Ehrlichia canis Jake uid58071

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|73666729|ref|YP_302745.1| hypothetical protein Ecaj_0096 [Ehrlichia canis str. Jake]
    MVALYTPQVDKNVIAHDFSLKSTDGNLYSLSSYHKGNGLLIMFICNHCPYVKAIINNLVYDVNTLKNDYNIYTIAIMPND
    TIAYPDDSYENMIKFAQEYGINFPYLIDEDQTVAKNYGAVCTPDFFGFNNKLELCYRGRFDSSGKNQVDSKQEDRDLFNA
    MKFISKTGKAPDNQKPSIGCSIKWKSQDDQFVPH

    >gi|73666739|ref|YP_302755.1| hypothetical protein Ecaj_0106 [Ehrlichia canis str. Jake]
    MPDTLIKIKEINSAQALSDMFKMTDSKINVIVIYTSWCSSCVKKIPEINKLISDFDNINPIVISLDENKNKLLSFLSKQG
    TLNFTPYNVSPSYLKNLLSYLTNKGIVFNHHIPYIAVLYNGIHPITNINNAKQLKLTIQNLIEKHHVN

    >gi|73666771|ref|YP_302787.1| dihydrolipoamide dehydrogenase [Ehrlichia canis str. Jake]
    MLHLQILLHSTIIIRFVSINKSMTKHEFLIIGSGPGGYIAAIRAAQLGYDVAIVEKENSLGGVCLNWGCIPTKSLLQSAS
    VYHNIKKADIFGITVKDVKFDFNKIIERSRNVVEKLANGISGLMKKNNIKVYHGTAKLLGNATVEITDHSNKRISITSTH
    IVLATGSQAKNIPGIDFDNNIVWNAKNAMTPNKFPESILIIGSGAIGIEFASFYNTFGTQVTMVELKDNILPLEDHEVSK
    CMHNILSNKGIKIHTSSSITKLEKCNNYAKVQISDTIDLQVDNVILAVGIIPNSSNIGLENTKIKTDNAGFIITDKHCCT
    DEPGIYAIGDVAGFPCLAHKASHEAILCIENIAATENKIPQHKIHTINKNNIPSCIFSIPQIASIGLTEHQAKHQGYNFK
    VGKFNANCSGKAVAIDEVEGFVKVIIDKSTGELLGAHMIGAEVTEMINGYIIGKQVEITDQDITSAIFPHPTLSEMLHEA
    VLSSNNESLNS

    >gi|73666838|ref|YP_302854.1| rhodanese-like protein [Ehrlichia canis str. Jake]
    MGYVVSTFYRFVHLSNYYDIQSVLKEFCVQHDIKGTIILAEQGINATIAGAQSALNQFFSFLDLDNRLKDIQHHESFSTH
    NPFSKMKVKLRNELVRLGIENFDNSVCGEYVSPQNWDDLISRSDVYTIDTRNTYEINFGKFKNAINPQTKCFRDFPEWAV
    SWASDKVNQDPIIAMY
    CTGGIRCEKSTAFMKNLGFNKVYHLKGGILEYFKSTKNTNNLWEGDCFTFDDRIVVDDNLVPGR
    VKCVSCDVHVTREEMKSVTRGNVLCFNCREVAKV

    >gi|73666872|ref|YP_302888.1| glutathione S- transferase, N-terminal [Ehrlichia canis str. Jake]
    MKLTMDTLYHFPLCPFSRKVRIFLKEKKFNFHQIEENPWKKREGFIKINPVCQVPVLISGQHVIADSQAICEYIEELYDS
    ASLLGSSLYTRSIVRKLIYWIDYKFYHEITRYIINEKISKYYIKNASPDSRFIQAARQNLLPHVRYIERLLNASSWIACN
    EFTLADITLAAHISVLDFMNIFPWHLTATLKEWYSVIKSKPSFSDILNDKVIGITPPVHYNKLDF

    >gi|73666956|ref|YP_302972.1| thioredoxin reductase [Ehrlichia canis str. Jake]
    MIHTYKTKVLIIGSGAAGCTAAIYAARANLEPILITGMCPGGQLTITTDVENFPGFAHAVQGPDLMEQMKQQAHNSGANV
    ISDEIKEIHTDVYPFKCIGIFGDQYIAESIIIATGAQAKWLNIKSEETFKGRGVSA
    CATCDGTFFTGSDVAVIGGGNTAV
    EEALYLTRHATKVFLVHRRDKLRAEPIMQERLLNNNKIQVIWDSVVEEILGNDENGTVEAVKLKSVKTGQFTTIKVKGVF
    IAIGHTPNTQILKNKDNSSIVELDQEGYIITKHGSTITSHPGIFAAGDVQDKIYRQAVVAAGSGCMAALEAAKFLSENTM
    H

    >gi|73666957|ref|YP_302973.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Ehrlichia canis str. Jake]
    MNLITKQAIDFTAKAVMPDDKICEFNLKEYVNGKCAILVFYPRDFTFVCPTEIISLHNRIPQFMEKNTEIIGISTDSEFC
    HSHWRNVSVNKGGIDKISFPLIADDSHFISSSYGVLHNNSIALRATFIIDDKFIVRHQSINDLPIGRNVDELLRIIDAIK
    HYQIHGEVCPAGWMKGDPAMEASQHGIEDYLKSHIDNLEKSIMDK

    >gi|73666988|ref|YP_303004.1| HesB/YadR/YfhF [Ehrlichia canis str. Jake]
    MSNLKSADLTLTENAVNKIKHLLDQEEDTGSLLCLSVSGGGCSGFQYNFNIGNINTLLADDEDDEDDDYDFLDEDDDEEY
    DDEDELEGKSSAKFTVFDEETGKPLLLIDKASNDLLKHSTIDYVEDINGSRFIVNNPIAKSKCGCGNSFSI

    >gi|73667033|ref|YP_303049.1| HesB/YadR/YfhF [Ehrlichia canis str. Jake]
    MNNEISISYNNDGNSSQIRYYINSEVTSKSPIIITENAIKKIRQLIKQKEDAVIGIRIMVKQKGCFGFKYNIEYAYDIKL
    LDVKIEVEYQHENFTILIDPKAMMFINGTEIDHVENKISSGFTFKNPNEKGRCGCGESFYV

    >gi|73667113|ref|YP_303129.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Ehrlichia canis str. Jake]
    MTVEIGDDAPYFKSLDTYKGDKNIILYFYPKDDTPGCTKEAKDFQNAMDDFVDLNTVIIGVSKDNEKSHDNFKRKHNILF
    ELISDEGSELSKQYGTWVEKNMFGKAYMGIGRSTFLIDKNGKIRKIWRNVKVSGHVDNILEIIREIM

    >gi|73667139|ref|YP_303155.1| dihydrolipoamide dehydrogenase [Ehrlichia canis str. Jake]
    MQNYDIVIIGGGPGGYKCAIRASQLGLKVACIDKNKILGGTCLRVGCIPSKALLHFSHEYYHLKNNLSEVGITFDNLNFD
    LNKIMSFKDKNIAELGSGISQLFSSYKIDYLCGAGKIKSVGSNDFIIAINGDNAEQQITSKNIVIATGSDVSSFPGITID
    EENIVSSTAALSFKEPPKRLVVIGAGAIGLEMSSVWSRFGSEVTVVEFLDKIAPSMDGDISKALLTSLKKQCINFKLSTK
    VVSIDNKGSNLTVHLESVKDGKSEVIEADKVLVSIGRVPYTKGLIDNNLIECDSRGFIKVNSRYETNIPGIFAIGDVIGG
    AMLAHKAEEEGIAVAELISGHIPHVDYEIIPSVIYTHPAVASIGKTEESLKNANYSYSVGKSNFAANGRSRITNNAVGFV
    KVLTSKVNNAILGVHIIGTYADTMINEAAIAMAYRASSEDVFRICHSHPDVNEAFRDACEAAFLNH

    >gi|73667313|ref|YP_303329.1| hypothetical protein Ecaj_0699 [Ehrlichia canis str. Jake]
    MKIIATALLVCFFTFVAIFTKVLLNKNTAPDNTNRIVLPILFTEDQVFDTNDLIGHPYILNVFASWCTTCQEEHKLWVEV
    AEKKTIKIYGINYLDTEHKVKEWLKKHGDPYTKIAKDYSGKMGSVLGVTAVPETFVFDKNGKMILQIHGNISKDILENQI
    LKLIQ

    >gi|73667315|ref|YP_303331.1| glutaredoxin-like protein [Ehrlichia canis str. Jake]
    MKNDIMDKIKHDIENNDVVLYMKGDADFPQCGFSSVVVSILKKMKVNFKSINVLEDLELREAIKEFTNWPTIPQLYVKGE
    FIGGCDIVKEMYHSGELQELFSKNNLISTQ

    >gi|73667324|ref|YP_303340.1| DSBA oxidoreductase [Ehrlichia canis str. Jake]
    MLRILFLLSLVILVASFPLINNWLSNKSGKPIVDKDTIIAIIEEYISNYPQKVIDLLTKGQVRAENEEMSQNIKKYKSEL
    ENTSYPSAGNKDSKIVFVEFFDYS
    CGYCKMMSEDMKQIVQDGKVHVIFRDFPILGESSLKVAQAALAVHMINPNKYIDFY
    YAALHYKQQFNDESILSIIKSIGITEEDFKVSLAKNADAIDKMIQSTRELAQNINIRGTPAIIVGDTFIGGAADISTLRS
    KIDMQK

    >gi|73667389|ref|YP_303405.1| hypothetical protein Ecaj_0776 [Ehrlichia canis str. Jake]
    MKFLILGKLFCLLAMVSFFGVAFCSDSQEEITEKFYSDTLVKLSDDITAKKLLSLLPNDRFVGNTKAPVVIIEYASFSCM
    HCAHFTLNVFPELERKYIKTGKVLYIFRNFPLDYVSLKAAMLGTCYNTASRFFTYTRAVFSSIEALVTNYKDLGVLSNIA
    KISNISDERFEKCINDEDIMNYVIQEKFVANRKLQVNATPVFFINGKKYDKSHDIESFSETIDELIMLHPNYSLVSGKS

    >gi|73667401|ref|YP_303417.1| thioredoxin [Ehrlichia canis str. Jake]
    MVSVMIEQISDSDFHSKVISCNEDILILVDFWAPWCGPCKTLEPQLEKLAQQYAEQVKIYKLSIEDNQDVAIQYGVSAVP
    TTLMFKNGKKLSQVIGADIAKIINELNNHI

    >gi|73667467|ref|YP_303483.1| glutaredoxin [Ehrlichia canis str. Jake]
    MTKVIIYTKDPCPYCTKAKALFNKKNILFKEIDVTNNSTLLEEMIQKSNGMRTLPQIFINDQHIGGCDDLYRLYESGKLE
    L

    >gi|73667473|ref|YP_303489.1| cytochrome c biogenesis protein, transmembrane region [Ehrlichia canis str. Jake]
    MFFSVNLDLIYILISALLGGVILNCMPCVFPVLSLKIMSLIKSAKYKKKISVKGEGLSYTLGVMTSMFVLSSVLLILRHF
    GHLVSWGYQMQSPMLITLLMYVMFLMGLSFSGFYDFPFIFPNLNGVNTKKEGLIGSFFVGVLSTFIATPCTVPFMVSAIT
    VALSQPSVYSLLIFQVLGFGMALPYLLLSFFPGLLKILPKPGKWMEVLQRFLAFPLYFSAAWLLCILVKQKGTEILFAVL
    SCAILFVMGIWIMKLVKSWKPVSKFVIFLCLLLLAISPLYFKSVKEFVMQNREPKRIATMEFSQAKLDQLLKEKKTVLLS
    VGADW
    CLTCKVNEQVFQLSTVQALFAKKNVYYMKGDLTTKNPEVTAYINQLDKNSIPLYVLYVGGVKVKVLPQVLSEKTV
    IDIIKQYVE

    >gi|73667498|ref|YP_303514.1| UBA/THIF-type NAD/FAD binding fold:MoeZ/MoeB [Ehrlichia canis str. Jake]
    MFDRYKKQILIPEIGKLGQKKLNSSHVLVVGCGGLGSVVIPLLAAAGIGHMVLCDDDTVQLSNLNRQVIYKESDINQSKV
    AKAKEFIRSLNSDINIQILNSFVTPKNFESIFKDIDIIVDCTDRLATKLFLNDAAVLIGKPLVHSAAIGFTGQILTIFPR
    GKPCLRCFFECQYMSSHLN
    CANAGILGPTVGVVGSIAASEVIKYLLGIEDSLVGKLQRIDLQSNDFSKYKFQKNDVCIAC
    SDNVRVDPYDYNYYESRLCF