEISSVGKTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKILF
    HRETKEILGIHCFGERAAEIIHIGQAIMEQKNGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|300714782|ref|YP_003739585.1| Thioredoxin 1 [Erwinia billingiae Eb661]
    MSSDKIVHLTDDSFDSDVLKAEGLTLVDFWAEWCGPCKMIAPILDEVAEEYDGKLTIAKLNIDDNPGTAPKYGIRGIPTL
    LLFKNGEVAATKVGALSKGQLKEFLNANLG

    >gi|300714853|ref|YP_003739656.1| ThiF protein [Erwinia billingiae Eb661]
    MFSDNDFLRYSRQLLLEEFGLDGQQKLQAGSVLIIGLGGLGSPAALYLAAAGVGKLVLADDDSVHISNLQRQVLFRTNET
    GQSKVAVAKKHLQSLNPQVEFIALAQRMMAESLREVVQQVDLVLDCSDNMETRHAVNAACVEQGKRLVSASAVGFGGQLL
    VLTPPFEHGCYRCLWPDEDEPQRN
    CRTAGVLGPVVGVMGTLQALEALKMLAGQPSCLDGKLRLFDGRQQTWRTLSLQRSV
    DCPVCGVSDENRG

    >gi|300715013|ref|YP_003739816.1| Thiol:disulfide interchange protein DsbD [Erwinia billingiae Eb661]
    MSKRITTLIFILFTTLFSLNAAASLFGQNGNHFGTVDQAFAFDFNQQANTLTLSWQVKPGYYLYRQQIKISANGAKLADF
    TLPEGTPHEDEFYGKTEIYPESLTLPLILQQADKGATVSVTYQGCAAAGFCYPPETRSVPLDEVKAGDATPASQAAASTP
    APVSVQTAPTENLPFSPLWALLIGIGVAFTPCVLPMYPLISGIILGGNRQYSAGRLFALAMVYVQGMALTYTVMGVIVAA
    AGLRFQAALQAPAILIGLSLLFILLALSMFGLFTLQLPSSLQTRLALWSNRQQGGSLTGVFLMGALAGLICSPCTTAPLS
    AILLYIAQSGNMLAGAGTLYLYALGMGLPLIAVTVFGNRLLPKSGAWMQTIKEGFGFVILALPVFLLERVIGDQWGLRLW
    SLLGVAFFGWAFISLKSNNGWLRLGQIVMLAAALVAARPLQDWAFASPGQNAAIAHLNFTRISDTEQLSHALQNAQGRIT
    MVDLYADW
    CVACKEFEKYTFSQPEVQNALGHTQLLQADVTANNAQDSALLKQLQVLGLPTILFFDANGHEIPHSRVTGFM
    DAAAFQQHLQKLAQ

    >gi|300715337|ref|YP_003740140.1| Dihydrolipoyl dehydrogenase [Erwinia billingiae Eb661]
    MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERFSTLGGVCLNVGCIPSKALLHVAKVIEEAKALEEHGIVFGKPQ
    TDITKIRTWKEKVINQLTGGLAGMAKGRKVKVVTGLGKFTGANTLVVEGENGATTINFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKEVPERLLVMGGGIIGLEMATVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVTA
    VEAKDDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKGLDAGQAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEMFEGSITDLPNPKAKKK

    >gi|300715523|ref|YP_003740326.1| Suppressor for copper-sensitivity D [Erwinia billingiae Eb661]
    MAKGRRILRDLLLLLMMMAVLFTVIDFFRAPQAPTGFADIPLHTIDGRDVTLAELSMKKPLLVYFWASWCGICRYTTPDV
    VKLSDNGSNVLTVAIRSGDDSRVVRYLNGKHLTLPVVNDPQGSMAANWDVSVTPTLLVVSKGQVVQSTTGWTSYWGMKLR
    LWWAQKKH

    >gi|300715524|ref|YP_003740327.1| Secreted protein, suppressor for copper-sensitivity C [Erwinia billingiae Eb661]
    MKKLLITLLLASSPVLAAPPFTPEQEVRIRELIRETLVENPKILAEAADAYDKQAQKEQGAVIAQVIEQNKAALFEDESS
    PRLGSKQAKVTLVNFTDYN
    CVYCKQFDPELEKLVKNYPDVAVVIKPLPYRSETSLTAARQALMFWREKPAQFWALHQRLM
    AKKGYHDEASIKAAEKKVGLSFIEPDRRSTETINSNLQLAQHLGVSGTPATLIGEQMVSGAIPYEQLEALVKVQLEQVK

    >gi|300715525|ref|YP_003740328.1| Membrane protein, suppressor for copper-sensitivity B [Erwinia billingiae Eb661]
    MQYLFRTLLVVLLSLWLPALQAADSGWLTTPQNDHAQVRVRADNASEGSTRVLLDIKLQDGWKTYWRSPGEGGIAPEIRW
    DGSPPAARWFWPVPQRFDVAGLTTQGYHHQVALPITMAGKVRDRLSGTLTLSTCSNVCILTDYPFSLAMQRPSDKRFAHD
    FAEAMGQVPVANVLTDTLQAGYQSGKLQITATRAGGWRQPDLFIDDRSDASFGKPALTIKGDTLQAVVPVSDQWGEGAPD
    LQGETVSLVLADGGLAQQSELKIGPPVASIGGGIALWQVVLMALAGGFILNLMPCVLPVLGMKLGSILQVEQRNKRTVRL
    QFIASSAGIIASFMALALLMTVLRLSNHALGWGIQFQNPWFIGFMVLITLLFSANLFGLFYFRLPSSLSTRLATHNGDGI
    AGHFWQGAFATLLATPCSAPFLGTAVAFALAASLPMLWGIFIALGIGMSLPWLLIALFPALALKLPKAGRWMNGVRIAMG
    VMMLASCLWLVSLLFSHQGVSFTLMDDHINWQPLSEQAITNALATDKRVFIDVTADW
    CITCKANKFNVLMRPDVQQALQS
    GDVVALRGDWSRPSAVINTFLKRRGSVAVPFNQVYGPGNPQGTVLSPLLDRQQLLTALSDAKGKAK

    >gi|300715559|ref|YP_003740362.1| alkyl hydroperoxide reductase subunit C [Erwinia billingiae Eb661]
    MVLVTRQAPDFTAAAVLGNGEIVENFNFKKHTAGKATVVFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEF
    VHNAWRKTPIEKGGIGEVKYAMVADIKREVQKAYGIEHPDAGVALRGSFLIDKAGVVRHQVVNDLPLGRNVDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKEGMGASPDGVAKYLSANAAKL

    >gi|300715644|ref|YP_003740447.1| Copper-exporting P-type ATPase A [Erwinia billingiae Eb661]
    MSQTTLLALDGLTCGHCVKRVKEALEQRADVEQADVSIAEARISGSADASELIATVEQAGYHASLAQDDSFPKAEPLTAS
    DTQPEALTADSHQLPAPQASSAEAAPLAHAEPLTASAAPAASFHLLIDGMS
    CASCVSRVQNALQQVSGVSQARVNLAERS
    ALVMGDAAAESLIDAVKNAGYTAEIIEDDVERREKQQQTARQAVRRFRWQAALALTLGIPLMLWGMVGDNMMLTDSNRNG
    WLAVGLTTLLVMVLAGGHFYRSAWRSLLKGTATMDTLVALGTAAAWLYSISVNLWPDFFPPQARHLYYEASAMIIGLINL
    GHMLEQRARQRSSKALEKLLDLTPPTARVVTADGERVLPLSDVQPGMTLRLTTGDRVPVDGTLSQGEAWLDEAMLTGEAM
    PQQKVAGDEIHAGTLMQDGSVLFTASAVGKNTTLARIIHSVRQAQSSKPEIGKLADRISAVFVPAVVAIALISAAIWYVV
    GPAPQVVYTLVIATTVLIIACPCALGLATPMSIIAGVGRAAEFGVLVRDADALQRASTLSTLVFDKTGTLTEGTPRVVDI
    MLFNGANEQQAIGWAAALEQGSSHPLARALQEKAGGQTLPTVEQFRTLAGKGVSGKVSGVELWLGNRALMDQQQIDSVSL
    NARIDRQAAKGITPVLLAADGKIVALFSVRDPLRKESVSALKRLRERGYQLVMLTGDNEITAQAIAREAGMDRVIAGVLP
    EGKAEAIRALQQQGQIVAMVGDGINDAPALAQADVGIAMGSGSDVAIETAGITLMRHDLNAVVDALAIAKATLRNMKQNL
    LGAFVYNALGIPIAAGVLYPLTGTLLSPVVAGAAMALSSITVVSNANRLIRYQPPAE

    >gi|300715656|ref|YP_003740459.1| thioredoxin-like protein [Erwinia billingiae Eb661]
    MSPQAAIVTINETNLQQTLEQSMQVPVLFYFWSARSQHCQELSPVLERLAQEYAGQFILAELDCDAEPAVAQQFGLRSIP
    TVYLFQNGQPVDGFQGPQPEEAIRALLDKVLPKPEELKAQEGMQLMDEGKVLDALPLLKDAWQLSNQNSEMGFLLAEALI
    ALNRSEEAEQVLSVVPLQDKDTRYQGLMAQIDLLKQAADTPEIQQLQQQLEAEPENAELATKLGLQLHQVGRNEEALELL
    FTHLKKDLGAANGQARKMLQEILAALGTGDALAAKYRRQLYSLLY

    >gi|300715724|ref|YP_003740527.1| thio:disulfide interchange protein [Erwinia billingiae Eb661]
    MLTAILSAFLGGIILNFMPCVFPVISLKALGLLRHQGSSSAARAEGLAFLAGVVVTMMALAGILLAARATGDAVGWGFQL
    QSPLVIAILALIILGAALNLLGVFEVGLSLQRAGEIEVGRSALVRSALTGALSIVVATPCSAPFMASAIGYALVQPPAVS
    LAIFFSLALGFAAPFTLVSLFPQLAKRLPRPGAWMDVLKHGLAFPMFGAYAWLVWVLAQQAGTGALATILACSVLLGFAG
    WLYGIAQKRRFREKSHKLLYAVTAALLVAVIAPVTGIIQPGAPLPDGQTAAAVTQVKWSPQTVAETRGHGKAIMVDFTAS
    W
    CITCQVNQRTTLSTTAVKEALLRTGTVYMVADSTKFNPDIDDAMNEFGQGGLPLYVVYPADGSAPKVLPQVLTPSIVVN
    ALNQASGKKA

    >gi|300715725|ref|YP_003740528.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Erwinia billingiae Eb661]
    MNRTKKLLCSVTAAAVMSLAMPTLNAYAALPVGAQAPDFKLQGALAGKPLTFSLQQALAKGPVVLYFFPVAFSKGCTIEA
    HDFAEATDGFKKLGASVVGVTAGNTEQIGEFSKLECRDKFTVAADPGAKVASEYQTTMQIKGKTVSDRTSYVIAPDGKIL
    LSFTDRNPDTHIQKAMDAVKQYSASHS

    >gi|300715774|ref|YP_003740577.1| DSBA oxidoreductase [Erwinia billingiae Eb661]
    MSKPLQIDFVSDISCPWCIIGLQGLEQALAELGPDVQANITFQPFELNPSMAAEGQDLVEHIAEKYGSSPEESAENRQRI
    RERAEAVGFEMNNAGPGLRIYNTFDAHRLLHWAEGFGLQQPLKHALFTAYFTDGENPSSHVVLVNVAEDVGLDPVEAAEV
    LATNRYADEVRALEREWVDAGIQSVPSIVFDRQYLLSGGQPPEAFKSAIENILQQRETAAS

    >gi|300715893|ref|YP_003740696.1| Putative methylated-DNA-protein-cysteine methyltransferase [Erwinia billingiae Eb661]
    MSYFCKVMPSPVGALTLIASDLGLTAILWQDDNPNRVRLPDMQENPTHPVLVETERQLNEYFAGTRTTFTMTLDFVGTEF
    QKKVWQALVAIPFGETRSYADIARDIGNPKAVRAVGAANGKNPISIIAP
    CHRVIGSNGKLTGFAGGLEVKAFLLKIETAK
    QGEAEFTLK

    >gi|300716022|ref|YP_003740825.1| Molybdopterin synthase sulfurylase MoeB [Erwinia billingiae Eb661]
    MLPELSDEESLRYNRQIVLRGFDFDGQEKLKAAKALIVGLGGLGCAAAPYLASAGVGQLTLLDFDTVSLSNLQRQILHRD
    SAIGQAKVDSARQQLSQINPHIRLDAINQQLDDAQLAELIGQQDVVLDCTDNVATREQLNRLCYASKTPLVSGAAIRMEG
    QIAVFRWQQDEPCYRCISRLFGDATLS
    CVEAGVMAPLVGVIGSLQAMEAIRVLSDFGNPVPGKLLMYDAMTLQFREMKVA
    KDPACEVCGH

    >gi|300716039|ref|YP_003740842.1| Glutaredoxin 1 [Erwinia billingiae Eb661]
    MFAVIFGRPGCPYCVRAKELAEKLTAEREDFSFSYVDIHAEGITKADLEKTVGKPVETVPQIFLDEKHIGGCTDFEAYAK
    ENLGLFQ

    >gi|300716068|ref|YP_003740871.1| Thioredoxin reductase [Erwinia billingiae Eb661]
    MSTAKHSKLLILGSGPAGYTAAVYAARANLNPVLITGLEKGGQLTTTTEVENWPGDPNDLTGPALMERMQEHAEKFNTEI
    IFDHIHTVDLQTRPFRLTGDSAEYTADALIIATGASARYLGLPSEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLANIAAEVHLIHRRDSFRAEKILIDRLMEKVRNGNIVLHTNQTLDEVIGDQMGVSSLRLRSALDDQQTEELNVAGL
    FVAIGHSPNTGIFKDQLELENGYIKVQSGLQGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERFLDGLVKN
    SQ

    >gi|300716197|ref|YP_003741000.1| hypothetical protein EbC_16180 [Erwinia billingiae Eb661]
    MPVLHNLVSNEELRARMLAESEPRTTVSFYKYFTLDDAKAFRDALYVALTKLKVFGRVYVASEGINAQISVPASQYETMK
    AMLYAFHPALDNLRMNIALDDDGKSFWVLRLKVRERIVADGITDDTFDASDIGGYLKANEVNAMLDDPDAVFVDMRNHYE
    YEVGHFDNAMEIPADTFRDQLPMAVEMLKDDKEKKIVMY
    CTGGIRCEKASAWMRHNGFENVYHVEGGIIEYARRAREQGL
    PVRFKGKNFVFDERMGERISDDVIANCHQCGAACDTHVNCKNDGCHLLFIQCASCAEQYKECCSPICMEELALTPEEQRA
    RRAGRENGNKVFNKSRGKLTMTLKIPSAE

    >gi|300716206|ref|YP_003741009.1| Glutaredoxin 2 [Erwinia billingiae Eb661]
    MKLYIYDHCPFCVKARMIFGLKNLPVELVVMLSDDEALPKKLIGQKMAPILMKEDGSCMPESLDIVHYIDNKDREPLVTG
    KTNPAISDWLRHINSYLNKLLLPRIAEAPFAEFATPEARRYFKEKKEANLGSFAELKLHAEGYIKNVNDDLRKLDKLIVK
    ANAVNGELSMDDIHLFPVLRSLSLIAGVEYPSRVADYRDNMAKQTQVTLLSSIAS

    >gi|300716467|ref|YP_003741270.1| Glutathione peroxidase [Erwinia billingiae Eb661]
    MTIFDTKLETLDGEQTSLANWQGDVLLVVNVASKCGLTPQYEQLEALQKNWQEKGFSVLGFPCNAFLGQEPGSAEEIKTF
    CSTTYGVTFPMFSKIEVNGPDRHPLYQQLVAAQPTASAPDNSGFLERMSSKGRAPKEPGDILWNFEKFLIGRDGTVIQRF
    SPDMEPADPLIESAIKQALAK

    >gi|300716471|ref|YP_003741274.1| conserved uncharacterized protein YdiU [Erwinia billingiae Eb661]
    MQFTNTWHQELEGFYTALTPTPLKNPRLLYHSAGLAAELGLDDSWFAADKIGIWSGESLLPGMQPLAQVYSGHQFGVWAG
    QLGDGRGILLGEQRLEDGRKMDWHLKGAGLTPYSRMGDGRAVLRSSLREFLASEAMYHLGVPTSRALTVVTSDEPVYRET
    TERGAMLLRVAESHLRFGHFEHFFYNQQPEKVRELADYAIRHHWPQWQDEEDRYRLWFTDVVRRTARLIAHWQSVGFAHG
    VMNTDNMSILGLTLDYGPYGFLDDYKPDFICNHSDYQGRYSFENQPVVGLWNLNRLAHALSGLMTTEQLKQALAEYEPEL
    MRCWGQQMRAKLGFTTQGKHDNDILTGLLALMTKEGSDYTWTFRQLSDSVQQGSTSPLRDEFIDREAFDSWYNIWRQRVL
    EEERSDEDRQQQMKQANPAIVLRNYLAQQAIEQAEKDDISVLSRLHQALSQPYADAPEFADLMQRPPDWGKKLEVS
    CSS

    >gi|300716479|ref|YP_003741282.1| Iron-sulfur cluster assembly scaffold protein [Erwinia billingiae Eb661]
    MPSATTASFSPDDYVWKGLTITDSAAKQIIVLAADDAQVKGLKLGVKTSGCAGFGYTMDMVKEPADDDLVFTHQGAHLYV
    PLQAMPFIDGTEVDFVREGLNQIFKFNNPKAQHACGCGESFGVE

    >gi|300716495|ref|YP_003741298.1| Putative glutaredoxin protein [Erwinia billingiae Eb661]
    MSTIEKIERQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILLNPEIRAELPKYANWPTFPQLWIDGELV
    GGCDIIIQMYQQGELQQLIKDTAQKYPSDAAE

    >gi|300716513|ref|YP_003741316.1| Glutathione S-transferase [Erwinia billingiae Eb661]
    MKLYYKAGACSLSPHIVLQETGLDFTLVAVDLQSKKTEQQEDYLLTNPKGQVPALLLDDGTVLTEGVAIVQYLADLKPDR
    HLLAPTGHLTRYQTVEWLNFIATELHKTISPLFGSATPEAYKTQLREKLHGKFSWVNQQLEGKQWLMGLKFSVADAYLFT
    MVRWAKALKLDLAGFEELESWFTRVAERPAVEAALKAEGM

    >gi|300716523|ref|YP_003741326.1| Electron transport complex protein [Erwinia billingiae Eb661]
    MSEAKTLIVGGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTCTNSAISASRRWVPADIRIPIYVMIIAAVV
    SCVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVVGRAEAVASKSSVALSALDGCFIGLGATSVMVVLGSLREIIGNGTIFNG
    ADQLLGPWAKVLRIQVFHFDSPMLLAMLPPGAFIGLGMLLAAKYVIDNKLKARAALKAAQEAQSLPEGKASAL

    >gi|300716528|ref|YP_003741331.1| Electron transport complex protein [Erwinia billingiae Eb661]
    MTEYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAIGMGLATTFVITLASICAWLVNHFILLPLDLVYLRTMAYILV
    IAVVVQFTEMVVRKTSPDLYRLLGIFLPLITTN
    CAVLGVPLLSVNLNHTFLQAALFGFSGALGFSLVMVLFAGIRERLVL
    AEVPAPFKGSSIALVTAGLMALAFMGFTGLVKF

    >gi|300716560|ref|YP_003741363.1| Peptide methionine sulfoxide reductase [Erwinia billingiae Eb661]
    MTIEYATIAGGCFWCTEAVFKQITGVVSVESGYIGGHTSNPTYRQVCDGNTGHAEAIRLGFDPEKVSYGDLLDISFATHD
    PTQLNRQGNDIGTQYRSAIFPADEAQAEEAKAAIVRAQEDQTSPIVTTIEGPAEWYPAEEYHQNYWEGEGQQNRYCLAVI
    PAKLQKLHKRYADRTK

    >gi|300716602|ref|YP_003741405.1| Osmotically inducible protein C [Erwinia billingiae Eb661]
    MTIHKKGQAHWEGDIKQGKGTISTESGALKEQPYGFNTRFEGKPGTNPEELIGAAHSACFSMALSLMLGNAGFTPESIDT
    VADVSLDKSGDGFKITKIALQSQVKLPGIDSSKFDEIINQAKAG
    CPVSQVLNAEITLEYKLN

    >gi|300716634|ref|YP_003741437.1| conserved uncharacterized protein [Erwinia billingiae Eb661]
    MTTATDLLASLADIAPDSELAQARNTREAATRHAQGSYEVIFSQQDADFPLAERFALAARVAEWNAQPTLQAHYQPQAGA
    LDNSPRHELALAWAHRLTFEPVSATPEHLQALQAAGWTARGIVTLSQLVAFINFQSRLRAGLQLLQGHASTANALPVVAG
    VWHQAATTASGKTALTAFTQQDLGWEPWLAAKPLTEFTDEEKQVLAKFGHSDSDYFRLLARNLPVLEQRTLTDKGIFFTS
    GGLPRADRELAAAVVSKVNGCIF
    CASVHARKASQLSKDFDSVEKLIGVAPGGKLSEGQSARWAAIIDFSAALSVTPQQAT
    LGQIVALQQQGLDTLALLDVIQSSAFFAWANRLMLTLGEPFIPSDV

    >gi|300716875|ref|YP_003741678.1| Thiol peroxidase [Erwinia billingiae Eb661]
    MSQTVHFQGNPVAVAGQIPEKGEAAKPFTLVAKDLSEVSLTQYAGKRKVLNIFPSVDTGVCATSVRKFNQLAGEVSNTVV
    LCISADLPFAQSRFCGSEGLSNVVTLSTLRGSDFKQDYGVAIADGPLKGLAARAVVILDEQDKVIYSQLVNEITTEPEYD
    AALAALK

    >gi|300716893|ref|YP_003741696.1| Glutaredoxin 2 [Erwinia billingiae Eb661]
    MKLYVYDHCPFCVRSRMIFGLKDVACEIVTLPNDDEATPTRLIGKKMLPVLVTESNEAIGESLDIVNYIDATYGSPMLTG
    SENSAIEGWMDDASTRIYQLAVPRWASSDFEEFRQAPARQYFTAKKEAVFGPFPSLLEQTDSLVAEMNEKLAALETLISV
    TKRDGETLSLTDIRLFPLLRSLSIVKGMHWPPRVDAWRREIALRSQVNLNDDIAI

    >gi|300716919|ref|YP_003741722.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
    MEQRRFPGNSHWYHETQSTLTPHAAPLFPEAAEIEDRFLLGLAQQYADTLGPTISQCQPAMLASRDLYQLLLPQQLTTSK
    THTLTIYDRLSTALTVAQVTGIQRLCNHYAARLNPLSGPDSSRESNRRLTQITEYARQLASQPTLVDNVALARLDEVGLT
    APDIVTFHQLIGFVSYQARIVAGMNALLALPVRWIPGVTLPEDAETDCFQHLDAWRPFLPPVELRYASASQLEALTWCQP
    QELLRDSAWLLAHDGEALYGWGNLLNAMQDVTGTEAGRLASAVSARINGSPL
    CFQQFADPSLREALLEGVEQALNKAIAE
    QKAVIHCAAQLTRSPERFSAAHLQPLKEAGFSDRAVFSIVQSIALAAWNNRLMQALGSTAPAVDSAR

    >gi|300716989|ref|YP_003741792.1| Selenide, water dikinase [Erwinia billingiae Eb661]
    MSENAIRLTQYSHGAGCGCKISPSVLETILHSDHPLRSDPHLLVGNETRDDAAVYDLGNGTAVVSTTDFFMPIVDDPFDF
    GRIAATNAISDIYAMGGKPIMAIAILGWPLDKLAPEIARKVIEGGRSVCAGAGISLAGGHSIDAPEPIFGLAVTGVIAPD
    KVKKNSSAQAGCKLFLTKPLGIGVLTTAEKRAKLKPEHQGLATEVMCQLNSAGAVFADIDGVTAMTDVTGFGLMGHLSEI
    CTGSNLHANVWFDRVPRLAGVDEYIAQGCVPGGTDRNFASYGHLLGAMRDEQRKLLCDPQTSGGLLLAVRPEAEAVVIES
    AGAMGITLTAIGELLPASAGRALIELVS

    >gi|300716995|ref|YP_003741798.1| Methionine sulfoxide reductase B [Erwinia billingiae Eb661]
    MAKDPNEFTPETDLNEMQRYVTQQRGTEPPFSGKLLHNKGEGIYHCLVCNSPLFLSESKYDSGCGWPSFYQPYHDDSIKY
    IEDESHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERY
    CVNSASLSFSDDDGNNIKG

    >gi|300717010|ref|YP_003741813.1| Disulfide bond formation protein [Erwinia billingiae Eb661]
    MLRYLNSCSRGRGAWLLLAFTAFALEMAALYFQHVMMLKPCVMCIYERCALFGVMGAGLVGAIAPKTPLRWVAILVWLYS
    AWEGVRLSWEHTMIQLHPNPFVT
    CDFAARFPGWLPLDKWLPSVFVATGDCTEKLWTFLTLGMPQWLVVVFAAYLIVGVLV
    LIAQPFKPKRRDLFSR

    >gi|300717302|ref|YP_003742105.1| Glutathione peroxidase [Erwinia billingiae Eb661]
    MADYAGKLVLVVNTASHCGFTPQYAGLEALNKKYTAQGLVVLGFPCNQFGKQEPGGADEIAQTCHINYGVSFPMFGKVEV
    NGANSHPVFRYLKDALPGVLGGRIKWNFTKFLIGRDGKPLKRFAPFTKPEKMESVIVAALEL

    >gi|300717692|ref|YP_003742495.1| Probable rhodanese-related sulfurtransferase [Erwinia billingiae Eb661]
    MSQSAVLQFPPPSAATSEAWLRDKLAYYADAWDVAQDLARGISDIVVLDTRSAEQYQAGHICGAVSFPHRTMTAETLSQL
    NSDKVYVTY
    CDGIGCNGSTKGAWKLAAAGFRVKELIGGLDFWLRDRHPVTQGEAAGEWPAQTMPEDCGC

    >gi|300717720|ref|YP_003742523.1| Cytochrome c biogenesis protein (Thiol:disulfide interchange protein) [Erwinia billingiae Eb661]
    MSKKILYIPLVLFLLLAAALMWQLNRNAHGDDPTLLESALVGKPVPVFKLESLDQPGKTYNQSVLTDGKPILLNVWATWC
    PTCRAEHQYLNSLASTGVRVVGLNYKDDRNKAINWLNTLGNPYALSLYDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
    GDLNDDVWNREVKPLWDKYSKEAGA

    >gi|300717906|ref|YP_003742709.1| ArsC-family protein [Erwinia billingiae Eb661]
    MLTMYGIKNCDTIKKARKYLEAEAVAYQFHDYRADGLDSATLQGFIDVLGWEALLNTRGTTWRKLSEETRNGVNNAATAR
    ELMLEQPAIIKRPLLCSADGSMLLGFSEATYQPFISEKS

    >gi|300717915|ref|YP_003742718.1| thioredoxin-dependent thiol peroxidase [Erwinia billingiae Eb661]
    MNPLKAGDTAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDSMDELKKAGVDVLGISTDKPEKLSR
    FVEKELLNFTLLSDEDHQVCEQFGIWGEKTFMGKTYDGIHRISFLIGTDGKVEHVFDDFKTATHHDIVMDYLKSA

    >gi|300717958|ref|YP_003742761.1| 3-mercaptopyruvate:cyanide sulfurtransferase [Erwinia billingiae Eb661]
    MSQREAAMTSSFFVTADWLAEHLSDPDLQIVDARMLPPGMENQRDIKAEYLAKHLPAAPFFDIEALSDHTSPYPHMLPRA
    ETFAVAMRELGVNSDKHLVVYDEGNLFSAPRAWWMLREFGVAKVSILAGGLKGWEDAGYALESGAVDLPEAEFDARFDSK
    LVKRLTDVLLISHEGGAQILDARAANRFRGEVDEPRPGLHRGRIPNSLNVPWNSLVEDGELKSPKALEEIFSQQGVDLTQ
    PIVTS
    CGSGVTAVVVILALTTLGVENVTLYDGSWGEWGSRDDLPIAVG

    >gi|300718015|ref|YP_003742818.1| Glutaredoxin [Erwinia billingiae Eb661]
    MRIIIYTKNNCVQCNATKNAMDKHGLDYQLVNLDHEPAAVETLKSMGYRQVPVVMAEEDHWSGFRPDKISALRPLTAMQG


    >gi|300718027|ref|YP_003742830.1| Thioredoxin 2 [Erwinia billingiae Eb661]
    MNTVCASCQATNRVPPERITDGAKCGRCGSELFTGEVVNATAATLDKYLQDELPVVIDFWAPWCGPCVNFAPVYENVADE
    RNGKVRFIKVNTEAEPELSARFRIRSIPTIMVYKQGKMVDMLNGAMPKTQFDEWLNENI

    >gi|300718202|ref|YP_003743005.1| thiol:disulfide interchange protein [Erwinia billingiae Eb661]
    MKKPYLVLSLLIAAISGVAHADDAAIQQWLKKLGLQQTEIQPSPLPGMKTVLTESGVLYVTEDGKQFIQGPLYDVSGGQP
    VNVTNKLLEKKVEALSEQMIVYKAPKEQHVITVFTDIT
    CGYCRKLHSQMADYNALGITVRYLAFPREGMNGQVAKNMESV
    WCAADRKKAFTTAMNGGEVSPIDCKIDLSQHYKLGILYGIQGTPAILLQNGMMIPGYQGPQEMKQLLDSQKAGG

    >gi|300718304|ref|YP_003743107.1| Putative peroxidase-related enzyme [Erwinia billingiae Eb661]
    MIPLVSLKPLAWHPYIAPVDVEDATPAQRDAMKVTPSNKKISEYVRTLAHDPESYVARTVLFNAIMYVEGGLNRPDRELG
    ALGASIVNGCKY
    CAVVHARRHAQLTKSDKLVSAIYFDKPEMLGPRDAAIYRFARRLSAAPAEATVDDIASLRSVGLDDVE
    IIDLIHAISIFGWANRLMHVLGHATPGK

    >gi|300718341|ref|YP_003743144.1| putative selenoprotein [Erwinia billingiae Eb661]
    MKTAPAITIHYCSQCNWLLRAGWMAQELLHTFSTDLASVSLVPGTGGIYQILIDEHIIWDRKTDGGFPEAKELKQRVRNF
    CFPERELGHIDTK

    >gi|300718756|ref|YP_003743559.1| Nitrite reductase [NAD(P)H] large subunit [Erwinia billingiae Eb661]
    MSTRLVIIGNGMVGHRLIEELLEKATPGQFAITVFCEEPRVAYDRVHLSAYFSHHTAEELSLVRNDLYLKNNVEVLIGER
    AITLNRQEKVIISSSGRVVHYDKLVIATGSYPWVPPINGADGQDCFVYRTIEDLNAIEACARRSTRGAVVGGGLLGLEAA
    GALKNLGIETHVVEFAPVLMAEQLDPLGGAQLQQKIERMGVKVHTGKNTQRITDRPEGGKRMQFADDSALDIDFIVFSTG
    IRPQDTLARQSELALGPRGGVLIDDHCLSSDGDIYAIGECAAWQGRIYGLVAPGYKMAQVTCDHLLGNDNLFAGADMSAK
    LKLLGVDVGGIGDPHGRTPGSRSYVYLDESKEIYKRLVVSEDNRRLLGAVLVGDTSDYGNLLQLMLNAIELPENPDALIL
    PAHAGSKPSIGVDSLPDSAQICSCFDVTKGDLVSAIQGGCHTVAALKAETKAGTGCGGCVPLMTQVLNAELSRQGIEVNH
    HLCEHFSYSRQELYHLIRIEEIKTFDALLAKYGKGYGCEVCKPTVGSLLASCWNEYVLKPEHTSLQDSNDIFLGNIQKDG
    TYSVIPRSAGGEITPEGLMAIGDIGRRYNLYTKITGSQRIGLFGAQKDDLPAIWSQLIAAGFETGHAYAKALRMAKTCVG
    SSWCRFGVGDSVSLGVELENRYKGIRTPHKMKFGVSGCTRECAEAQGKDVGIIATEKGWNLYVAGNGGMKPRHADLLAAD
    LDKETLIRYLDRLMIFYIRTADKLQRTSLWLESLEGGIDYLKRVIIDDSLALNAQLEAELARLRARFVCEWKETVDDPRQ
    HARFAHFINDSRRDPLVQVIGEREQHRPARPEERIPVVLMEEQS

    >gi|300718792|ref|YP_003743595.1| Thiosulfate sulfurtransferase [Erwinia billingiae Eb661]
    MEQFECISVQQAQAQMTDNNALLVDIRDPQSYAAAHASGAFHLTNESLPGFIAQSDVDTPVLVMCYHGISSKSAAQYLLN
    QGFNQVFSVDGGFEAWRVVFPQQVEAVAL

    >gi|300718832|ref|YP_003743635.1| Cation-transporting P-type ATPase [Erwinia billingiae Eb661]
    MHQHSSSCPCGQRHAHSQQGCSSKPRPTIKKISMMTSVTAETSCCSEAGCGSGSDADEESDRRGSAERFSWIISGMDCPS
    CARKIETAVSKLSEVDTARVLYATEKLVVNADRDVRQQVEAAVKQAGFTLQRSDAVKTDAATPGFWQENRAIILLAVMML
    ASWLIDLVSPEAGQIAFTLTTLAGAWPIARSALRLIRSGTPFAIETLMTVAAIGALFIGATAEAAMVLLLFLLGERLESF
    AASRARRGVTALMALKPEEAVRVSGEKRETVALSELRPGDRIEVAAGARLPADARLLSPFASFDESALTGESVPVERQQG
    EAVTAGCLSVDRQVLLEVISKPGESAIDRILHLIEEAESNRAPIERFLDRFSRIYTPVIMAMALLVAVIPPLLFAADWQP
    WIYKGLTLLLIGCPCALVISTPAAITSGLAAASRRGVLIKGGAALESLNAIRTFAFDKTGTLTEGKPQVTALIPLAEESE
    DSLLAKAAAVEAGSSHPLAKAIVALAGQRGLTLAAATSQRALAGSGVEAIVSGHSLLISAPARLDQGTLSPEQQERVSAL
    EAEGNTVVVLLQENQPTALIALRDTLRADAAAALAELKALDIQAVMLTGDNPRAAAAIAGELGIDFRAGLLPADKVTAIG
    ELNQQQPVAMVGDGINDAPAMKAATTGIAMGSGSDVALETADAALTHNRLGGLATMIRISRATHANIRQNITIALGLKGV
    FLVTTLLGITGLWLAVLADSGATALVTANALRLLRKR

    >gi|300718890|ref|YP_003743693.1| Glutathione reductase [Erwinia billingiae Eb661]
    MTRHYDYLAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIAEAIHLYGPDYGFDTTVNSFN
    WATLVKNRSAYIDRIHTSYDNVLGKNNVDVIKGYARFIDAHTVEVNGEKITADNILIATGGRPTHPSIPGAEYGIDSDGF
    FELDALPKRTAVVGAGYIAVEIAGVVNALGSETHLFVRKHAPLRSFDPLIVDTLVEVMNAEGPALHTESVPKAVIKNADG
    SLTLQLENGQEQTVDCLVWAIGREPMTDNLNLDVTGVKLNEKGYISVDKYQNTSVSGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPEEHLDYSNVPTVVFSHPPIGTVGLSEPEAREKYGDDEVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGKDE
    KIVGIHGIGYGMDEMLQGFAVALKMGATKKDFDNTVAIHPTGSEEFVTMR

    >gi|300718990|ref|YP_003743793.1| OsmC family protein [Erwinia billingiae Eb661]
    MSIEKVVYTAKAKATGGRDGRATSSDGVLDVKLGVPKEMGGAGGEATNPEQLFAAGYSACFLGAMKFVAGRDKIAIPKDA
    FIEGEVGIGAIPTGFGIEAKLNIHLEGMDEAEAKKLVDAAHIV
    CPYSNATRGNIDVTLNIIN