Dyadobacter fermentans DSM 18053 uid59049

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|255033843|ref|YP_003084464.1| protein of unknown function DUF255 [Dyadobacter fermentans DSM 18053]
    MNRLSEQTSPYLLQHAHNPVDWYPWGEEALSKAKNENKPILVSIGYSACHWCHVMERECFEKEPIAEVMNAYFVCIKVDR
    EERPDVDAVYMDAVQAMGVRGGWPLNVFLLPDSKPFYGVTYLPPQNWVQLLKSINQAFTNHFDELADSAEGFVQNMIASE
    SQKYGLVEGTVHFNADDLDVMFEQIQRHFDTQKGGMDRAPKFMMPSIYKFLLRYFDVSQNPEALAQVELSLNRIALGGIY
    DHVGGGWARYSVDEDWFIPHFEKMLYDNAQLLSVYAEAYSLTQNPLYASRIEQTIQWLSAEMRSADGGFFSALDADSEGI
    EGKFYIWTQQELQSVLGEDFDWFSKLYNISAQGNWEHGYNHLHLTEPVEHAAKTAGILTDDFAGRYENAVTKLAEKRRER
    VRPGLDDKILASWNGLLIKGLTDCYRALGHEEIRELAIGTGHFIAGKMTTGSKLNHSFKNGVATVTGFLEDYAAVIEGYL
    GLYQITFEEDWLQKAQQLTEYALSNFYDQSEGFFHFTDAYGEALIARKKELFDNVIPASNSIMAQNLYTLGKMLDRDDYI
    EISDKMLSKMTKLLLADVQWVTNWAALYCQRAVPTAEIAIVGGDADAMRKDLDRFFIPNKIVMGTSTSSTLPLLLNRTDI
    NAKTAIYVCYDKTCQLPVTKVEEALDQLAGV

    >gi|255033898|ref|YP_003084519.1| methionine-R-sulfoxide reductase [Dyadobacter fermentans DSM 18053]
    MKNFIMAAIAGVFALTLQNCYGQSSADQSKPAQKAPEYSRTETAPVKKSNDEWQKILSPEVYRVARLKGTERPFTSEYEH
    SKEIGTFYCAVCGNPLFKSDAKYESGCGWPSFFEPISKKSIVEAADNSLGMHRIEVMCGRCKSHLGHVFDDGPPPTGLRY
    CINGVVLDFEKAKTAEKKFNSKKKTQTGS

    >gi|255033901|ref|YP_003084522.1| thioredoxin reductase [Dyadobacter fermentans DSM 18053]
    MSSEKVSCLIIGSGPAGYTAAIYASRAGLNPVLYQGAQPGGQLTITTEVDNYPGYPDGITGPEMMINFEKQARRFGTDVR
    YGLATSVDFTGYPHKVIIDNTHEITADAVIISTGASAKWLGIEGEERLNGHGVSA
    CAVCDGFFFRGQDVVVVGAGDTAAE
    EASYLAKLCRKVYLLVRRDEMRASKIMQKRLETLPNIEILWNTETVKLNGEHGLESVLVKNNKTGEEQLLEATGFFVAIG
    HKPNTDIFKGYVNMDETGYIQTIKGSSCTNIKGVFACGDAQDNVYRQAITAAGTGCMAALDAERFLVEREVDVIIEEETA


    >gi|255034099|ref|YP_003084720.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MCAFRKLIFALALVVNALNVFAADQPETLKIGAQAPDFNLMGVDGERYSLKSFADADVLAIVFTCNHCPTAQAYEERIKK
    LTADYKGKKMAMVAISSNDPKAILLDELGYTDLSDTYDEMKIRAKDMAYNFPYLYDGDDQKIALAYGPVATPHIFIFDKA
    RKLQYNGRIDDVEKPTGTPKNLDARNAIEALLAGKPVPVASTKTFGCSMKWAAKEDNVKKEQTAWAKEPVTLEVIDEAAL
    KELIQNKSDKLRLINVWATW
    CGPCVTEFPDFMVMHHMYRRRDFEFISISADNPDKKEKALKFLQGKFASNQNYIFNVEDK
    YKLIEAVDPKWQGALPYTILVEPGGKIVYSQQGPIDPAKMKKMIVENKYVGRYY

    >gi|255034215|ref|YP_003084836.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Dyadobacter fermentans DSM 18053]
    MHEPYKFDVAIVGGSYAGLSAAMTLGRARRKVIIIDSGKPCNRQTPHSHNLITHDGKTPAEISALAREQVLAYPTVQLRA
    GLVTQVTGSDGAFTVTTDDGQTLETKKIIFTTGIADIMPDIPGFAESWGISVIH
    CPYCHGYEYSDASTGVLMNGEMTLEY
    LKMIRNWTADLTLYTNGPAAFDDAARAKMHAFGAEIIEEPIASLDHESGYLQTLHLADGTARAITALYHRPAFVQHCLIP
    EELGCELTVQGFIKVDEAQKTTIAGIYAAGDNSGAFRGLTGAMAAGTTAGARLNHELINEEY

    >gi|255034241|ref|YP_003084862.1| thioredoxin [Dyadobacter fermentans DSM 18053]
    MGKALEITDSTFDELIQGEKPVLVDFWAEWCGPCKMIGPVVEQLAGEYEGKAVIGKMDVDMNSSVPAKFGIRSIPTLMIF
    KGGQLVDKVVGVVPKTTLEDKLNAQIEATV

    >gi|255034289|ref|YP_003084910.1| Rhodanese domain protein [Dyadobacter fermentans DSM 18053]
    MKPYRVILYYYYTPIADPDTYRDEHHLFCVENNLLGRIIVAPEGLNGTVSGTPEQCDAYMNYVRSDARFAGVQFKVEESD
    HIAFQKLHVRVKDEIVNSDLPVNPLERTGKHLEPADFKAMLNDPDVVLVDMRSDYEHEVGKFKGAITFDMHNLRELPDHV
    HEIAHLKDKKVITY
    CTGGIKCEKASAYLLDQGFKDVYQLHGGIIRYGLEEGGEDFDGKCYVFDNRITVDVNKVNPTVISK
    CHVCEEPCDRMVNCANPECNNHLPICEKCGWEMEGACSAECKTHPAKRAYDGTGYYVVNSNHYHPIQGLKSQQKNIKKMK
    LSLKTESA

    >gi|255034358|ref|YP_003084979.1| transcriptional regulator, AraC family [Dyadobacter fermentans DSM 18053]
    MNQQAYNYDKIAKAIEYIVANAKEQPTLTEVADEVSISQFHFQRLFSEWAGVSPKKFLQYITAGYLKDRIRESTSLAELA
    ESAGLSSQSRVYDHFISIEGVTPQEYKTAGKGLVISYGFHETPFGDCFIAATERGICAMAFVDEATRDMQLIELARKWHY
    ATIRPDQQLTAGYIGRIFKPAGQSLEKLPLLVQGTNFQLKVWEALLSIPQGAVTTYQQIAERIGHPKAVRAVGSAVGDNP
    VAYIIP
    CHRVIRKEGVLGEYRWGSLRKKALIGWEAARQDEEYFAQKQPL

    >gi|255034722|ref|YP_003085343.1| Methionine sulfoxide reductase A [Dyadobacter fermentans DSM 18053]
    MTALEKIGLGGSCHWCTEAIFQSLKGVLHVSQGWIASDDNPTRFSEAVVVEFDPVQISLETLIEIHLHTHSCTSDHSMRS
    KYRSAVYAFSGQQLSFASQAIETLQADFDKSIITEVIPFGEFKLNDEKYLDYYSKNPDKPFCKTFIDPKLKILLARFSGA
    VDKGKFFN

    >gi|255034992|ref|YP_003085613.1| Rhodanese domain protein [Dyadobacter fermentans DSM 18053]
    MNIITAEQLKTILENDDPIVIDARGGADALERYNQAHLESAQFVDLETDLSEKADDPASGGRHPLPRPEDFGRFLGILGI
    SPSSTVVVYDDKKGANAAARFWWMLKAAGHEKVYVVSGGLDAINAAGIQLTQKAATLHALEEYPVKGWHMPLVDADDVAL
    AAADPDSMVIDVREHYRYLGESEPIDLVAGHIPGAVNIPYTSNLDNLGEFMSPADLAAKYKDAFADKDPRKVIVH
    CGSGV
    TACHTLLALAEAGLHGASLYVGSWSEWSRSERPIATGEA

    >gi|255035041|ref|YP_003085662.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Dyadobacter fermentans DSM 18053]
    MRHYDAIVIGAGQAGTPLCRKLAESGLKTALIEKRWVGGTCVNGGCSPTKAMIASAKAAWSARHNEALGVSVGGITIDFE
    DIIERKNRIVQMMRDNSEKRIRETAGLDLIYGTARFSGRKEITVTLTDGSSETLIADKFFLNNGVQPVIPDIEGIQTIPY
    LTSTTIMQLDEIPEHLLILGSGYIALEFGQMFARFGSKVTLIERSERILKKEDKDITEEIAKILAQESIEILTNTEATGF
    SKNGHIISVTLETNGRKSQRSCTHVLVAAGRKPQLREFGLETAGVEADEKGYIKVNDQLETSAEGIYALGDVKGGPAFTH
    VSYDDYRLIIQKVVEKKQISIADRLIPYCIFTDPQLGRVGMTEQQAREKGIDIKVAVLKNDSVARSIETGDERGMMKAIV
    DAKTGQILGAAVLAEEGGEVITVLQMAMIGNITYDRLMNGIFAHPTYSESLNNLFMSLEG

    >gi|255035832|ref|YP_003086453.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MRYPLYIYLVCFGIVFLFTGCEYKKNNSVKVTIDYPKLAGDTVSIGRVNMVDVSTIELGKVLLDSAGKGVVEVEVEAPVF
    AHINGKELAAGILIYPGDEIEIAPSAAGARLAVQFRGDGAAVNQALNETQQIRSEFEKWNGTYYFQLNSEDFLAAKDSLQ
    KSYDHLFSKLKSDTQVSAERLALLTHQTGMHVVSYQYNFAIGKDTSEIPAQVRRVVEHLPIDTVALQSGMFDYSLVASQF
    FQHRINNAVYEENDQMDSDSLESIFPMMVEKKIKANEYPKPIEDFIRVKSADVQIRLNGLSPNMITLANTIEKEVASEEL
    KKVIREDVSRWEKLGPGKPAPDFTGTTPDGKKLALSDLRGKIVYVDIWATW
    CGPCVGEFPESKKVHSEFKEDDRVAFLYV
    SIDRDTLAWKKMVAAGRVPAGHHMLTSADAPESVWNLYHVWGIPRYLLIDAQGRMVATHAVRPSSGNVQGELRKLLSKSR
    IAQK

    >gi|255036042|ref|YP_003086663.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MLALLATSWRVAAQSCIVTGQINGVGAIPIQFRYIQNGVDKIDTVFATGDRFRYVAQKPDNGMFDIFIQNPAWTAVWYEA
    GNLTVSGNIDKAGQLEVKGTKENDLLTAFNQLRWAYREKAQGQPAEAVDKLIEEHTRKTWAFMKVNTPSLTAMYLLNGLT
    NGADVKIEDLDEAFHEFPPQIRESYYGKRAKERIEIVKNQPVKGKKAPDFKLVSSKGDSVQLSRHSGKYVLLDFWGHW
    CG
    P
    CIRSMPELREFHEKYKSKITLIGIAAEWGDDKETWLKTIEKHQANWIQLTDFRFDQGDIMKTYNISGFPTYLLIDPKGM
    VVARENNFQAIAKIVAETKALR

    >gi|255036225|ref|YP_003086846.1| UBA/THIF-type NAD/FAD binding protein [Dyadobacter fermentans DSM 18053]
    MTPIERKRYARQIIMPEMGLAGQDRLRAGKIAVVGAGGLGCPVLQYLVAAGVGEIGVIDDDTVDLTNLHRQILYSADDIG
    KNKAITAVEKLSVLNPFVKLTAYPDRLSAENGADLLNAYDLIIDGSDNFETRYLVNDFCVQLDKPFVFGSILRFEGQVSV
    FNWNGGPTYRCLFPDAEEGDN
    CAEAGVMGVLPGIIGTYMANEAIKIIAGIGEPLSGKLLVINTLTNNHSVFQFSRSVAAK
    PAVPSEKAAELPLEENTHEMSFDEYEALQATDPEQILLVDVREYYEFEADNFGGENIPLSDIPESIGTFPSGKKVVFY
    CN
    TGKRSLQAAKLLAQSGYEGQSFWAQHW

    >gi|255036281|ref|YP_003086902.1| Rhodanese domain protein [Dyadobacter fermentans DSM 18053]
    MKTFKPLFALVWLLIAHTALNAQTAPAAAAKRDLVSFEEFETRLARAGKNAQILDARLPEEYAQNHLEGALSFSVANEAD
    FSNAVAKLDKGKPTFIYSIGNGRSGKLAKDLRDNGFQDVTELPGGLSKWIGLGKPVVSTVGPGLSLADYQASLKSDKLIL
    VDFGSRY
    CGSCKRLAPIVDSIKHEQANAVKVITIEAYENKALIKQVGVTALPTLILYRGDKVVWKKTGVTPKGEIERVLA
    EANL

    >gi|255036366|ref|YP_003086987.1| putative pyridine nucleotide-disulphide oxidoreductase [Dyadobacter fermentans DSM 18053]
    MKKTLLAVCMILSLLPAMAQNHVFVETESFEDKGGWVIDQQSFVVMHSSYLMAHGMGRPVKDATTTVKLPKTGKYRMWVR
    TKDWAPFPKGPGKFQVVIDGKSTGQTFGESGSDAWKWYDGGVIETKSADMKLALKDLTGFNGRCDALLFTDDLKFTPPNE
    LEPLTAFRRKLLNLTDKPQDAGRYDLVVVGGGIAGTCAAISAARMGLTVALIQDRPVLGGNNSSEVRVHLMGDVDKNHYP
    KLGRIVREMDNGDPGNGNPDAKEYGDARKIAIVKAEKNISLFLNTHVFKVEKENDIITAVVGRDIATNQERRFSGSFFSD
    CTGDGTVGFLSGAEFRMGRESKAETGESLAAEKSDDFTLGTSNLWASLDRDTVSSFPETPWAMQFSDEYHIDEPKSDWQW
    ETGFGNFNTITQAEQIRDHNLRAIYGNWSYLKKNKAAKYGKKELAWVAYIGGKRESRRIIGDYVLNQMDIQEGKFYPDGS
    VTATWTIDLHFPDAKNSKYFEGQEFFAGTKHIKVAPYTIPYRCLYSKNIQNLFMAGRNISTTHVAFGSTRVMRTCGMMGE
    VVGFASYIANKYKTSPRGVYKDHLPELTGILKGETLAPQP

    >gi|255036371|ref|YP_003086992.1| hypothetical protein Dfer_2610 [Dyadobacter fermentans DSM 18053]
    MIIGESTHKREPKTIALAADLVIVGGGLTGTCAAVTAARAGLKVLLVQDRPVLGGNCSSEVRLWILGATSHMGNNNRWAR
    EGGVIDEIMLENAYRNPDGNPLIFDTVLLEKVTQEANITLLLNTAVYDLDKAQNGDKIEAVHAFCSQNSTKYTLTAPLFC
    DASGDGIVGFLAGAAFRMGAESAEEFGEKFAPDKAYGELLGHSMYFYSKDIGRPVKFVPPAFALKDITHIPRYKTFNPKD
    FGCRLWWLEYGGRLDTVHDTEKIKWELWKVVYGAWNYIKNSGEFPEAENMTLEWVGTIPGKRESRRFEGDYLLRQQDVVE
    QTVFPDTVAFGGWSLDLHPADGVYSDQAGCNQWHSKGVYSIPYRCFYSKNIENLFIAGRIISATHVAFASTRVMATSATG
    GQAVAMAAAVAHKHGCTPREVGEKHLEELQLELWRSGQYLPQTAVSDPDNLVNNAQIQASSTLELKELTGSDQWKPIQHS
    VAQMLPVRGNMPSVTVWVEAAQDTELVVELRKSSKPFNHTPDVILETKSYRLITGKHELVLDWDSHFAEECYTFVSFLKN
    ADVKIQYSEQRVTGLVTVFNATNPAVSNYGKQEPTEDLGVDTFEFWCPQRRPAGLNLAFTLSEPIRLFGTENLQNGWHRP
    IASPNAWVAAPDDRHPEIDIQWNENQLVSKIELVFDTDFDHPMENVIYVHPETVMPFCAQNVEVIDDAGKVIGTIADNHL
    TKRTITLAAPVSTRSLKIRLQNSHAHVPVSLMEVRAY

    >gi|255036440|ref|YP_003087061.1| glutathione peroxidase [Dyadobacter fermentans DSM 18053]
    MSFIKTLFIMITSLITGLFADKSEIAVRPENAPVAKQTLYDFKVKSLVGGKTVDLSKYKGKKVVILNVASKCGYTKQYAD
    WEKFYKDHGDKVVVLGFPANNFGGQEPGTSEEIATFCSATYGVTFPMFEKVSVTGDDQAPIYKWLSDKDANGWNDKVPTW
    NFCKYVINEKGELTHFFASKVLPTDAEFTKAVGI

    >gi|255036454|ref|YP_003087075.1| DSBA oxidoreductase [Dyadobacter fermentans DSM 18053]
    MKVEIWSDVMCPFCYIGKRRFESALAEFPQADQIQVEWKSFQLNPQMKTEPGRSINDYLAETKGWTPEYAQQVNDQVTNM
    AAEVGLEYNMDKAVLANSFDAHRFLQFAKTKGLGDAAEEQLFKAYFTDGRNTADHATLIELGTAIGLDAAELKAILEGTR
    FSEDVRRDIYEAQQVGARGVPFFVLDRKYAVSGAQHTETFLGALQQSFAEWEKANPKPLVNLADGANCIIDGQCD

    >gi|255036543|ref|YP_003087164.1| thioredoxin [Dyadobacter fermentans DSM 18053]
    MIFTAAFPAGEGKPFCSRKGYHYRQNSSIMATFSELINSDKPVLVDFSAEWCGPCKMMKPILEKVKADLGDSATIIKVDV
    DKNQSAAQAYRIQGVPTLIVFKNGKPLWRQSGVVQADQLKSVIQQYI

    >gi|255036667|ref|YP_003087288.1| Redoxin domain protein [Dyadobacter fermentans DSM 18053]
    MSSTTKKVSLVLLLLMAGAAVYFVFFKSPAVPEPVLSEAPAAPESVYLPLTDLTGKEVAMDENKIAFVNVWATWCGPCNM
    EMPSIQTLYNKYKDHSKVAFYIISDEDAATVNPFVARKGYDLPFYQYAGPYPSALDGNAIPRTYIIYKGKILTEEIGASQ
    WDRPEVIELIEKQLAEI

    >gi|255036682|ref|YP_003087303.1| Rhodanese domain protein [Dyadobacter fermentans DSM 18053]
    MDITVEELKERLEKGEDLHFYDVREEHEYEEDNLGAILIPLGELPDHLDELEALKDEEIIIHCRSGARSGKAARYLESQG
    FSNVRNVLGGILAYRELED

    >gi|255036696|ref|YP_003087317.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MGLKVGDPAPAFSVKDQDGNLVKLSDLKGEKVVLYFYPKDNTPTCTNQACNIRDNYAALLKKGYKVFGVSPDSEKSHQRF
    IKKHNLPFPLLADTEHQMINAYGVWGEKTTFGRTYMGLLRTTFVINKKGIIEEIISKVESSKHTDQILGKTE

    >gi|255036718|ref|YP_003087339.1| hypothetical protein Dfer_2959 [Dyadobacter fermentans DSM 18053]
    MKPTIEIEYCPKCGWLLRAAWMAQELLTTFSDDLHAVKLRPSEVAGRYTITIDKQLLWDRKREGHFPEPKEIKQRVRDVA
    APDRDLGHNDRSK

    >gi|255036857|ref|YP_003087478.1| alkylhydroperoxidase like protein, AhpD family [Dyadobacter fermentans DSM 18053]
    MSRKPTSELTPQAFAAVREIEKYVASTGLDKVHYKLIKIRASQINGCGYCLDMHARQARELGMSDQRIYMLSAWREAAIY
    SEEEKAILALTEEVTLIHRGGVSDAVYNRAVALLGEEYTKAVIMGVVAISAWNRILIADQVTVHAAESHV

    >gi|255036863|ref|YP_003087484.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MQTFHSLMRDYTRTCLMLLLILTGFFSTAYSQGYRIDATIHGMRDSSFVLAHYNRNGSQIVPKDTAKADANGKIVFEGKT
    ALPGGLYVILFPGNQKMIEVIYSGKETNFAIEADTSDLNGSVKVTGSRENELFYNYRQELAKGGKEIEVLGKQATPEAQA
    RVKTIQEGFGAYRKKLLAENAGTFTAQLLKMSADPEIPAAPKLANGKTDSTWIFNYYKAHYWDAFDFSDPRIMNTPFLEP
    KMERYFKNLVVQVPDSIIKDADLIVKKASANKDIKSWTVYYITNQYENPKTVGTEAVWVHMATKYYLSGEMGVSEEVKKR
    VSEKVATMKDLLVNKTFPALTLTDPAGKKVGVQAIDANYTVLFFYAPT
    CGHCKEASHVLKAFYDKNKAKGIKVMAISTEH
    NVEEWKTFIKTYHMEELINGFDALNQIDFNRKYDVVTTPMIYILDKNKKIIARKMPVEQLEDFLNYYQNKMARKL

    >gi|255036865|ref|YP_003087486.1| copper-translocating P-type ATPase [Dyadobacter fermentans DSM 18053]
    MEATTDIKKITLPVTGMSCAACAVSVESMLGHTKGVSDAAVNYANQSVAVSYDPDLIDLPEMDRVLQSIGYGLIIEENEE
    DAIAEQEKIQQEHYLQLKNKAIYTGILTAPIVVLGMFFMNWTYANYIMLALTIPVLFIYGRGFFVNAWNQARHRKANMDT
    LVALSTGVAFLFSTFNTFFPAFWHARGLHPHVYFEASAVIAFFILLGKLMEERAKSNTSDALKKLIGLQPKTVKVYRDGA
    ETEIPVREVRLGDEVIIRSGEKIPVDGTVASGSSFVDESLMTGEPIPAEKKPGDSVFAGTINQTGSFTFTAEKVGKQTVL
    AQIIKTVQAAQGSKAPVQRLADRIAGIFVPVVIGIAMLTFVAWLVWGGENAITHAMLTAVSVLVIACPCALGLATPTAMM
    VGVGKGAENNILIRDAESLEKAYKVDAVILDKTGTLTEGRPQVTDWKWAASVQNQPQHSAAVKALESRSEHPLATAIVQH
    VDTAGQPEVTRFESLTGSGIRGVVAGNAYSIGTFQFLEKEGVRLDAALQSAYDTLTAQAKTVIGIAINGQHAGLVAIADQ
    LKPTSREAVARLRGQGIEVHMLTGDNAQTAAAVAFQVGIDSFRAEVKPDDKMQFVQKLQSAGKTVAMVGDGINDSQALAQ
    ADVSVAMGKGSDIAMDVAKMTLITSDLLALPKALTLSRKTVVTIRQNLFWAFIYNLIGIPIAAGALYPLNGFLLDPMIAG
    GAMALSSVSVVMNSLRLKGSRL

    >gi|255036877|ref|YP_003087498.1| beta-lactamase domain protein [Dyadobacter fermentans DSM 18053]
    MKIEQIYTGCLAQGAYFIVSNGEAAVIDPLREVAPYIQKAEKTGAQIKYVFETHFHADFVSGHLDLAEKTGAEIVYGPGA
    QTGFKAHIATDGEEFKLGDVVIRALHTPGHTMESTSYLLLDESGRPVALFSGDTLFIGDVGRPDLAQKGDLTMDDLAGIL
    FDSLRSKIMPLPDDVIVYPAHGAGSACGKNMSKETSDTLGNQKRFNYALRADMTKEEFIHEVTAGLTEPPQYFPENVKMN
    RDGYESIDDVLERGHQAFSPEAFEAKANNTGALILDTRKPGDFAEGFIPNSINIGIEGSFAPWVGALIPDLKQQLLIVTE
    PGREEEVVTRLARVGYDYTIGYLNGGFEAWKKAGKEIDQVESVSAEEFADRYPAGDLEVIDVRKPDEFASGHIQGARNLP
    LDYINDLMPEFPKDRKLHIH
    CAGGYRSMVAASILKSRGIDDVVNIEGGYGAVSKTNVPVLTEA

    >gi|255036907|ref|YP_003087528.1| iron-sulfur cluster assembly accessory protein [Dyadobacter fermentans DSM 18053]
    MVTVSDSAKNKIVELRKADGFEEDYQIRVGVLGGGCSGLTYNLEFNSESKPNDMVFEDKGVKIIVDKKSLLYLAGTTLDF
    SDGLNGKGFQFINPNATRTCGCGESFAV

    >gi|255036937|ref|YP_003087558.1| FAD dependent oxidoreductase [Dyadobacter fermentans DSM 18053]
    MKTPEYDAVVVGSGPNGLAAAITLQEAGLSVLVVEGKDTIGGGMRTAELTLPGFRHDICSAVHPMALMSPFFARLPLADF
    GLRFVQPTHDAAHPLDGGRVAVLDQSVESTARQLGADGDTYRKWMGSLLDSIPKLLPALLGPLQWPEEPFRLAGFGLQAL
    PPATWTAARFKTAEGRALWAGMAAHSIQPLGNLATSAFGIMLMAAAHIKGWVIPVGGSQSIADALAAYFRSLGGEIRTGW
    MVASADELPSSKVILMDVTPRQLVRIAGSRLSSSYKRRLGTYRQGPGIFKVDWALNEPIPFQREECRGAGTVHLGNTFEE
    IVRYERNVGNGKRGEKPFALVAQQSVFDKTRAPEGKHTAWAYCHVPNGDDRDMTDALESQIERYAPGFRDVILAKHATNA
    SAFEQYNPNYIGGDINGGIQDIWQLYSRPVVSVSPYRTSADDIYICSSSTPPGGGVHGMCGYHAARQALKDVFKVKIG

    >gi|255037116|ref|YP_003087737.1| UDP-galactopyranose mutase [Dyadobacter fermentans DSM 18053]
    MKQYDYLVVGAGLWGSVFAHEATKRGKKCLVIDRRDHIGGNVYCENVEGINVHKYGAHIFHTNDKDIWDYVNSFVEFNRY
    TNSPVANFNGELYNLPFNMNTFYQLWKVRTPEEAKEKIRQQVEEAGIKDPQNLEEQAISLVGTDIYEKLIKAYTEKQWGR
    KATELPAFIIKRLPVRFTFDNNYFNDRYQGIPIGGYNKLTEGLLNGVDVRLGVDFFKERESLTELAETIVYTGPIDEYFD
    FRFGQLEYRSLRFDNQLLDQENYQGNAVVNYTDGETPFTRIIEHKHFEFGTQPKTVITHEYPQEWVKGAEPYYPVNDDKN
    TAVFNQYKALAAEEPNVIFGGRLAEYRYYDMHQVVASALKKVKVHFDS

    >gi|255037276|ref|YP_003087897.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MRLLLSFGILSIFTLIAAFRPSPVTPPQNGIWRATLSRDKQKLPLILDISKNSDGKTYTVNIINGTEKLKMDSSYFQNDS
    LVIPMMMFDAKIIAKSTGDELKGTYYRYANGKVAGSLPFEAVQGENYKFFKKGEAKSSRNVSGKWATTFTNPASGDETIA
    VGNFTQQGTDVTGSFLTPTGDYRFLTGSVNGDSLYLSTFDGSFAMLFKAAFQPDGSLKGSQWSGIKAYKTWTARPDANAK
    LPDATKMTFLKPGFESVDFSLKDTKGKTWTLKDPRFAGKPVIIQIMGSW
    CPNCMDETNYLAPWYKKNKKRGVEIVGLSFE
    RSDKPEISNPKIDRMVSRFGIEYPVVLAGTSSEESTAKALPMLNKIMSYPTTIFIDKHGKVREIHTGFNGPGTGHYYDEF
    VADFNTLMDKLISEK

    >gi|255037382|ref|YP_003088003.1| protein of unknown function DUF1573 [Dyadobacter fermentans DSM 18053]
    MKVFFSALVLILGLTTVSFAQKGVLKFKEETHKFGKVPQGTPVTHEFVFTNTGSDPVILSNVTVSCGCTTPVWSKEPVLP
    GKTGSVKATFNAAAAGPFNKPVTVFSNTEGGSITLYLNGEVVPKTAAKSSK

    >gi|255037503|ref|YP_003088124.1| peptide methionine sulfoxide reductase [Dyadobacter fermentans DSM 18053]
    MRTTIPIFTFIFLCCMALVSCAQSDKKHKSKMDKETASTALDESNVDTANTEIATFGTGCFWCTEAVMESLDGVKKVVSG
    YSGGHDPNPSYKAVCTGTTGHAECVEVTYDPKVISYAELLEAFFRSHDPTTLNRQGNDVGTQYRSVIFYHTDDQKQLAET
    AKAELDKSGAYANPIVTEITKSQKFYPAEDYHQNYFANNPEQGYCAFVIAPKLDKFKKVFKDKLRKQI

    >gi|255037701|ref|YP_003088322.1| Thioredoxin domain [Dyadobacter fermentans DSM 18053]
    MSLKMKSLKNLGFAMAALMLAMSVATAGEGDKKATAASTIAADKGIQFTEAKWAEILKQAKKENKLIFLDAYTTWCGPCK
    LLQKNVFTRDDVAATFNGNFINVKIDMESGEGPALTKKYPIEGYPTLFFINSKGKVVKQLLGYQQPADLIKAAKAVQKGP
    TS

    >gi|255037743|ref|YP_003088364.1| dihydrolipoamide dehydrogenase [Dyadobacter fermentans DSM 18053]
    MAQTYDVIVIGSGPGGYPAAIRASQLGLKVAIVEKESLGGICLNWGCIPTKALLKSAQVFEYIKHAKDYGINAAEYSADF
    GAVIKRSRGVADTMSKGVSFLMKKNKIDVIMGAGKVKGQKTVEVTDKDGKKTDYTASKGVIIATGARARELPNIKLDGDK
    IIEYRKAMSLEKQPASLLVIGSGAIGMEFAYVYNSMGTKVTVVEFLPNLVPVEDEEISKEIAKQYKKIGIETLVNSSVEK
    VDTSGKGCKVTVKTPEGEKTFEVDVVLSAAGIVANIENIGLEETGIKTDKGKIVVNEWYETSVPGFYAIGDCTPGQALAH
    VATAEGIICAEKIAGHKTEALDYGNIPGCTYCQPEIASVGLTEKKAKEAGYDIKVGKFPFKASGKAVGAGVTDGFVKVIF
    DAKYGEFLGAHMIGANVTEMIAEVVVARKLETTSHEIMRSVHPHPTMSEALKGATEAAYGEAIDL

    >gi|255037778|ref|YP_003088399.1| Redoxin domain protein [Dyadobacter fermentans DSM 18053]
    MENKRFDPDFFRIIELLLMIGLLSACGETSEIVVRGDLRGADTFLEGKRIFLENAETRYFVDTTVVRDGQFEFQIDTQKD
    FIPFRAAIYFETGNPEWPRQLIGYRNPYFMKTGEVNFYAERGLMELQLDTIRVFTPKNTEVMFNIKDVNRQTSTLFHHFS
    LKTGAQNVAANRAYNRSLVERHPYSLDLLRNLNFRKAALQPDEAKELLALFDPQLHTNPVYITLQNYAMLENKTGKDFPA
    TVALKTADDRLYDEALLDPTKHNLIVFWASW
    CGPCRMEIPQIKKLYERSNAKLNIVSISVDKDQGAWKGAMQKEQMPWKQ
    FLLPAGETYAMLDKKYNLETIPVWMLLDHKGKMIEQHVGYDTGENAMDLKVAKLLK

    >gi|255037850|ref|YP_003088471.1| protein of unknown function DUF255 [Dyadobacter fermentans DSM 18053]
    MKRLLSSLILFSAMLVALTGFKADTNKPADGIQWLTIDEAYAKIQKEPRKVLVDVYTDWCGWCKVMDRETFKDKAVTDYI
    NKKYYAVKLDAEQKGTIKLGDKEFKYLAQGGRGINEIALALTNNQPSYPTTVFLDDHFNMIQPLAGYLKAKEFHQIITFF
    GEDFHKKQDFETFKAKTYKELYPAK

    >gi|255037920|ref|YP_003088541.1| cytochrome c biogenesis protein transmembrane region [Dyadobacter fermentans DSM 18053]
    MKRGILFILSIVLFVAGVVQAQIQKPKARWTYSFSKPEVKKGETVDLVFTATIDKDWYMYSSDFDPDLGPVLTTFTFEKN
    NTFEVVGKLKPQSPKTKFEEVWGGNVRYFEGKGVFKQTVKILADNPVIKGASEFQTCSHVTGLCIAGGEDFEFKGLKVAA
    AGGSQPHVGAATPANTQSGAASATETAKSAATTSSGVATPASASAATNDTAISISASDNPAAADSASAATTAPTASTEVT
    AATDTPADGSLLGFALAAFLSGLVALLTPCVFPIIPMTVSFFTNQEKGKFKALLYGISIILIYTLIGTVVSRLNGPAFAN
    FLSTHWLPNLLFFAIFITFGLSFLGLFEIVLPSGFVNKMDQKADQGGYAGVFFMAFTLVLVSFSCTGPIVGSLLVASAGG
    EVVKPIVGMAAFSAAFAIPFTSFALFPQWLKSLPKSGGWLNAVKVVLGFLELALALKFFSIADQVYHWNLLDREIYLAFW
    IVIFALLGFYLLGKIRTPHDSPIEKVSVPRLLLAIVTFTFVVYMIPGMFGAPLKALAGYLPPQSTLDFDLSKRSAAATTP
    SALAGESRKYADLFHLPHELEGFYDYQEALAYAKKVNKPVFIDFTGHG
    CVNCREMEARVWVDPAVLQRLNNDYVIVALYV
    DDKTELPESQWYTSKYDNKVKKTIGAQNADLQIVKYNNNAQPHYCLVDHEGNLLVSPKNYDLDPAKFAAFLDSGKAAFGK
    K

    >gi|255037973|ref|YP_003088594.1| beta-lactamase domain protein [Dyadobacter fermentans DSM 18053]
    MERRNFVKQLACIGIGSAVPLHDILARTVFASPNYEIEQFEVKGLAHFSYAVRAGSKVVVIDPQRNPGVYYDYAKKKYGE
    IIGVVETHPHADFVSAHQEMHQKLGVPVYASSLTEAAYRHTDFDEGKVIKLSDHVTLRALYTPGHAPDHISVVLAEDGRD
    KVVFSGDALFIGDVGRPDLREFSQKTEAQRQRLAEMMYDTVHTKFAKLADDVVVYPAHGAGSLCGKSIRKALSSTIGEEK
    QSNYAFEKRSKEEFVKLLLSDQPFIPAYFKYDVELNMAGAPDVQPALAAVKRLPQNHRPEPKAMVIDARPADLFKASYIP
    DAINIQGDGAGFVTWLGTVVHPDKAFYLVAQNDQALKMALEKTALIGYESKVKGAFVYDAKDGERFTIFDKTGFDPKAKR
    YTYIDVRTTKEAQQKPLFDGAINIPLQDLEKRFSEIPTDKPILVS
    CASGYRSATASSLIRKRLPDAKVYDLGADVVEYLK


    >gi|255038274|ref|YP_003088895.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MANRLLSVGSEFPEFKKTSVVSLEKGNEFYDITSEDHKNAGKWMVMFWWPKDFTFVCPTEIAEFNKHTGDFADRDTILIG
    ASTDSEYVHLAWRKNHDDLRDLQFPMLADTSKSLAEELGILEANEKIAYRVTYIVDPQGIIRWVSVNDLSVGRNVSEVLR
    VLDALQTDELCPCNWQKGEATLA

    >gi|255038383|ref|YP_003089004.1| hypothetical protein Dfer_4638 [Dyadobacter fermentans DSM 18053]
    MQVMKFDMCYICLACFCIYVSGCERSNNRQIAGEVEGERIYLDEVDGMITNSLYEYLFAISETRIIAANELINLKVLKIE
    AGSRRISVDSLLSMEMRRISMQETKLKYIRDNALQGGVVDERNPFKLHPLDTPAGAEILNNSYQKFLRIRLVDELRVKYR
    ARILLSRPQPPQVDLTNVTSHARGNLKALHSVTIVSDFD
    CPVCREAYPELSKLFERYSDHVRFEAISLSSSVTPPILFAE
    CAAKQQKFWEVYGYLYGQKGYDFNIDSLIAQFELNREECKSCLESRDQHKIIETDMNRLRQVGIEVTPTVLIDHRVYHGP
    LTDKAIGRFLDDLFKETPNPGN

    >gi|255038510|ref|YP_003089131.1| methionine-R-sulfoxide reductase [Dyadobacter fermentans DSM 18053]
    MREVQKTREEWQQELSSQQCFVLFEKGTERPFSHPYNDNKEEGTYVCAACGTPLFSSETKYDSGSGWPSFFMPVAKENVE
    EIVDKSHGMIRTEVVCRTCGGHLGHVFNDGPKPTGLRY
    CTNGAALKFHKAE

    >gi|255038630|ref|YP_003089251.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MKIRISLWVSMILCLSLLAGPASAEDGERGASRQSQRGYQVGDAVSNFRLKNTNGNMVSLSDFASSKGVIVVFTSNHCPF
    AKAYEDRIIALNNKFAGQGFPVIAINPSDPGTHQDDTFEKMKERAAAKNYGYPYLVDDAQQVARAFGAARTPQAFVLQKN
    GAQFAVRYVGMIDDNPQDASGVTKFYVDEAVTNLAGGKPVVTTLTKPVGCAIKWKNQ

    >gi|255038670|ref|YP_003089291.1| protein of unknown function DUF1573 [Dyadobacter fermentans DSM 18053]
    MFPMKKIALFACLGLAVAFSGCSKTEKNGEEKQANSKLPVFALIDSAEYDFGTIQEGAIVEHEFKFRNDGEYPLILNNIS
    SS
    CGCTTPEWPKEPIGPKQSSSIKVRFDSKHKAGPQVKTITVYANTEPAYTELRLKGIINAAPQPALADSATARK

    >gi|255038736|ref|YP_003089357.1| arsenate reductase and related [Dyadobacter fermentans DSM 18053]
    MLTLYGIPNCDTIKKARTWLDKNKVAYQFYDYRKDGISPEKVASWFSEFPWDKVLNKASTTWKELSDEEKANVTNAQSAA
    KLLSANPTAIKRPVIEDESGKALTLGYNEKIYQETYLK

    >gi|255038745|ref|YP_003089366.1| OsmC family protein [Dyadobacter fermentans DSM 18053]
    MKVELVRVDDAFHFEGTGSSEVKVHTDGSPEIGGQNLGVRPMELLLMGLASCSAIDVVLILKKQRQDITDFRVVADGDRE
    QEPDTQRKPFRKIHLTFKFAGNNLDEAKIQRAIGLSMEKYCSATAQLEALATITYDVEIATV

    >gi|255038806|ref|YP_003089427.1| HesB/YadR/YfhF-family protein [Dyadobacter fermentans DSM 18053]
    MNNPIQLTEAARLEIRSTLEANKIPDTYGLRVGLRGGACSGSFLLGFDTATEHDQTYLIEGIKVFIDKRHLMYVIGVSVD
    FEEGVNGSGYTVSAAEKVK

    >gi|255038936|ref|YP_003089557.1| Peroxidase [Dyadobacter fermentans DSM 18053]
    MSLRLGDIAPDFEANTTQGPIKFHEWLGDSWGLLFSHPADFTPVCTTELGKTALLKGEFEKRNVKVLAVSVDDLDSHNRW
    IPDINEVNDTEVNFPIIADEGRQVAQLYDMIHPNASEKATVRSVFVIGPDKKIKLTLTYPASTGRNFNEILRVVDSLQLT
    ANYSVATPADWKDGEDVIVVPAVSTEDAQKKFTKGLNIVKPYLRYTPQPNK

    >gi|255039062|ref|YP_003089683.1| Copper-exporting ATPase [Dyadobacter fermentans DSM 18053]
    MTMSILTAPEATPDTRHVCYHCGEDCRDEVLHADDHDFCCDGCLTVYGLLKESDLCQYYSIDGAQGISPDPSFYKNKYDH
    LDLPEVHDKMIEFTDGRLTTVYWYLPKMH
    CSSCIWLLEHLYRLHPAVRSSVVNFPEKKVRITFDAAALRLSGLAALLTRI
    GYEPYLSMDDLSGKKAGKWNRTRLYKIGIAGFAFGNIMMLSFPEYFHLGQNTSDQNLRTLFGVLNLALSLPVLFYCAADF
    YKSAWAALKGRYLNIDAPIALALSCVFLISIYQLATQSGPGYLDSFAGAVFFMLVGRYFQDKTYAGVSFDRDYKSYFPVA
    ISMTDGETETRKPITDLQKGDRMLVRNEELIPADAVLQSPLAMIDYSFVSGESQPVERRKGDTIYAGGKHKGAAIELEVL
    RAVSQSYLTQLWNNEAFAREKDDANTSLAARINRYFSLVVLGIATVTFLVWFFAFNNAETAFLAFTTTLLVACPCALLLS
    STFTNGNLLSVFSRNRFYPKNAHSIERLAQIDAVVFDKTGTITLPDDAEIDFTGEPSTREELVMIKSLVTQSSHPLSRLL
    AKHLADVPASKRVLSGFSETSGKGMTAQWGAQTVRVGSAGWVGAAADDDAGQSSRVYIAIDGAVKGYFTIRSKYRPELPE
    TLAALRDAGIGTYLLSGDRPTDRELLTPLFGPNATLLFNQKPEQKLDFVRNLQREGRHVLMVGDGLNDAGALRQSNVGLA
    VSDDINNFSPSCDAIVEGSQLSLLPGYIALARSGQRIIRQSFAISLIYNILGLSFAITGHLSPVIAAILMPVSSITIVAF
    TTLASNAAARRCLKKLTNVINRT

    >gi|255039145|ref|YP_003089766.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dyadobacter fermentans DSM 18053]
    MKKSCMKLIVLFALTVLLIPNPSTAQQQQFDDTPIRNINTFYQFIDEKLNKDSAFFYLQKVAGHGLSASRIPGIIHEELA
    QYVLNRSFPPDMDSAIVARFRRGQVVNKQLMEMIMADTNKVLKGAVNPLYLFSKIQDNPNDNQKLAQIANQFIREELSDK
    DIYSNRSGRYALMIYPLLRSQKELQPLAATLLKKTSDYVNDGLLLVSENTTGDNAGKRAWYRYLYAYTNVLNSEQVNDPD
    KKMSLLKTAFDYSPDVLDRSNNWGYFYDMFIIFGKEKASFRDEYLQFLTEHVKDQQVVFNTILEIALQQPEYKGKLKEVF
    HKINGPQKDFAQFWMATVDHYAQPAPPISLSMLDKSRFSNQTAAGKWILIDFWGTW
    CGPCRSEHPAIQKFYESVVTANAG
    KIAMLTIACRDTEAKVTNYMKEKKFSFPVAMSDNQVEHTYKVPGYPTKLLITPAGKYITVPAGHDWASFVTHYADL

    >gi|255039292|ref|YP_003089913.1| methylated-DNA/protein-cysteinemethyltransferase [Dyadobacter fermentans DSM 18053]
    MGNIFKQMASPTGTLTLIASEKGLRAVLWNHNPEKSGIDRGVEDLAHPLLLETEKQLNEYFSKKRKTFTLHLDFVGSDFQ
    IQVWEAMLTIPFGETRTYGDIARQIGNPDSVRAVGGAANKNPIPIIAP
    CHRVVGANGKLVGFGGGLENKAILLALEAPYR
    QTSIFD

    >gi|255039419|ref|YP_003090040.1| hypothetical protein Dfer_5686 [Dyadobacter fermentans DSM 18053]
    MKQIILAFALIISFQSRGQITFIDSNTPWNELSKQATEQDKLIFIHFENSECVQCNEVASQGFSGKDLKELFDDNFISIR
    CNVSTPNGLSLARKFAIRSSLMSLFVDANGNILHVNNGSTGNSGAYESGAELALSRKGQKQLADYDKEYKAGVRGLVFLR
    EYMTKKREASMPVDQLLDEYVAFLPIDSLANFQSVQTILAFAPALNSAAYKAITTKTPPSLLDSIFQAGSPDNRKMMREG
    IIGNTFRLAVWKRDEPLAVRTAEFARDVQRKSPSKGQVEYAKTMVQYYYQTRDTLRYLEQAVQLMESHYMPLTVDSLNKM
    DDAAFHEQNTAFTTKRGKPEQGIVVRSMAIMPPSQFIYKDLNEHAYHFYELTRDKALLEKALAWSKKSMELGDSKGRRAQ
    TPFKLGDPNWMDTYAHILYRLDRRDEAIEWQTKAMEAQKISGMAYQSFEIRLNKMKTGTL

    >gi|255039504|ref|YP_003090125.1| OsmC family protein [Dyadobacter fermentans DSM 18053]
    MINRKATAIWKGTGKEGTGTISTQSTVLENTQYSFNTRFAEGKGTNPEELVAAAHAGCFAMKLSFELNAAGFTADELNAT
    ATISLDPAQGKIVKSAIELKAQVPGISAEQFAQVADKAKKE
    CPISQLLNTEITLNAELVG