Dinoroseobacter shibae DFL 12 uid58707

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|159042586|ref|YP_001531380.1| putative thiol-disulfide oxidoreductase D [Dinoroseobacter shibae DFL 12]
    MARKLTSLALGVAIAAAGAYWYTSQSGVPTAGVTLNPVGSVEAQEVDTSGIVEMTLGAADAPITVVEYASFTCPHCATFH
    QNVFPELKENYIETGKVQFIYREVYFDRFGLWAGMVARCGGEERYFGITDMLYEQQSEWTGNGSPAEVADNLRRIGRVAG
    MSDEQVDACLQDGEKAQALVAWYQQNAEADGINSTPSFVINGENYSNMNFRDFAAVLDGLLEE

    >gi|159042591|ref|YP_001531385.1| thioredoxin domain protein [Dinoroseobacter shibae DFL 12]
    MLEFGQTGGGAPAAGDLVKDTTEATFMADVVDASQEIPVIVDFWAPWCGPCKTLGPALEAEVTAAKGKVRMVKVNVDEAQ
    MIAGQMRIQSIPTVYAFHKGQPVDGFQGAITPAEIKDFVSRVAALGGDDGLGEAVEAAEAMLTEGAAVDAAQTFAAILGE
    EPENAAAYGGLVRAHLAMDELDKAEALIAAAPDAVAKSPELDAARAQLELARQAAQAGPVAELRAKVTADPDDHQARFDL
    AQALYANGDTQAAVDELLDLFRRDRDWRDGAAKTQLFTIFDALKPEDPIALQGRRRLSSMIFA

    >gi|159042669|ref|YP_001531463.1| redoxin [Dinoroseobacter shibae DFL 12]
    MQVGDKLPEADLIKLGADGPETVSVSSLTAGRKVILFAVPGAYTPTCHSAHVPSFVRTKDAFAAKGVDEIICVSVNDPFV
    MKAWGEATGAADAGITMLGDPGSEFTKAIGMDFDAPPAGLHARSKRYALYAEDGVVKVLHAEENPGVCETSGGEAMLDAI


    >gi|159042677|ref|YP_001531471.1| uncharacterized peroxidase-related enzyme [Dinoroseobacter shibae DFL 12]
    MTDTPDLVTALNLPQVDPLPPETAKYFAICEEKLGLVPNVLRAYAFDIDKLNTFAALYNDLMLAESGLTKLERELIAVVV
    SSVNRCYY
    CQVAHGAAVRELSGNPELGEQMVMNYRVANLSPRTMAMLDYAVALTEASAKVTETDRARLREHGFTDRDIWD
    ISAVTGFFNMTNRLASGVDMRPNPEYHGAHR

    >gi|159042702|ref|YP_001531496.1| 3-mercaptopyruvate sulfurtransferase [Dinoroseobacter shibae DFL 12]
    MLNKAAGPVSQDDPKTLVSTDWLEAHLSNPDLRVLDASSYLPGSGRDPKAEYDAAHIPGARFVAIDDVSDARSDLPHMAP
    PVEKFMSRMRALGVGDGHQVVVYDGAGLFSAARMWWLFRLMGKTDIAVLDGGFPKWQAEGRPVEDLPPVVRDRHMTVQRQ
    AHLVKDVTQVAAAAKLGEPQVVDARSAGRFRGEEPEPRAGLRAGHIPGSKNLHYATLLAEDGTMKPLDELRAAFVAAGVD
    LDKPVITT
    CGSGVTAAILSLALERLGHRDHSLYDGSWSEWGMYGDLKVATG

    >gi|159042891|ref|YP_001531685.1| putative mercuric reductase MerA [Dinoroseobacter shibae DFL 12]
    MTNRIETDICVIGAGSGGLSVAAGAVQMGARVVLIEGHLMGGDCLNFGCVPSKALIAAGKQAHIVRAGGFGVAPAEPVID
    YAAAKDHVRRVIDTIAPVDSQERFEGLGCTVIREYASFISETELQAGDTVITARRFVIATGSRPFVPPIPGVEDVPYYTN
    ETIFDLREKPEHLIIIGGGPIGMEMAQAHVRLGCKVTVLEGAQALGKDDPELAAIALERLRGEGIEIIEGAQASNISGKG
    GAITVETANGQSVTGTHLLMAVGRTPNLDKLNLEAAGVDYDRRGLKVDASLRTTNKRIYGAGDVAGPLQFTHVAGYHAGI
    LIRQLVLGLPAKTRDDHVPWATYTDPEIAQVGLTEAQAREKYGAALEVARFEYDENDRAIASGKTTGLIKVMVVKGRPIG
    ASIVGAEAGELIGLWAYAIANKHKMSAVANMIAPYPTLGEINKRAAGAYFSPRLFESALVKRIVRIVQKF

    >gi|159043220|ref|YP_001532014.1| nitrogen fixation protein fixI [Dinoroseobacter shibae DFL 12]
    MSDLSAHSLGPSANSACPACAAAPLAEQLSKRPVRGGIVLSLPGIHCASCISGVERLLDATPGVVGARVNLTRKRVLIDA
    EEGITPEALAQLLTDKGFEAYELDPGQLGNAEADRPARDLLMRLAVSGFAMMNIMLLSVAVWSGAEAATRDMFHWISAAI
    AIPTIGFCAQPFFSNSWRALKAGRLNMDVPISLAILLAVGMSLYETANSGAHAYFDAAVSLTFFLLAGRYLDFRTRASAR
    SAAQELAALEVPRAIKLVGGTEVKTVVADLAVGDLIRVTPGSRVPADGLVVDGVSELDRSLLTGESLPVHAAPDTPVSAG
    EMNLTGVLTLRVTAAGQDSSLHRMAELVAVAENARSKYTSLADKAAGLYAPGVHILAALTGLGWMLYSMDLRLSLNIASA
    VLIITCPCALGLAVPAVVTAASGRLFRRGLLIKSGTALERLAEVDEVVFDKTGTLTLGQPILENADRIAARDLAVARALA
    QGSAHPLARAIAATDAGGASAEVTELREVPGYGVEGRWQDQPVRLGRADWVGAAQGDVTATWLRIGQAAPVAFEFKDALR
    PGAAEAVAALQARGLKVSLLSGDAPGAVARVARELGITDYRAECRPEEKAAHVTARGEAGYKVLMVGDGLNDTAALAAAH
    ASVSPASALDAARVASDIVLLGQDLSPLADMLQTARKSTKLIRENFTISTVYNVVAVPLAIAGLATPLIAALAMSVSSIT
    VSLNALRVR

    >gi|159043297|ref|YP_001532091.1| redoxin domain protein [Dinoroseobacter shibae DFL 12]
    MTGQHGFEIEWSELPKPVDDGAAAHLPGMVLPAVALPSTGGGTVALDRLTGTAVLYVYPMTGTPGVALPEGWNDIPGARG
    CTPQSCAFRDHFADLQAAGAAHVFGICTQSPVDQAAAAARLHLPFPLLSDAAGALTRALRLPTFEADGITCLKRLTLIAR
    DGWIATCFYPVFPPDRNAAEVESWLKAAPNR

    >gi|159043322|ref|YP_001532116.1| arsenate reductase and related [Dinoroseobacter shibae DFL 12]
    MRVYGIKTCDTCRKAVGALGAELRDIRAERLTAAEIDRFLAAFGDALVNTRSTTWRGLDEAARAQAPEALLAAHPTLMKR
    PVIETPDGTLHLGWGADVKARLL

    >gi|159043398|ref|YP_001532192.1| arsenate reductase [Dinoroseobacter shibae DFL 12]
    MTDVLVWHNPRCSKSREAVRLLEEAGHEVTLRRYLSEEPTEDELRAVHARLGGPVLDMMRTKEAAFKEAGLSKESDDEDL
    FAAMARHPILIERPIAFANGKAVIGRPPEKVLGIV

    >gi|159043462|ref|YP_001532256.1| UBA/THIF-type NAD/FAD binding protein [Dinoroseobacter shibae DFL 12]
    MTRYARQVQLPQVGAEGQARLAAAHVLVIGAGGLAAPALSYLAGAGVGRITVMDADRVSLSNLHRQTLFTMDDIGAPKAE
    AAAARLRAQNPEVTITALCEAFTPANGAARLAGVDLVLDCADSYAASYTASDLCGPVPLITASVLGASGYVAGCCGGAPS
    LRALFPDPPDSAAS
    CATAGVFGPVVGALGALQAQMALGALLGLKPSSLGQAITLDTATWRMASFRFDAAPEPDRALRFIA
    ASQITETDAVYDLRPESEARHTVGQGAIRLPDTCPTQIRPAKRVVLACSSGLRAWRLGTALGPDFPGEIVLVADPQQETT
    P

    >gi|159043646|ref|YP_001532440.1| protein of unknown function DUF395 YeeE/YedE [Dinoroseobacter shibae DFL 12]
    MDILPLVDGIGEAPTAALFGLITGMVLGFAAQRSSFCLRAACVEFARGQFGRRMAVWLLCFSTALVWVQGATLLGLMRVE
    DARMMAVTGSWSGAILGGLMFGVGMVLARG
    CSGRLLVLAATGNLRSVVSGLIFAVVAIMALQGVLAPLRDWLAALWMTEG
    GRNVNLLNALGLPRGSGLVLGLVLAVLALEIARRNRIGTRVLVMASGVGFAVALGWVLTFALSAVAFDPVQIESVTFTGP
    SANTLMFFLIPNPVLEFDIGLVPGVFLGAFLGAWIGGDLKLQGFEGAGSMTRSITGAALMGFGGMLAGGCAIGAGVTGGS
    IFVGTAWLALTCMWIGAVLTDLLVDQRGIRGVPAE

    >gi|159043648|ref|YP_001532442.1| peptide methionine sulfoxide reductase [Dinoroseobacter shibae DFL 12]
    MFFMSRKKAEMVRAEDALPGRAAAIPTADTHFLSGRPLTLSVPEGMEVAMFGMGCFWGVERMFWKLEGVWLTMVGYAGGF
    TQNPTYQEVCTGQTGHNEVVRVVYDPKVISYETLLQVFWEGHDPTQGMRQGNDVGTQYRSGIYTTTEAQAQAAQDSRAAY
    ADQLRKAGFGAITTEIVPAPSFYFAEDYHQQYLAKNPNGYCGIGGTGVSCPIGTGIAQAG

    >gi|159043706|ref|YP_001532500.1| protein of unknown function UPF0061 [Dinoroseobacter shibae DFL 12]
    MSLHIPFEARYAALPDRFHAQLAPTPVSAPGLIKVNHRLARELGLDPAALESPEGVAMLAGNAVPEGAVPIAQAYAGHQF
    GGWNPQLGDGRAILLGELRHADGALRDVQLKGSGPTPFSRMGDGRAGLGPVLREYILSEAMHALGVPTTRALAAVTTGER
    VLREQVLPGAVFTRVASSHLRVGTFQFFAARDDLDALETLCDFARARHDPEAETALDLLRGVIARQADLIARWMGLGFIH
    GVMNTDNMTISGETIDYGPCAFMEAYHPDTVYSSIDRHGRYAYRNQPEIAVWNLAQLATALLPLIDADQDRAIEVATEAV
    HGFADLYQSAWLDVFRAKLGLATAREEDAKLAHGLLRLMAEAGVDFTLAFRGLAEGQEVARKLYAQPEIFDAWARDWRAR
    LAEEGVDAETLTARLTSANPAFIPRNHRVEQAIQAGMAGDFAPFHTLVAVLERPFDDQPEHAAYMAPARPEEAVRETF
    CG
    T

    >gi|159043727|ref|YP_001532521.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dinoroseobacter shibae DFL 12]
    MIETGQSAPDFTLPRDGGETLTLSAQKPRNVVLYFYPRADTSGCTKQAAGFTAHLDAFAAANTVVIGVSKDPVKKLDKFR
    DKHGLSVALVSDEESTVCEDWGVWVEKQMYGKTYMGIERATFLIDGTGTVRNIWRKVKVPGHVEEVLEAVKAL

    >gi|159043808|ref|YP_001532602.1| heavy metal translocating P-type ATPase [Dinoroseobacter shibae DFL 12]
    MSEPMTVSLSLTGMTCASCVGRVERALAERPGVRDVSVNLATETARMTLAQPDALPDLVEMLTTRGYAPREATISLRVAE
    MS
    CASCVGRVERILQAEPGVLEASVNLGTETATVRVLDGVTSPARLIARCSEGGFPARLAATDEAPARAQRQRDEAEAMA
    RRVAGAAALALPVFILEMGSHMVPAFHHWIMATIGMQTSWLLQFVLTSLVLFGPGRLFFVKGAQSLAHGTPDMNALVALG
    TGAAWSYSVVATFFPALLPEASRAVYFEAAAVIVVLILVGRWLEARAKGRTGAAIEGLLGLQVKTARLIRGDDIAEVPVE
    ALGPGDHVLVRPGERLPVDGTVIAGTSNVDESMITGEPMPVPKAAGAEVTGGTVNGTGSLSVAVTRTGGDTVLAQIIRMV
    EQAQGAKLPIQGLVDRVTLWFVPIVLGIAALTVAVWLALGPGLGFALVAGVSVLIIACPCAMGLATPTSIMVGTGRAAEM
    GVLFRKGDALQALADVDMIALDKTGTVTEGRPVLTDLELATGWARAEVLALMAGVEMASEHPVGAAVVRAARGEGVVPER
    ATDVESHTGRGISGTVSGRRVLVGTARLMAEEGVETGRLAERAAALAEQGHTVFFVAVEGALAAIAAVSDPIKPTSKAAI
    AALKTQGVDVALITGDNEGTARAVARAVGIDHVVAGVLPEGKVAALEAMRAEGRKLAFVGDGINDAPALAHADVGVAIGT
    GTDIAIESADVVLMSGDLRGVVNARDVSRRTMRNIKQNLGWAFGYNAALIPVAAGVLYPAFGILLSPIFAAGAMALSSVS
    VLGNALRLRRVRPQQSMDTQGPQGAVAAEPQPAE

    >gi|159043836|ref|YP_001532630.1| protein of unknown function DUF395 YeeE/YedE [Dinoroseobacter shibae DFL 12]
    MYADLGLDFIDVRLASALFGLALGLAFGVLAQRTRFCLRRAVAGAPEDRRSAAGVWLTALAVALVGTQAIVALGLVGFSE
    HRFFVSEVPVLAILAGGLMFGAGMVLTRG
    CISRLTVLGASGNLRALTVVLIFAVVAHATLKGVLAPLRTSLASATVDFGD
    MTGFASLPGGAWGWTAVLALLAVAVAIRSGNRPGVLLLAALLGALVPLGWVGTGYVLYDDFDPIALESLSFTAPATESLF
    FVIASTSIPAGFGTGLIAGTLLGALLAALASRSFAWASFDSPRQTGRYAAGAALMGVGGVLAGGCTVGAGLAGVPTLSFA
    ATLALVAIAVGGAVTGRLLPEGVTSPSLRGSGAQGTKPQALPAE

    >gi|159044106|ref|YP_001532900.1| putative DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
    MIKLDILSDPICPWCYIGKMALDQALGNAPDHPFTIEWHPFQLNPDMPPEGMDRTAYLQAKFGGPEGAREVYGRIEDTAK
    AAGLPVDFGAIQRTPNTLDAHRLIHWAGVEGRQIAVVSKLFEGYFTQGRDIGDREVLVEIAQAAEMDGEMVRRLLASDAD
    ADDILARDAHARERGVTGVPTFVVANQHVLSGAQPPELWEKVIAELREQIADQNGRNSSSSS

    >gi|159044255|ref|YP_001533049.1| peptide methionine sulfoxide reductase [Dinoroseobacter shibae DFL 12]
    MMFVPRRDAGSGPGQAQETEMEKVVKSEEEWKAQLSDLAYKVTRKHGTERAGTHEDFPKDPGTYRCVCCDAPLFDQAHKF
    ESGTGWPSFFQPLDEEMVGESVDKSWFMTRTEVHCNRCDAHLGHVFPDGPQPTGLRY
    CINGVALNFEPE

    >gi|159044259|ref|YP_001533053.1| putative monothiol glutaredoxin [Dinoroseobacter shibae DFL 12]
    MSDANERIKETVTKNDVVLFMKGTKTMPQCGFSSRVAGVLNFMGVEYTDVNVLADEEIRQGIKDYSDWPTIPQLYVKGEF
    VGGCDIITEMTLSGELDQMFETNAVSYNKEAADKIREANA

    >gi|159044279|ref|YP_001533073.1| iron-sulfur cluster assembly accessory protein [Dinoroseobacter shibae DFL 12]
    MDLTLPPTVTERAFARLAEINAESDAAKALRVAVEGGGCSGFQYEIKLDDPAEDDLVLEGKGQKVVVDAVSLPFLENAVI
    DFTEELIGARFTIENPNASSSCGCGTSFSM

    >gi|159044360|ref|YP_001533154.1| dihydrolipoyl dehydrogenase [Dinoroseobacter shibae DFL 12]
    MAETSFDMVVVGAGPGGYVAAIRAAQLGLKVAIVEREHMGGICLNWGCIPTKAMLRSSEVFHLMHRAKEFGLKADGVGYD
    LDAVVARSRAIAKQLNSGVSHLMKKNKVTVVMGEASLPAKGTVAVKTDKGTETLRAPHVVLATGARARELPGLEADGDLV
    WTYKHALTPKRMPKKLLVIGSGAIGIEFASFYNTLGTETTVVEVMDRILPVEDAEISGFAKKQFEKQGMTIREKAMVKSL
    ERGKGTVTAQIEQGGKTTAETFDTVISAVGIVGNTEKLGLEALGVRVEKTHVVTDAYCRTGVEGLYAIGDLAGAPWLAHK
    ASHEGVMVAELIAGRNDVHPVTPDSIAGCTYCQPQIASVGMTEAQAKEAGHKIKVGRFPFIGNGKAIALGEPEGMIKTVF
    DAGTGELLGAHMVGAEVTELIQGYVVGRQLETTEEDLMNTVFPHPTLSEMMHESVLDAYGRALHF

    >gi|159044389|ref|YP_001533183.1| hypothetical protein Dshi_1840 [Dinoroseobacter shibae DFL 12]
    MPTEKLTFTGHSGDTLAARLDLPEGPHLATALFAHCFTCSKDIPAARRIAQRLAAMGIAVLRFDFTGLGHSGGEFRNTTF
    SSNVADLRLAAEALAARGMAPSLLIGHSLGGAAVLKAVRSIPGVKAVATIGAPFDPGHVTHNFAEALETIAAQGEAEVQL
    GGRPFRIRKAFVEDVTAEKLAPEIAAMKAALLVLHAPLDAQVGIENATQIFAAAKHPKSFVTLDDADHLITRAADADYAA
    EVIAAWVGRYLDLRPPAPPPGVPEGITRVSEADPAGFLQDVSAGPSHHIQADEPLAYGGTNRGLTPYQLLAAGLGA
    CTSM
    TLRMYARQKGWPLTHVSVDVMHDKVHGQDAKGAHDRIDSFVRRIHLEGDLDTAQQERLLEIADKCPVHRTLETGARIVTE
    LAVPA

    >gi|159044401|ref|YP_001533195.1| putative thioredoxin [Dinoroseobacter shibae DFL 12]
    MRRREALLTGGAVLASAGAGYIASTVFLRDDAPPPPEPGARAGRPAPPLTLGPLRDQPFLTYADLTVPGPKLVNWWASWC
    APCRAEHPSLMALAAEGVPIHGITHRDTEADSLGFLAELGSPFAKLGADTTLATYRDWNLTGLPETYVLNGEGRVVLRHA
    GPVLSNIVRDYIRPALAAV

    >gi|159044425|ref|YP_001533219.1| putative glutaredoxin 3 [Dinoroseobacter shibae DFL 12]
    MTRTITLYTKDYCPYCKAAKALLHRKGARFTNHEITGKPALRAEMIQRAGGLRTVPQIFIGGVHVGGYDALTRLDARGEL
    DGLLGLVRTA

    >gi|159044513|ref|YP_001533307.1| dihydrolipoyl dehydrogenase [Dinoroseobacter shibae DFL 12]
    MDIKVPDIGDFTDVPVVSILVAVGDTVAEEDPLIELESDKATMEVPSPAAGVVKEIKVAEGDNVSEGTVIMVFESSGAEE
    APKGADEAPAAAAAPEAVAATGTATGPGDVHGEVVVLGSGPGGYTAAFRAADLGKKVVLIERYPSLGGV
    CLNVGCIPSKA
    LLHVAKVITEAEEMGAHGVSFGKPKVDLDELRAFKDSVIGQLTGGLSGLAKGRKVEVVTGYGKFTGPNMIAVEGEDGVTT
    VSFDQCIIAAGSEPVNLPFLPEDDRIIDSTGALELKDIPKRMLILGGGIIGLEMACVYDALGSDITVVEFMDQLMPGADK
    DIVKPLHKRIEGRYENILLKTKVTGVEALKKGLKVTFEDAKGELTTDTFDKVLVAVGRKPNGALIDAEKAGVAVDERGFI
    AVDSQQRTGVAHIFAIGDLVGQPMLAHKAVHEGKVAAEVCAGHNRHFDARLIPSVAYTDPEVAWCGVTETDAKAKGIAYE
    KGVFPWAASGRSLSNGRSEGITKLLFDPEDDRVIGACIVGTNAGDLISEVALAIEMGADAVDLGHTIHPHPTLSETVNFA
    AEMFEGTITDLMPPKKKKAH

    >gi|159044599|ref|YP_001533393.1| putative glutathione peroxidase [Dinoroseobacter shibae DFL 12]
    MAVVGLVAASSVAARPATSDPLPDGAGAFMAIEGVPLNLSDWAGQPVLVVNTASRCGFTDQYAGLQALQDRYGTDRLTVL
    AVPSDSFNQEFATAEEVAEFCALNYDLTLPMTDITPVRGTGAHPFYDWLAETQNVVPRWNFTKILLDGEGRFVAHFDTAT
    RPLSPRITREIDALITR

    >gi|159044892|ref|YP_001533686.1| putative iron-binding protein iscA [Dinoroseobacter shibae DFL 12]
    MFGIPGKAPVTITDRAAAHIGKLMAQGNKQGLRIGVKKGGCAGMEYTMDYVDEIDPHDEVVETGEARVMIAPMAQMFLFG
    TEIDYETSLLESGFKFRNPNVVDACGCGESIKFDEALAAKT

    >gi|159045062|ref|YP_001533856.1| putative peroxiredoxin [Dinoroseobacter shibae DFL 12]
    MFIITTRSQDMNAHATPTPETSVGLPRLNEPAPAFDALTTDGRKTNADYKGKWLILFSHPADFTPVCTTEFVAFANRAEE
    FAALDTQLLGLSIDSHYAHIAWMRSIKESFGIEIPFPIIADLDMKVAQAYGMIQPGASDTQAVRATFVIDPEGILRAMVY
    YPMTNGRSVDEFLRLVKALQTSDTHKVATPENWTPGQDVIVPTPQTAAAAEARISEGFDTKDWYFSTKSL

    >gi|159045194|ref|YP_001533988.1| thioredoxin reductase [Dinoroseobacter shibae DFL 12]
    MSSETRHLKVLIIGSGPAGYTAAVYASRAMLNPVLVQGIQPGGQLTITTDVENWPGDSSVMGPDLMVRMEEHAKAMGTEI
    IADHINRLDLSSRPFTAYGDSGTIYKAEALILATGAQAKWLGLPSEEHFKGFGVSA
    CATCDGFFYRGKEVVVIGGGNTAV
    EEALFLTNFASKVTLVHRRDSLRAEKILQDRLFKNPKVEVIWDHTVEEVVGTDTPRGVEGVVIKHRDTGETRTLPCAGFF
    VAIGHAPASELVIDQLETHMGGYVVTAPDSTATSIPGVFAAGDLTDHEYRQAVTSAGMGCMAALEAERFLAEMDGETTAD
    AGVYAAPVNAAE

    >gi|159045249|ref|YP_001534043.1| peptide methionine sulfoxide reductase [Dinoroseobacter shibae DFL 12]
    MNRRHFLAATAGLLASAAILPRGLQASAGPFEITLTEAEWRARLTPAQFKVLRKEGTERPFTSPLNDETRAGIYHCAGCD
    LPVYPSTTKYDSGTGWPSFWAPLEEAIGTKADRKLIYLRTEVHCRRCGGHLGHVFDDGPQPTGKRH
    CLNGVALTFKPA

    >gi|159045277|ref|YP_001534071.1| glutathione reductase [Dinoroseobacter shibae DFL 12]
    MSFDYDLFVIGGGSGGVRAARVAAAEGAKVALAEEYRMGGTCVIRGCVPKKLMVFASGYREMPGEARAYGWDVPDGVFDW
    VPFRDKLHSELDRLEQVYRGLLKGSEVEVFDTRATLKDPHTVALADGGTKTAKHILIATGGHPVRPDLPNAELGITSNDI
    FNFETLPKSILIIGGGYIACEFACILNGLGVEVTQFYRGAQVLRGFDDEARGLVAESMREKGIGLHLGTNIVEMRAAADA
    ENATTLTGTDPAMGAPAQEAEALTPKARKGGPIWVKATNGMTGVYDQVLFATGRDPSTEGLGLEAAGVETGRRGEILVDA
    YSQTSVPSIYAIGDVTNRVQLTPVAIREGMAFVETVFKGNPTKPDHDLIPSAIFTQPELGTIGMSEEEAREQEPVDIYCT
    SFRAMREAFAGKTDRVLMKLVVSKATDKVLGCHIVAEHAGEMIQLAGIAVKMGATKADFDRVCAVHPTISEELVTMKSPV
    RSA

    >gi|159045348|ref|YP_001534142.1| putative thioredoxin [Dinoroseobacter shibae DFL 12]
    MGRFLTLCAAALLWTLPGLAAQLGDDGLHKTAWMKDTFKDLREDLAEANAEGKRLALIIEQRGCIYCDKMHKEVFPIPEI
    DALLNDQFFVVQINMFGDVEITDFDGEALAEKDAVRKWGALFTPTLMFFPEEVPEGASAAQAAVATIPGAFGKWTTLNML
    TWILEEGYTTDEPFQKYHARKFMEQNTE

    >gi|159045426|ref|YP_001534220.1| dihydrolipoyl dehydrogenase [Dinoroseobacter shibae DFL 12]
    MASYDVIIIGSGPGGYVGAIRCAQLGLKTACVEGRDTLGGTCLNVGCIPSKALLHASHQVHEAEHNFEKMGIKVPAPKID
    WKTMLAYKDDVIGQNTKGIEFLFKKNKVDWLKGWASIPEAGKVKVGDETHEAKHIIIASGSEPASIPGAEVEIDEKVVVT
    STGALELGKIPKRMVVVGGGVIGLELGSVYARLGTEVSVIEFMDGITPGQDLEVARQFQKILTKQGLKFITGAAVQKVAA
    TKSKAKVTYKMRKDDSEDSLEADIVLVSTGRKPFTEGLGLDALGVKMTERGQIATDGSYRTNVPGVYAIGDVIEGPMLAH
    KAEDEGMAVAEMIAGQHPHVNYGVIPGVIYTHPEVASVGKTEEQLKAEGVAYKVGKFSFMGNGRAKANFAADGFVKLLAD
    KATDRILGAHVIGPMAGDLIHEVCVAMEFGAAAEDLARTCHAHPTYSEAMREAALACGDGAIHA

    >gi|159045509|ref|YP_001534303.1| hypothetical protein Dshi_2969 [Dinoroseobacter shibae DFL 12]
    MDWTAYMDEVRGDLRTLNAAIPETARGFGALTKASKESGELDLKTREFVALGIAVSQRCAPCIGFHVEGLAKAGGTRQEL
    ADVLGVAVQMGGGPSLMYAAQAMAAWDALAEK

    >gi|159045514|ref|YP_001534308.1| molydopterin biosynthesis protein [Dinoroseobacter shibae DFL 12]
    MIFVFFLALTIWLVARRAGLPSQARWLLLGLLYVAVLGIQVLLPEGTPLRVMTGGSPALWLILGGFAVLVVLYRAGLRRV
    RARVQAPPPSETRQTGPFSDVELDRYARHIVMREIGGLGQKRLKEAKVLVVGAGGLGSPVLLYLAGAGVGTIGVIDHDTV
    SLSNLQRQVIHTDARSGMPKVFSAEMAMTALNPHITVRPYNRRLTAEIAEELFAEYDLILDGNDNFETRTLVNKAAVATG
    KPLISGAIAQWEGQISLFDPVRGAPCYACIFPEAPADGLAPS
    CAEAGVAGPLPGVIGTMMALEAMKELTDAGTGLSGRMM
    LYDALNAETRTVKLKRRADCPVCGHI

    >gi|159045564|ref|YP_001534358.1| ADA regulatory protein [Dinoroseobacter shibae DFL 12]
    MSDPETADDRYHYGVIRRAIEEIDAAGGTPLPLDDLAGRIGMSPAHLQRTFSAWVGVSPKRYQQYLTLDHAKALLADRFT
    TLEAAGELGLSGSGRLHDLFVTWEAMSPGEFARKGAGLTIRWGWFDSPFGPALVMGTDKGICGIAFAAETGTDAAMADMV
    ARWPKARYVEDPTRLRPWAVAAFGAGDGDLARAPLYLIGAPFQIKVWEALLRIPSGHVTTYSEIAEAIGSPRAVRAVGTA
    VGRNPVSWLIP
    CHRALRKSGGLGGYHWGLPVKRAMLAQEAALLEQAG

    >gi|159045603|ref|YP_001534397.1| Thiol:disulfide interchange protein TlpA [Dinoroseobacter shibae DFL 12]
    MRWIASAVLYMAVALGANAETAGAPALDIAALEALREGQMEKLRFHEAPRARSDLAFMRADGSESSLAAYDGKVVVLNFW
    ATW
    CAPCRKEMPGLDRLNQALGGDDFAVVTLATGRNSPTGIAKFFEDTALQTLPQYRDIKQGIAREMEVPGLPTTVILDR
    DGREIARMTGEAEWDTPSAKAIVTALIGADS

    >gi|159045825|ref|YP_001534619.1| putative thioredoxin [Dinoroseobacter shibae DFL 12]
    MNRREILALGAAFVTAPMAAQAMEGAKAYTPGMVDAALARGETVFLDFKASWCSTCAAQGRVLSALKAEMPDYTSSITFI
    DVDWDEFKDAEITRRLEIPRRSTLVVLKGDEELGRIVAGTGKEQIKALMDTALAAATS

    >gi|159045888|ref|YP_001534682.1| rhodanese domain protein [Dinoroseobacter shibae DFL 12]
    MAWQGRDGPGIAAPMFTVAALYKFTRFDDPDALRPGLRAVCEAGGVRGSLLLAREGINGTIAGPRAGIDAAIAAIRALPG
    CAELEWKESTAKTMPFGKLKVRLKREIVTMGQPHVDPMAAVGRYVPPQDWNALISAEDVVVIDTRNDYEVEIGTFRGAID
    PQTTSFRDFPAWWEANRHRFGNKRVAMFCTGGIRCEKSTNYLLSEGVLEVYHLQGGILKYLEEVPEHESLWEGECFVFDK
    RVSVGHGLKPGPLGLCHACRRPLAEADKTRPEYETGVSCHRCLSEYSEADRTRFRERQKQIKLARARGEEHLS

    >gi|159045890|ref|YP_001534684.1| selenide, water dikinase [Dinoroseobacter shibae DFL 12]
    MHTPYPLTQDVVLVGGGHTHALVLRKWAMSPLLGARLTLIDPNPTAPYSGMLPGHIAGHYDRAALEIDLVRLARFAGARL
    VLGRAEGLDLAAREIHVSGRPPIRYHRASLDIGVTSRLPDLPGFTDHALAAKPLGAFADRWEAFCTNPPPEPHVLILGGG
    VAGVELAMACAHRLGATAKVTLIEASDTALAGMNAKTRDTLLGEMAAQGITLRLNARAAEIGADHVRLEGGEALRADITI
    GATGARPQDWLAQTGLARVDGFVAVDDQLRSLSDDRIYAVGDCAHMGFAPRPKAGVYAVRQAPILYHNLRADLTGRARKR
    YKPQSDYLKLVSTGRKAAVADKAGMRSSGALLWRLKDRIDRKFMAKFHDLPAMSAPDLPRLRAEGVQAALSGKPLCGG
    CG
    AKVGAGLLSDVLAGLPSPARDDVLSRPGDDAAILRHGAGQQVITTDHLRAFVEDPYLMTRIALQHALGDVWAMGADPQAV
    LSQIILPKATPAVHAGMLAEITAAASEGARAVGAELVGGHTSIGAELSIGFTVTGLAPARAIGLDGARPGDRLVLTRPIG
    TGVLLAAEMQAAAPGQQVAALWELLAADQSKTARHLAAKAHAMTDVTGFGLAGHLARLCAASGTGAEIRLDAIPIHAGAE
    ALAAAGHRSSLYPANRALVPDWPETTPRHELLFDPQTAGGLLAALPPGDPVPGTVEIGRVTADPGLRLV

    >gi|159045945|ref|YP_001534739.1| thiol:disulfide interchange protein DsbA [Dinoroseobacter shibae DFL 12]
    MKGPATWSELETEMKHWVYVAAIGASLASPVAAQELSEERIKELALEAILENPQIVMDAVAILREREAEAQVASAAETLA
    NQRDLLERDENAPVLGNPDGDVTVIEFFDYN
    CPYCRRAKPTIEGLIAADPNVRVVFREFPILGDDSVLAARAALAARAQG
    MYEEFHWALMALSGRINEAQIMQTADDLGLDVAQLEADMQSDAVTMHIETSLSLAQSLGISGTPSFVVGETILPGLVDQA
    RLEELVAQERSDG

    >gi|159045947|ref|YP_001534741.1| thiol:disulfide interchange protein DsbD [Dinoroseobacter shibae DFL 12]
    MTTLARCALHALALTCLWLAYALPGQAAESEPHVSAISTARLVTAEDAVAPNAQSISAALAITLEDSWKTYWRSPGEVGL
    PPEISWEGSENIASVELLYPAPTRFRAFGIENFGYADEVNFPLKVTLEDPGAPAKLSANVSILVCAEICVPEEFALDLDL
    GTGTGVDAASANLIASAAALVPEPADLYGVTLEAAALADDGAALVVAFSRRGGWQSPDIFPEMGEYTAFGAPDVRIDPEG
    DTMWARLPVLSDPVSSDMPLRLTLTDDGMAVDLPEVPLVSQVPAPPFEPQAEMTAVSELLWIALIAVIGGLILNVMPCVL
    PVLSIKFASALKAADQSAARVRGGFLMSAAGVLAFMWLLAAGTLGARAMGLSVGWGLQFQNPYFLTAMLLILTVFAANLA
    GLFEISLPQSWMTRMSSDKGSGYTGDFATGAFAAVLATPCSAPFLGTAIAFAMAGRPIDIVVIFTALGIGLALPYLLVAA
    APGLVRYLPKPGRWMLLVKAVLAGLLILTAAWLLWVLGGVAGSAALLWVAALLAVLVLLLSPVARGVGRTRVGLVLATVI
    AAFFLPMSTSTPDTAMNAKLDAEWIAFERSDIPKRVAAGEIVFVDVTADW
    CLTCKANKALVLDREPVAGLLASEAVTAMR
    ADWTRPDESISAYLESFGRFGIPFNVVYGPAAPEGLPLPELLTADIVQDALLRAGMNQIAQAD

    >gi|159045950|ref|YP_001534744.1| thiol:disulfide interchange protein DsbE [Dinoroseobacter shibae DFL 12]
    MKRALFALPVVLVLILGGFFLWGLNPDRDPNAIPSVLIDAQAPEFALDGIPGLDTPGLAKADLSGADNPLVVNVFASWCV
    PCRAEHAVLTRMAREENIHLLGINYKDKPEDAVRWLDELGNPYERIGADLTGRVGIEWGISGVPETFVIDANGIVVYRFV
    GPILSAEDVRDMQEAIALARSRSGAGGTS

    >gi|159045979|ref|YP_001534773.1| thioredoxin [Dinoroseobacter shibae DFL 12]
    MATVAVTDETFDTEVTKSDIPVVVDFWAEWCGPCKQIGPALEELSVTFDGKVKIAKVNVDENPNAPAQMGVRGIPALFLF
    KNGEVVSNKVGAAPKAALQSWIEESL

    >gi|159046008|ref|YP_001534802.1| peptide methionine sulfoxide reductase [Dinoroseobacter shibae DFL 12]
    MTRSPSFFPGLARMKPVLLAVTILLGIAVECQQAKAAGTEKVVVAGGCFWCVESDFEGVPGVIEAVSGFAGGTTPNPEYK
    EVTKGGTGHLEVVEIEFDPRKISTREIYDLFLRSIDPLDAGGQFCDRGESYTTAIFATDAQRADALAAVAQAEADLGRSI
    VTPVRKSAPFYEADAYHQDFYKSTTRVLTRFGPKTKAEAYKRYRTSCGRDARVKAVWGAAAPFAGS

    >gi|159046047|ref|YP_001534841.1| glutaredoxin-3 [Dinoroseobacter shibae DFL 12]
    MQPVEIYTSPLCGYCHAAKKLLSQKGVSFAETDVWRAPQKKPEMIERAGGRTSVPQIFIGATHVGGCDELYALERAGKLD
    ALLAG

    >gi|159046162|ref|YP_001541834.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
    MKRRGLILSVLALGVAGFGGAAWYATRPDPIAASDPIDPEMADALIRPYSPILGPEDAPVTIVEFFDPACEACRAFYPVV
    EDIMAEHGDAVRVVIRYTPFHGEASVEAIRVLEAARMQDVFEPVLEAVLREQPRWASHGTPAPGLILEIAASGGLDVEAA
    RTQMLAPGVVAVLNQDRADVETVGVRQTPTFFVNGKPLDPFGEAELQRLVAVEVAASQS

    >gi|159046315|ref|YP_001541987.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Dinoroseobacter shibae DFL 12]
    MKRLIAGLPFIAAVIFGGFFLWGLNPDRDPNEIPSVLISQPAPAFDLDPVPGLETPGLARSDLVGNERPVVVNVFASWCV
    PCRAEHAVLTRFVERDGMRLFGINYKDKPEDAVKWLNDLGNPYERIGSDLSGRTGIEWGLSGVPETFIVDSDGTVLFRYV
    GPVVGPDAVERFTQALKQAGALPNGAGS

    >gi|159046318|ref|YP_001541990.1| thiol:disulfide interchange protein DsbD 1 precursor [Dinoroseobacter shibae DFL 12]
    MIDCLLILRRVLLIPFVLLAVVSGSVAAATSAEYQSAPLTAHLISVQDGVPENTQTLSAGLHLQLNENWKTYWRSAGEVG
    IPPSVEWSGSENVADVEFMWPAPTRFTAFGIENFGYAGEVVFPLRITLKDPGAPVTLSAQVKLLVCSNVCVPEEFDLSLR
    LGRGNVIDSTSAGLIGTFSERVPEGAKTSGVSEANAFIDEDLTELIVSLRVDEPLQSPDVFPELGMGVALGKPDIRLGEE
    DRLLWARLPILSSNTDVTVAPSITVTDGENRAFTIIADRVAQGIAPPFELAATTPDMMELIWIAAIALLGGLILNVMPCV
    LPVLSIKVSSVLKHTDHDTTRVRFGFVAASAGIMTFMWGLALVLWALQTAGLSVGWGLQFQSPLFLAAMIAVLLVFSANL
    FGAFEFALPHGMQTRLAGAGGRNGYSADFFTGMFGAVMATPCSAPFLGTAVAFALAGRGVDILIVFTSLGLGLALPYLVI
    AAFPRLVAFMPKPGRWMLIIKSVMGVLLLATAVWLFWVLDGVAGLASVIAVAALSGLAVLILSLPNVQSQFRWSIAIASL
    VLAIAAGPLLQQSAPARSTPQLAMAWIAFDRSEIAKRVSAGEVVFVDVTADW
    CLTCKANKTLIIDREPVRSALEAPGVTA
    MQADWTRPDTRISRYLESFGRYGIPFNAVYGPSAPNGIVLSELLKTEDVMNALAQASGRDVSAKVAGQE

    >gi|159046326|ref|YP_001541998.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
    MRFRQAFTTVAIAALLPIPALADELSESRVKELVLEAIRENPEIVMEAVAILEQRQAQAQELSQAQVLNDQRDLIENDPN
    APVLGNLEGDVTVVEFFDYN
    CPYCRRVKPEVRALIEDDPNIRLVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAMMG
    LEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQLTQALGFNGTPSFVIGDALVPGFVEKAQLADLVEEARK
    VED

    >gi|159046328|ref|YP_001542000.1| heavy metal translocating P-type ATPase [Dinoroseobacter shibae DFL 12]
    MPEPKQISLPIEGMSCASCVGRVDRALNAIDGVEDVSVNLASETARMSVDALKRIPDIIESLRELGYPARKARAELTIAA
    MS
    CASCVGRVDKALAAVPGVVEVNVNLASETATVVYVEGLVTTSDLIESSGAAGYPATVATAQAGDDRVARKEEEAQALA
    KRVTFAAILALPVFLIEMGGHVIPAVHMLIETTIGQQTSWLLQFVLTTIVLFGPGRTFYTKGFPALFRGAPDMNSLVAVG
    TGAAYLYSVVATFVPSVLPDTLRTVYFEAAAVIVVLILLGRFLEARAKGRTGAAIQKLLGLQARTARVMRDGESVEIEID
    ALVQGDIVIVRPGERIAVDGEVIEGTSRVDESMLTGEPIPAEKGAGDTVTGGTVNGAGSLQFLATRVGADTTLAQIIRIV
    EEAQGAKLPIQGLVDRITLWFVPAVMAIAAATVLVWLFFGPDPALTMALVAGVSVLIIACPCAMGLATPTSIMVGTGRAA
    EMGVLFRKGDALQQLDSVDVVALDKTGTVTEGRPALTDLVLAEGFDRPTTLSKIAAVESLSEHPVADAIVRAARAEGAPL
    VAAEGFQSVTGYGVRAVVEDVEVLVGADRYMAREGIDVSALAPEETKIASKGRTALYAAIDGRVAAVIGVADPVKPASRA
    AIAALHEKGLAVAMITGDKRETAEAIARETGIDHVIAGVLPDGKVAALDSLRQGNKRIAFVGDGINDAPALAHADVGIAI
    GTGTDVAIESADVVLMSGDLRGVVNAFEVSRRTMRNIRQNLFWAFAYNVALIPVAAGVLYPAFGLLLSPILAAGAMALSS
    VFVLTNALRLRRIAPAMDEQRAIPAELAAATPAPAE

    >gi|159046330|ref|YP_001542002.1| glutaredoxin [Dinoroseobacter shibae DFL 12]
    MPRDTDSKSAQLYRMVMPGHVCPYGLKSKDLLERQGFEVEDHPLDTREDTDAFMEKHGVETTPQTFIGDERIGGYDDLRV
    FFDIDPPEEEQSDTTYQPVIAIFSVAALLALGLSWHQYGSVLTLRGFEWFISLSMTILAIQKLQDVEGFSTMFLNYDLLA
    RKWVRYGKVYPFGEALAGVLMTAGALLWLSAPVALFIGTVGAVSVFKAVYIDKRELKCACVGGDSSVPLGFISLTENLMM
    IFMGIWMPVRAIWF

    >gi|159046470|ref|YP_001542140.1| glutaredoxin [Dinoroseobacter shibae DFL 12]
    MPRDTDSKSAQLYRMVMPGHVCPYGLKSKDLLERQGFEVEDHPLDTREDTDAFMEKHGVETTPQTFIGDERIGGYDDLRV
    FFDIDPPEEEQSDTTYQPVIAIFSVAALLALGLSWHQYGSVLTLRGFEWFISLSMTILAIQKLQDVEGFSTMFLNYDLLA
    RKWVRYGKVYPFGEALAGVLMTAGALLWLSAPVALFIGTVGAVSVFKAVYIDKRELKCACVGGDSSVPLGFISLTENLMM
    IFMGIWMPVRAIWF

    >gi|159046497|ref|YP_001542167.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
    MKRRGLILSVLALGVAGFGGAAWYATRPDPIAASDPIDPEMADALIRPYSPILGPEDAPVTIVEFFDPACEACRAFYPVV
    EDIMAEHGDAVRVVIRYTPFHGEASVEAIRVLEAARMQDVFEPVLEAVLREQPRWASHGTPAPGLILEIAASGGLDVEAA
    RTQMLAPGVVAVLNQDRADVETVGVRQTPTFFVNGKPLDPFGEAELQRLVAVEVAASQS

    >gi|159046590|ref|YP_001542260.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Dinoroseobacter shibae DFL 12]
    MKRLIAGLPFIAAVIFGGFFLWGLNPDRDPNEIPSVLISQPAPAFDLDPVPGLETPGLARSDLVGNERPVVVNVFASWCV
    PCRAEHAVLTRFVERDGMRLFGINYKDKPEDAVKWLNDLGNPYERIGSDLSGRTGIEWGLSGVPETFIVDSDGTVLFRYV
    GPVVGPDAVERFTQALKQAGALPNGAGS

    >gi|159046593|ref|YP_001542263.1| thiol:disulfide interchange protein DsbD 1 precursor [Dinoroseobacter shibae DFL 12]
    MIDCLLILRRVLLIPFVLLAVVSGSVAAATSAEYQSAPLTAHLISVQDGVPENTQTLSAGLHLQLNENWKTYWRSAGEVG
    IPPSVEWSGSENVADVEFMWPAPTRFTAFGIENFGYAGEVVFPLRITLKDPGAPVTLSAQVKLLVCSNVCVPEEFDLSLR
    LGRGNVIDSTSAGLIGTFSERVPEGAKTSGVSEANAFIDEDLTELIVSLRVDEPLQSPDVFPELGMGVALGKPDIRLGEE
    DRLLWARLPILSSNTDVTVAPSITVTDGENRAFTIIADRVAQGIAPPFELAATTPDMMELIWIAAIALLGGLILNVMPCV
    LPVLSIKVSSVLKHTDHDTTRVRFGFVAASAGIMTFMWGLALVLWALQTAGLSVGWGLQFQSPLFLAAMIAVLLVFSANL
    FGAFEFALPHGMQTRLAGAGGRNGYSADFFTGMFGAVMATPCSAPFLGTAVAFALAGRGVDILIVFTSLGLGLALPYLVI
    AAFPRLVAFMPKPGRWMLIIKSVMGVLLLATAVWLFWVLDGVAGLASVIAVAALSGLAVLILSLPNVQSQFRWSIAIASL
    VLAIAAGPLLQQSAPARSTPQLAMAWIAFDRSEIAKRVSAGEVVFVDVTADW
    CLTCKANKTLIIDREPVRSALEAPGVTA
    MQADWTRPDTRISRYLESFGRYGIPFNAVYGPSAPNGIVLSELLKTEDVMNALAQASGRDVSAKVAGQE

    >gi|159046601|ref|YP_001542271.1| DSBA oxidoreductase [Dinoroseobacter shibae DFL 12]
    MRFRQAFTTVAIAALLPIPALADELSESRVKELVLEAIRENPEIVMEAVAILEQRQAQAQELSQAQVLNDQRDLIENDPN
    APVLGNLEGDVTVVEFFDYN
    CPYCRRVKPEVRALIEDDPNIRLVYREWPILGDGSVFAAKAALAARKQDKYEEFHWAMMG
    LEGRAEEASVLRVAEEIGLDIAQLRKDMEAPEVEEHIATSMQLTQALGFNGTPSFVIGDALVPGFVEKAQLADLVEEARK
    VED

    >gi|159046603|ref|YP_001542273.1| heavy metal translocating P-type ATPase [Dinoroseobacter shibae DFL 12]
    MPEPKQISLPIEGMSCASCVGRVDRALNAIDGVEDVSVNLASETARMSVDALKRIPDIIESLRELGYPARKARAELTIAA
    MS
    CASCVGRVDKALAAVPGVVEVNVNLASETATVVYVEGLVTTSDLIESSGAAGYPATVATAQAGDDRVARKEEEAQALA
    KRVTFAAILALPVFLIEMGGHVIPAVHMLIETTIGQQTSWLLQFVLTTIVLFGPGRTFYTKGFPALFRGAPDMNSLVAVG
    TGAAYLYSVVATFVPSVLPDTLRTVYFEAAAVIVVLILLGRFLEARAKGRTGAAIQKLLGLQARTARVMRDGESVEIEID
    ALVQGDIVIVRPGERIAVDGEVIEGTSRVDESMLTGEPIPAEKGAGDTVTGGTVNGAGSLQFLATRVGADTTLAQIIRIV
    EEAQGAKLPIQGLVDRITLWFVPAVMAIAAATVLVWLFFGPDPALTMALVAGVSVLIIACPCAMGLATPTSIMVGTGRAA
    EMGVLFRKGDALQQLDSVDVVALDKTGTVTEGRPALTDLVLAEGFDRPTTLSKIAAVESLSEHPVADAIVRAARAEGAPL
    VAAEGFQSVTGYGVRAVVEDVEVLVGADRYMAREGIDVSALAPEETKIASKGRTALYAAIDGRVAAVIGVADPVKPASRA
    AIAALHEKGLAVAMITGDKRETAEAIARETGIDHVIAGVLPDGKVAALDSLRQGNKRIAFVGDGINDAPALAHADVGIAI
    GTGTDVAIESADVVLMSGDLRGVVNAFEVSRRTMRNIRQNLFWAFAYNVALIPVAAGVLYPAFGLLLSPILAAGAMALSS
    VFVLTNALRLRRIAPAMDEQRAIPAELAAATPAPAE