Enterococcus faecalis V583 uid57669

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|29374916|ref|NP_814069.1| methylated-DNA--protein-cysteine S-methyltransferase [Enterococcus faecalis V583]
    MTDAGLAFVGSANQSIEELKNWYPQAQLEASEKKTAPYKEALISYLNQHSTTFACPIDIEGTPFQKEVWQALQEIPYGVT
    MTYQEISEKIGRPRAVRAVGTAIGKNPLLMVIP
    CHRVIGSKGQLTGYRGGLAMKQALLTFEQS

    >gi|29374937|ref|NP_814090.1| copper-translocating P-type ATPase [Enterococcus faecalis V583]
    MESKTFDIEGMSCASCAQTIEKATAKLPGMAKASVNLATEKLSVTYDQTEVTEEEIKEAVSDAGYKAISPAQQRTFAIEG
    MS
    CASCAQTIEKAVNQLSGVQQAIVNLATEKLVVSYDDHQVTSAEIIKAVTDAGYQATEEVAAGATADQDREKKQKHIAE
    MWQRFWISAVFTVPLLYIAMGHMVGLPLPDFLNPMTHAMTFAMVQLILTLPVLYVGREFFTVGFKALFKGHPNMFSLVAL
    GTSAAFVYSLYGTVMIFLGDTSFTMALYYESAGVILTLITLGKYFEAVSKGKTSDAIKKLMGLAPKTAHILRDGVEIEVP
    VDAVQLDDIVIVRPGDKIPVDGVIVSGSSSVDEAMLTGESLPVEKKVGDAVIGASINKNGSFQFKATKVGKETALAQIIQ
    LVEDAQGSKAPIAQLADKISGVFVPIVIGLAVLSGLAWFFLGQESWIFALTITISVLVIACPCALGLATPTAIMVGTGKG
    AENGVLIKSGDALETTHKIQTIVFDKTGTITEGKPVVTDILVADSALSEAELLTLAASAEQGSEHPLGEAIVGAAKERQL
    PLAEGSDFSAIPGHGIRVTVNERVLLLGNIKLMKEEAIELSTFVQQADRLAEEGKTPMFVAKDGSFAGIIAVADTVKDSS
    QTAIARLHKMGIEAVMITGDNKRTAEAIAKQVGIDRVLSEVLPEDKALEVKKLQAEGKKVAMVGDGINDAPALAQADVGI
    AIGSGTDVAMESADIVLMRSDLMDVPTAVELSKATIKNIKENLFWAFAYNTLGIPVAMGVLHLFGGPLLSPMIAAAAMSF
    SSVSVLLNALRLKGFKPSTVKRTSGSQK

    >gi|29375084|ref|NP_814237.1| OsmC/Ohr family protein [Enterococcus faecalis V583]
    MKKIYETTIINTGGRAGEVHSPDKSFSYAVASPGVKKENTTNPEQLFAAAYSACFNGALELVMDQEKVEGKSTVTARVSL
    FQGEDGFSVGAELEVHIDGVDQAKAEELVKKAHEI
    CPYSKATRNNIDVKLTVI

    >gi|29375104|ref|NP_814257.1| ribonucleoside-diphosphate reductase 2, NrdH-redoxin [Enterococcus faecalis V583]
    MNVKIFSKNNCIQCKMAKRFLSENNIAFEEINIDAQPDAIDWLKEQGFQSVPVITSEATTVVGFRPDQLKQLAS

    >gi|29375325|ref|NP_814479.1| hypothetical protein EF0730 [Enterococcus faecalis V583]
    MEYVTTLEELEEKITDNRLQAVFLTAKNCSVCTVDKPIVEKIATKYEFPTYIAEADKSPEIIGQLNAFSAPTIILYYEGK
    EIHRQAKIINFQEIEKRVRQVQENS

    >gi|29375342|ref|NP_814496.1| hypothetical protein EF0748 [Enterococcus faecalis V583]
    MKYQVLLYYKYTTIEDPEAFAKEHLAFCKSLNLKGRILVATEGINGTLSGTVEETEKYMEAMQADERFKDTFFKIDPAEE
    MAFRKMFVRPRSELVALNLEEDVDPLETTGKYLEPAEFKEALLDEDTVVIDARNDYEYDLGHFRGAVRPDIRSFRELPQW
    IRENKEKFMDKKIVTY
    CTGGIRCEKFSGWLLKEGFEDVAQLHGGIANYGKNPETRGELWDGKMYVFDDRISVEINHVDKK
    VIGKDWFDGTPCERYINCANPECNRQILTSEENEHKHLGGCSLECSQHPANRYVKKHNLTEAEVAERLALLEAVEV

    >gi|29375363|ref|NP_814517.1| hypothetical protein EF0770 [Enterococcus faecalis V583]
    MDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMH
    HYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDES
    VTEEELRGYIEK

    >gi|29375664|ref|NP_814818.1| hypothetical protein EF1088 [Enterococcus faecalis V583]
    MKIEFFHDVICSFCFPMSDRMHEIQQEFPEIELIHRSFALGWSANDFETMFGSRAAVKEEVLTHWVHANQNDSKHRFNIE
    GMRKQRFDFPTSKNVLLAAKAAGYIGNQDTYWLLFDKLQEGLFVRSLNIEEPEVIEKLVKETTIDFALWKEAVASEAVWT
    AVQEDFALASAYGLQGVPALIINQKYLINGAVPKQQISQTIQKILAEEKQQQPLVSLTPSSEESASCEFKEGTWTCH

    >gi|29375784|ref|NP_814938.1| NADH peroxidase [Enterococcus faecalis V583]
    MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEIT
    AIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYI
    GIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKIVTDKNAYDADLVVV
    AVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPF
    PGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTAN
    INAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER

    >gi|29375905|ref|NP_815059.1| thioredoxin reductase [Enterococcus faecalis V583]
    MYDVIIIGAGPAGMTAALYASRSNLSVLMIERGAPGGQMNNTAEVENYPGFDSIMGPELAYKMYENVEKFGTENAYGIVM
    GIEDHGSYKEVICDDKSYEAKAVIIATGCEHRKLGVKGEEEFAGRGVSY
    CAVCDGAFFKNKRLVVVGGGDSAVEEAIYLT
    QFASEVVIVHRRDELRAQKIIQDRAFANEKISFVWDTVVEEIVGNEMVVTGVKARNVKTDEVSEIEANGVFIYVGLDPLT
    EPFKKAGITNEAGWIETDQEMRTKIPGVYAIGDVREKTLRQITTAVGEGGIAGQQVFNYIEELK

    >gi|29375923|ref|NP_815077.1| dihydrolipoamide dehydrogenase [Enterococcus faecalis V583]
    MVVGDFAIELDTVVIGAGPGGYVAAIRAAEMGQKVAIIEREYIGGVCLNVGCIPSKALIAAGHHYQEAQDSSTFGVTAKG
    VELDFAKTQDWKDNTVVKSLTGGVGMLLKKHKVEIIEGEAFFVDENTLRVIHPDSAQTYSFNNAIVATGSRPIEIPGFKF
    GGRVLDSTGGLNLKEVPKKFVIIGGGVIGAELGGAYANLGSEVTILEGSPSILPTYEKDMVKVVTDHFKKKNVTIVTSAM
    AKEAVDNGDSVTVKYEVNGKEESVEADYVMVTVGRRPNTDDLGLEQAGVEIGERGLIPVDNQGRTNVKNIFAIGDIVPGA
    ALAHKASYEAKIAAEAISGKKVAVDYKAMPAVAFTDPELASVGMTVAEAKEAGIEAKGYKFPFAGNGRAISLDKTEGFMR
    LVTTVEDNVIIGAQIAGVGASDMISELALAIESGMNAEDIALTIHPHPSLGEITMDTAELALGLPIHI

    >gi|29375967|ref|NP_815121.1| cadmium-translocating P-type ATPase [Enterococcus faecalis V583]
    MQKSYKLEGLDCASCADKIEKSVQKIHGVEKARVDFMAEKMTLEVESGHDLEVENEARAVIGKLESDVKVISLKDVKEEE
    GRNPNKNRLIRIIIAFVLFLALIIIKPSNNWVALASYLVVYVLIGGDIVKRAVTNIFRGEVFDENFLMSVATIGAFFIGE
    YPEAVAVMLFYQVGEWFQSAAVDQSRKSIAKLMDIRPDSANLLVNGQIKAVAPDTIEIGQQILVKPGEKVPLDGQIIDGS
    SMVDTSALTGESVPRTVKVGDEILGGFINKNGALTINVTKKFGDSTVSKILDLVENASSKKAPAENFISKFARYYTPVVV
    VLAILLAVIPPFIFPDTSINEWVYRALTFLVISCPCALVISVPLSFFGGIGGASKLGVLIKGSNYLEILANTETIVFDKT
    GTLTKGNFVVQNITSVVLPEEELLRLTATAEQLSTHPIAISIKESYGKETVPATAIEEVAGHGIKATIEGKTVLVGNAKL
    MKQFGIEAPEVKEAGTLIFVAIDNQFAGYLVIADQLKPDAISAIKELKAEGVKQTVMLTGDNQQVAEAIAKEVGVDKVYA
    ELLPDGKVDRLEELLKASSPKNKVAFVGDGMNDAPVLARADVGIAMGGLGSDAAIEAADVVIMNDEPSRIASAIKLSRKT
    LRIVKQNIIFAIAVKIIVLALGALGLASMQAAVFADVGVTIIAVLNAMRCLRVEKMKDNN

    >gi|29375972|ref|NP_815126.1| thioredoxin [Enterococcus faecalis V583]
    MTQAITDKDFATETDEGLVLIDFWATWCGPCRMQAPILEQLSEEYDEDEVKIVKMDVDENPATPASFGIMSIPTLLLKKD
    GEVVEKAVGVHTKDQLQAMIAKHL

    >gi|29376148|ref|NP_815302.1| NADH oxidase [Enterococcus faecalis V583]
    MKVVVVGCTHAGTSAVKSILANHPEAEVTVYERNDNISFLSCGIALYVGGVVKNAADLFYSNPEELASLGATVKMEHNVE
    EINVDDKTVTAKNLQTGATETVSYDKLVMTTGSWPIIPPIPGIDAENILLCKNYSQANVIIEKAKDAKRVVVVGGGYIGI
    ELVEAFVESGKQVTLVDGLDRILNKYLDKPFTDVLEKELVDRGVNLALGENVQQFVADEQGKVAKVITPSQEFEADMVIM
    CVGFRPNTELLKDKVDMLPNGAIEVNEYMQTSNPDIFAAGDSAVVHYNPSQTKNYIPLATNAVRQGMLVGRNLTEQKLAY
    RGTQGTSGLYLFGWKIGSTGVTKESAKLNGLDVEATVFEDNYRPEFMPTTEKVLMELVYEKGTQRIVGGQLMSKYDITQS
    ANTLSLAVQNKMTVEDLAISDFFFQPHFDRPWNYLNLLAQAALENM

    >gi|29376215|ref|NP_815369.1| branched-chain alpha-keto acid dehydrogenase, E3 component, dihydrolipoamide dehydrogenase [Enterococcus faecalis V583]
    MAEQTDLLILGGGTGGYVAAIRAAQKGLNVTIVEKYKLGGTCLHKGCIPTKALLRSAEVFDTLKQAASFGIETEAASIDF
    SKIQQRKEGIIEQLHKGVEGLCKKNKIKILAGEGAILGPSIFSPVSGAVAVTFNDPTREEEIIVPKNVIIATGSSSKTLP
    NLPLDEEFILSSDGMLELEELPESIAIIGGGVIGVEWASLLNSLGVNVTIIEFLDRLLINESATISKELKKRLEQRGINI
    LLGSKVQEAKVTGQKVQVEVAGQETLTVDKVMVAIGRQPNINKLGLQNTSVKYTDKGIEVNEFYQTTEGHIYAIGDCIDT
    LQLAHVAMKEGELAVQHLLGETVEPLNYTNVPRGVYTNPEIASVGYTRETLPAEKEVVIGTFNFNGNGKSLVYGETDGFI
    EVIRDKKTDDLLGVSMIGPHVTDLIAEASTAMYLDAAPIEIGEAIHAHPTMTEVLQEAALDTYGLAIHK

    >gi|29376235|ref|NP_815389.1| peptide methionine sulfoxide reductase [Enterococcus faecalis V583]
    MEEKAIFAGGCFWCMVQPFDTQPGIISVVSGYTGGHVPNPTYEQVLTHTTGHTEAVEITFDPAIISYEQLVDIYWQQTDP
    TDAFGQFQDRGDNYRPVIFYRSQEQKEIAEKSKERLANSGRFTEPIVTTIEPAAPFYPAEEYHQDFYKKDALRYGLSHQR
    RSEFIEEKWSD

    >gi|29376401|ref|NP_815555.1| thioredoxin family protein [Enterococcus faecalis V583]
    MLSEKTDLENTEAFNKESVKDLRKLSTKDINGKDFTSKDFEKYDLTMVNVFATWCTACVKEIPDLVEVQNEMKSKGVNIV
    GVVTDPVDDNGENKEAIEKSKLIHEKTKASYPFLMPDKTNFNGRLNGIQAMPETFFVDSNGETKVVLDKAIRICMECIGI
    G

    >gi|29376993|ref|NP_816147.1| arsenate reductase, putative [Enterococcus faecalis V583]
    MYTLYEYPKCSTCKKAKAWLDQQGVKYQAIDIKATPPSSEQLAKWMKETGLPVRRFFNTSGVLYREQGLKDLVDSFSIEE
    ASQRLAADGMLIKRPILLKDNTFLTNGFKEADYEGVLGK

    >gi|29377054|ref|NP_816208.1| selenide, water dikinase [Enterococcus faecalis V583]
    MDFLSQCTSGGCGAKIESRVLNQLLQHLPETPANERLLVGFEHADDAAVYQITSEKALISTVDFFSPMVNDPLSFGKIAV
    ANALSDVYAMGGTVLYALNLVCFPQKMSKEWLEQMLLGGSLKLKEAGALLAGGHSIYDHEPKYGLAVTGEVHPENLWHNN
    TPQVGDVLILTKALGVGIIQAAVRGQLAKQTEQKIAQDSMERLNKYAAANARSYAVHACTDVTGFGLLIHAKEMADNQVT
    LLIDTEALPTITGALAYAAECLVTAAGQRNRQTIGTTIDYSKISMEMQELLFDPQTSGGLLISVAADEAAACLAAIQKED
    PVAKIIGEVLPKEQQAVVLL

    >gi|29377159|ref|NP_816313.1| hypothetical protein EF2678 [Enterococcus faecalis V583]
    MLTLYTSPSCTSCRKARAWLQEHEIPFKERNIFSEPLNIEELKAILIMTEDGTEEIISTRSKVFQKLNMDLDELPLQDLL
    ELVQENPGLLRRPIMIDEKRLQVGFNEDEIRRFLPRDVRQLELRQAQLMAGL

    >gi|29377214|ref|NP_816368.1| thioredoxin reductase/glutathione-related protein [Enterococcus faecalis V583]
    MTEEIYDLIIIGGGSAALSAGIYAGRAMMDTLIIEKDKIGGQVTTTSEIVNYPAIRHTTGPELMEEMRIQAQDFGVAFTN
    DEIIDVDFSQTIKTVQSASQTYQAYAVLIATGASARKIGFPGESEFTGRGVAY
    CSTCDGEFFQGLDIFVIGGGYAAAEEA
    VYLTRYGKSVTMIIREPDFTCAKLTAEAAKNHPKIKIVYNIEVKEITGDDFVRKAVFVNNQTGEETVYEAPKDSTFGLFV
    FAGNKPSTEIFEGKIALDRGYVPTTENMETNIPGVYAAGDLRIKELRQIVTAVADGAIAATHAQRYVTEQKTQAGQSIVT
    KRMTERLANQSAPETSSQQPKEKQPAKVTGKHQWFPESMRQQLSGIFAKLTKKVTLLQFLDASDEKSLELQSFLTEFASL
    DQKITLETILKDTEPAKELLYGIEKMPSVVLLDAAGNYTGIKFSGIPSGHEVNSLVLAVYNVGSEGQPLEASLQKNILAL
    PKRKIEIFVSLT
    CHFCPDVVAACQRIASINPHVEAEMVDISLFPELKKEKKIMSVPAMLIDGEQMIFGSKTMTEIIEALA


    >gi|29377215|ref|NP_816369.1| alkyl hydroperoxide reductase, C subunit [Enterococcus faecalis V583]
    MNLINQKLFDFECDAYHDGEFTRVSTEDILGKWSIFFFYPADFSFVCPTELGDMQEHYAHLQELNCEVYSVSEDSHYVHK
    AWADATETIGKIKYPMLADPNGQLARFFGVLDEASGMAYRASFIVSPEGDIKSYEINDMGIGRNAEELVRKLEASQFVAE
    HGDKVCPANWQPGEETIAPSLDLVGKI

    >gi|29377396|ref|NP_816550.1| AhpC/TSA family protein [Enterococcus faecalis V583]
    MNVTRKGHVLELTGEQPKVGTKAPVFSLKNLNNQEINLADYKGKTVLISVVPDIDTRVCSLQTKRFNQEAAKLDGVQIIT
    ISNNTVEEQANWCAAEGVEMEMLHDTEDSFGAAYGLYIPEMGRLARAIFVIDPEGTLVYEEIVSEVSSEPDYQQALESAK
    KV

    >gi|29377451|ref|NP_816605.1| rhodanese family protein [Enterococcus faecalis V583]
    MYNTIGMPEFYQEAKRKKLPIIDVREEMEYQLGHVPQAINLPLSTLTENYQQLDKNQPYYLICQMGSRSAQACAFLSQQG
    YQVTNVLGGTSGWLGQLEQ

    >gi|29377452|ref|NP_816606.1| coenzyme A disulfide reductase [Enterococcus faecalis V583]
    MKIVIIGGVAGGMSAATRLRRLMEDAEIVVMEKGPFVSFANCGLPYYVSGEIAEREQLLVQTPEALKARFNLDVRPHHEV
    VAIDPIEKVITVKHETEILTEHYDKLILSPGAKPFVPPITGLAEAKNVFSLRNVPDLDQIMTALTPETKRAVVIGAGFIG
    LEMAENLQKRGLEVTLVEKAPHVLPPLDEEMAAFVKAELSKNNVQVITGQSAVAFEEEGQVIRLEDGQTLASDLTILSVG
    VQPENTLAVEAGVATGLRGGIVVDEHYQTNQPDIYAVGDAIVVKQQITQEDALISLASPANRQGRQVADVIAGLERKNQG
    SIGTAIVRVFDLTAASTGLSERAAKAAGLTTAVVHISGKDHAGYYPGATDLQLKLVFHPTTGEIYGAQGIGAKGVDKRID
    ILATAIKGQLTIFDLPELEFTYAPPFGSAKDPVNMLGYAAMNLVEGLSENVQWYELSNELANGAVLLDVRNPAERANGQF
    KNAVSIPLNELRERLEELDKSTEYIVS
    CHSGLRSYIAERMLKQAGISAKNLDGAFALYRMVKPEELENV

    >gi|29377453|ref|NP_816607.1| rhodanese family protein [Enterococcus faecalis V583]
    MLFQLFKKTPSISTKELQSRLSKEITLLDVRTPSEYRAGHIPQAINVPLNKIPAYNKSANEVYVICQSGMRSKNAAKILA
    RKNYHVINVRGGMSQWSGQIKGGK

    >gi|29377495|ref|NP_816649.1| thioredoxin family protein [Enterococcus faecalis V583]
    MIYPNSLEELATYVEKGKNVFFFTADWCGDCRFIKPVMPEIEEAFPAFQFIEVDRDQFIDVAAEWNIFGIPSFVVIENGQ
    ELGRLVNKDRKTKEEISAFLTSLG

    >gi|29377614|ref|NP_816768.1| methionine sulfoxide reductase B [Enterococcus faecalis V583]
    MTKPTEEELKQTLTDLQYAVTQENATERPFSGEYDDFYQDGIYVDIVSGEPLFSSLDKYDAGCGWPSFTKPIEKRGVKEK
    ADFSHGMHRVEVRSQEADSHLGHVFTDGPLQEGGLRY
    CINAAALRFVPVADLEKEGYGEYLSLFK

    >gi|29377713|ref|NP_816867.1| glutathione reductase [Enterococcus faecalis V583]
    MKTYDYIVIGGGSGGIASANRAGMHGANVLLIEGNEIGGTCVNVGCVPKKVMWQASSMMEMMERDTAGYGFDVEIKNFSF
    KQLVENREKYIDFLHGAYNRGLDSNNIERIHGYATFTGEQTIEVNGTEYTAPHILIATGGRPKKLGIPGEEYALDSNGFF
    ALEEMPKRVVFVGAGYIAAELAGTLHGLGAETHWAFRHERPLRSFDDMLSEKVVERYQEMGMQIHPNATPAKIEKTAQNE
    YVITFENGESITTDAVIFGTGRQPNTDQLGLENTKVALDEKGYVKVDKFQNTTQNGIYAVGDVIGKIDLTPVAIAAGRRL
    SERLFNGQTDLYLDYNLVPTVVFTHPPVATIGLTEKAALEEYGEDQVKIYRSSFTPMYFALGEYRQKCDMKLICVGKEEK
    IVGLHGIGIGVDEMLQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|29377946|ref|NP_817072.1| hypothetical protein EF_B0054 [Enterococcus faecalis V583]
    MKKMIGGLVVGLFVLIFFWQLYSLNKEEIEYKITDSESIENKISQNKDLNIYFFKKGCQPCNVQKKDLNKVIKDKNLLVY
    GVDIEEKNKESNLLLDQLNITQTPTVIIIKEGKVYKRLEGVSSYELLEESLIKE

    >gi|29377068|ref|NP_816222.1| putative selenate reductase subunit YgfK [Enterococcus faecalis V583]
    MSDIMHPISIEALLNWIFSEYQQDGTIFGIRKFYHADPTKTISLFGEKMETPCGPAAGPHTQLAQNIIAAYLTGSRFFEV
    KTVQILDGEDLPVSKPCIAAADECYNVEWSTELRVPQAYDEYVKAWFVLKLLSKEFELGDPNGFIFNMSVGYDLAGIQSP
    KIDRYINEMQNAEGTPIWAECQAAAKKYLSYFKKVDDLYIEAISPKVCHSITLSTLHGCPSDEIERIAAYLLSEKGLHSF
    IKCNPTMLGYEYARQTMDELGFDYMVFDDHHFKEDLQFEEAVPMLQRLQLLANSKNLSFGVKITNTFPVTIAANELPGDE
    MYMSGRSLFPLSISLAQKLSEAFDGKLQISYSGGADIFNSKEIFDAGIWPITMATTLLKPGGYQRMNQVANVLSAAEYPQ
    MVHVNLDKLAQVVEKAKTQARYQKSIKLPESTKLRKTVPLTDCYIAPCRSDGGCPINQDIPAYLRYVSEGNYLKALQVIV
    DKNPLPFITGTICAHPCMTKCTRQFYEESIHIREVKLEAAEHAYDELLTTLEKPQPKENAPKTAVVGGGPAGISAGYLLA
    REGMPVTVFEKSETIGGV
    CSQIVPEFRISMESVQKDVQLAEFMGAEFRTGQEAPSLAELKNQGYTNVIYAIGAWKHGVLR
    LESGRALNSLEFLKANRENPTINPYGEQIVVVGGGNTAMDCARAATTLPGVKKVSVVYRRNKRNMPADEEELYLALEDGV
    DFLELLSPIKHENQQLTCEKMVLGERDASGRRRPIGTGEMIDIPADTVIAAVGEKVDTEFYQALGIHTDNYGKVVSNQET
    LETNIPGVYVIGDANLGPATIVEAIADATKAANNICLVHNHHYEKDNLNSDVAFVRNKRGILVTDEMSCSQASRCLECST
    ICESCMDVCPNRANIVVYVEGKPQIVHVDRMCNECGNCETFCPYASAPYKDKFTLFNSEADFYDSTNSGFYVQNPVDKIC
    LLRLWGTVSTIQLTDQGLDVPEDLIALMVTMIEEYAYCMQA