Elusimicrobium minutum Pei191 uid58949

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|187250433|ref|YP_001874915.1| redoxin domain-containing protein [Elusimicrobium minutum Pei191]
    MKKILMNGTPMKIKGAELKIGDKAPDFTLTKVDLSPAKLQDYKGKVVILSVVPSIDTPVCTIETRRFNKEASELGGNIVF
    LTVSKDLPFAQKRWTDSFNTDKIIMLSDYRNPEFGTDYGVLIEEIYILSRAVFVIDKDGVIRHIDFLEDVGKEPDYKVII
    EKAKELDK

    >gi|187250606|ref|YP_001875088.1| hypothetical protein Emin_0187 [Elusimicrobium minutum Pei191]
    MKKLFITALLLLPLTMFGKDLVRVAVFTSPACVHCNHMKQDKFVEKLKKEYGSKIEIINIDTSDAQGSIIFKESAEAYGK
    DFGVPAMAIGETYLQGYPAQIAFYAGPAVERALANNETTKITVKEVKAEDEFNKLTFSTIVLSGLADGINPCAFAVIIFF
    VSFLAVYGYNKKEVVYVGSAYCLAVFLAYFLIGLGLFEFLYAMSGFAYVIKIFYFLAAALCFVFFLLSLYDFIIYQKTKK
    SDGMLLQLPKNLKLKINKIIGFFMRGKEGEGRHPLRLIVAAFCVGILVSLVESVCTGQVYVPTIVLIMKDPHFRTRAVSY
    LILYNLLFILPLLIVFGFTLLGHKSEKVNSLFKKHLGITKLLLALVFLGLFIMLVIV

    >gi|187250692|ref|YP_001875174.1| methyltransferase type 11 [Elusimicrobium minutum Pei191]
    MTEKKTVKKETAKKAAAKKPADKKAKTVKTDSFIDLFELNKNDVLLDLGCGKGEFLKTAAKTTAFATGIDCSAEHLTEAQ
    KALQKTGNITLIEGWLQDAWFENNSFTKITAKDVLRSMNNHEKGVLINKVSNWLKPGGLFIVQDIITSFGLHRKDERHEM
    IEAE
    CKKYYGKKWPELKDSFYHDLYHAHPSDLSLMMHHFLFTGFNVLQIIKHTSCVCTIVAQK

    >gi|187250749|ref|YP_001875231.1| OsmC family protein [Elusimicrobium minutum Pei191]
    MVKTKYTGNMKIAVEVGGFTVNTDLPAAHKGDNTAPNPFDLFLASFAACTAVFALFYLDKHGLSKEGVNVDIEPAYTKEG
    MVDNFKVFVTIPETFPKEHETGLKTNVESCKVGKHIKPAHEVIIVRK

    >gi|187250907|ref|YP_001875389.1| thioredoxin [Elusimicrobium minutum Pei191]
    MSEIILTDDNFKTEIENSKGVALVDFWATWCGPCKMFAPIFEETAKEYEGKAKFGKVNTDDAPGVSSNYRISSIPTVIVF
    KDGKPAQVLIGLQSKESLKKTIDALI

    >gi|187251013|ref|YP_001875495.1| thioredoxin reductase [Elusimicrobium minutum Pei191]
    MQTSDIIVIGNGPAGVTAAIYGVRAALDVLVFAGPISGGQILQTNDMENYPGFIEPVSGYELMDKMHKQAERLGAKVVHT
    EISSIDTSSKPFKLTATDGNIYAAKTIVIASGVKPRWTEADGEDKYKGRGISS
    CATCDGMFFKNKDVVVIGGGNTAFEDV
    LYLSKICNKVYLVHRREGFRAAQKTVEKVKACPNVEMVLNYTAESFEGDSLGLNALKVKNLNDQTVRELPCQGVFVAIGG
    VPQTAFLKNSGVELEEDGIIKIDESGKTNIEGIFAAGDCTTEQQFRQVVIAAGAGAKAAVEAINYINLN

    >gi|187251255|ref|YP_001875737.1| OsmC family protein [Elusimicrobium minutum Pei191]
    MSKIVTTYLGDGEAESFYPEVGEKIFTDLPLDNGGKGRKFSATDIFTASLAACIVTIMGKMAESRGDSLKGAKIEIEKIM
    ESNPRRIGKFIIDIIFPEGISKEKMEMYSKVIHTCPVHNSIHPDIKVEVNIK

    >gi|187251315|ref|YP_001875797.1| methylated-DNA/protein-cysteine methyltransferase [Elusimicrobium minutum Pei191]
    MSTKYFLSFKTPVGILELTSNDTALIGIYFTKTVKESKTLPPILKSAKKQLLEYFDGKRKDFDLLLDFGAGISPFRLKAW
    KEMAKIPFGKTYTYGQLAAKAGNAKASRAAGGACNKNPFMIVVP
    CHRVLGSNGSLTGYAGGLNVKKFLLDLEGISYK

    >gi|187251424|ref|YP_001875906.1| thioredoxin domain-containing protein [Elusimicrobium minutum Pei191]
    MKKTLNDENFKQVTSTHEKPFMVEFFATWCPHCQRMAPIIDELAVDFEGKADIFVIDVDIAEKTIAEFKVSGTPTIVFFK
    ENKPFKELVGEKPKQILVEILNEII

    >gi|187251686|ref|YP_001876168.1| redoxin domain-containing protein [Elusimicrobium minutum Pei191]
    MKKKLLVLALALAFVGACSFTGPKVAFNLPNINGTQFDSAVNAKKQPVFLAFMATYCGYCKMSVPMIVELQNNFGSKGLK
    VVGVFSDGSADGPAAYAKEFGINYDVLYQGGQLAQEAKVNGVPHFVLLNKNHQIVRVWSGYSPDHNFAEEIQKVL

    >gi|187251768|ref|YP_001876250.1| dihydrolipoamide dehydrogenase [Elusimicrobium minutum Pei191]
    MSKNIVIIGAGPGGYPAALKAASLGAKVTVIEKKAVGGTCLNCGCIPSKSLLDAAHRFDIVKKIPSLAIEESITANPDWN
    KISLRRKNVIERFQKSILSMFNTAGITYIEGRAKFKNDSEVELLTQEGMKIIHFDSAVLAAGTHPFIPEIFKGIDILDNS
    NVFDIPKLPQTITILGGGVIGCEFASLFNSLGVKVTIIEMQPALVPGEDETSIRTLTQSFKKRGINILTSVIADKARVEN
    GKKIITLSTGEDIAADEILVAVGRTAHLGDIGLENIGVPWTRRGVEVNPQTLHLAKNIYAVGDVNGLCLLAHAASKQGEV
    AASNICGHKEVYNNNLIPRAMYTSPEVASAGLNKAQAEKAGYEVKIQRAFFLANGRAQTQDETEGQLQIFSDAKTLKILG
    AAIAGPNASEMIHIFSVAIAAGMTTTRLKDVVFAHPSLSEIITEALAK

    >gi|187251789|ref|YP_001876271.1| methionine-R-sulfoxide reductase [Elusimicrobium minutum Pei191]
    MKKSYLIFAALMILLMVFLTQQANSIKNNMQGKGKTKKDKEFAMWLEHREDLKDIYLAGGCFWGVQAYLDKIPGVINTQV
    GYANGKTQKPTYEQVCSQKTGHAETVRVQYDPEKISLEHLLKIFFEIINPVSLNKQGGDKGTQYRTGIYYTLPEDKETAQ
    KVIDEEQKKYSQPIVTELKTIENYYPAENYHQKYLEKNPNGYCHIDLSGADKYKKLLKSKEELKKILTPVAYNVTQENGT
    EAPFSGEYNDFFEKGIYVDVVSGEVLFSSEDKFKSSCGWPSFSKPVGDVEEKEDLTRGMIRTEVRSKKGDSHLGHVFDDG
    PKDKGGLRY
    CINSAALKFIPLKNLEQEGYGEYKKLFNKQ