Aliivibrio salmonicida LFI1238 uid59251

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|209693674|ref|YP_002261602.1| thiol/disulfide interchange protein DsbA precursor [Aliivibrio salmonicida LFI1238]
    MDWRKLNMMKTMMALFGALVLSFSVNAANFTEGDYYKVLNLPESKTPTVNEFFSFYCPHCNSFEPLIQGLKKTLPENATF
    KKTHVSFMGGKMGLSMSKAYATMVSLGIEDKMVPVMFNRIHSMQKPPRNDKELRQIFLDEGVNADEFDGTYNSFAINSMV
    NRFDKSFQDSGLTGVPALMVNNKYLVETSKIKSTEEYYELVNWLLKK

    >gi|209693743|ref|YP_002261671.1| glutathione reductase [Aliivibrio salmonicida LFI1238]
    MATHFDYICIGGGSGGIASANRAAMHGAKVALIEAQELGGTCVNVGCVPKKVMWHGAQVAEAINLYAEDYGFDVELKKFN
    WSKMVENRQAYIGRIHESYDRVLGNNKINVIKGFAKFVDANTVEVNGEHYTADHILIAVGGRPTIPNIPGAEHGIDSNGF
    FDITEQPKRVAIIGAGYIAVEIAGVLHSLGTETHLFVRKESPLRSFDPMIIDTLVEVMNTEGPTLHTHSVPKEVVKEADG
    SLTLHLENGETQNVDTLIWAIGRHPATDAINLEKTGVAINDRGYIKVDEYQSTNVKGIYCVGDIMEGGIELTPIAVKAGR
    LLSERLFNGQTNAKMDYTLVPTVVFSHPPIGTIGLTEQEADEQYGKDNVKVYTSGFTAMYTAVTKHRQPCKMKLVCAGEN
    EKVVGLHGIGFTVDEMIQGFAVAMKMGATKADFDAVVAIHPTGSEEFVTMR

    >gi|209693768|ref|YP_002261696.1| thioredoxin 1 [Aliivibrio salmonicida LFI1238]
    MSDKILQLTDDGFEESVINASGPVLVDFWAEWCGPCKMIAPILDEIADEYEGKLTIGKLNIDQNAGTPPKFGIRGIPTLL
    LFKDGGVAATKVGALSKTQLKEFLDANL

    >gi|209694033|ref|YP_002261961.1| peptide methionine sulfoxide reductase MSRA [Aliivibrio salmonicida LFI1238]
    MVIYSFYRVAQGKCLLNYSVKGCDMTMEKHTVQPLHFISQHDIESIPTGCEQILFGMGCFWGTERLFWKLTGVYSTAVGY
    SGGKTKIPTYKDVCSGSTDHVEVVKVVFNPALISLEELLHSFWQTHNPTQGMRQGNDIGTQYRSVIYTYDKNQQEIATHT
    KKQYQHALSQQGIEEPITTEITPANDFYFAEEYHQQYLAKNPNGYCGLSGTGVCFL

    >gi|209694156|ref|YP_002262084.1| thiol/disulfide interchange protein DsbC precursor [Aliivibrio salmonicida LFI1238]
    MSFIRRTSAMIIALLSVASFTACSDEQVKETATPASPVVASNSDSTIAITQRLTTLGLPVEAIHDSDIDGFKQVETPFGI
    FYVSDDGKHFIQGRIFEFDENGNMKDLLAARFAKLVDSQSENMIVFPAKNEKYVITVFTDIT
    CGYCTKLHKEMKDYNDAG
    ITVRYLAYPRQGYQGSVADKMAQVWCADDKQQAMEDAKSNRPINGSKPATAQCKNIIKEQYLLGRKMGVNGTPAIVLPNG
    DLVPGYKPAKELLADLEK

    >gi|209694308|ref|YP_002262236.1| iron-binding protein IscA (iron-sulfur cluster assembly protein) [Aliivibrio salmonicida LFI1238]
    MAISVTEAAASRVQTFLENRGKGIGLRLGVRTSGCSGMAYILEFVDDLNEEDEVFEKFGVKIIIDPKSLAYMDGTELDFA
    KEGLNEGFKFNNPNVKSECGCGESFNV

    >gi|209694384|ref|YP_002262312.1| copper-transporting P-type ATPase [Aliivibrio salmonicida LFI1238]
    MSQKLTLPLAGLNCGRCIAKVEKALSEIPKISHFSVTKTELTLTTTLSYEEIAENITQLGYSIPEPELITLYLAGLKCGK
    CINKTTDTLSTLSHTSIESISKDKITLNTVHSQESIIELIESIGFQASSAPFIPDSPLPKEEVITLNKETPTDQSKTEKQ
    KIEKTTQLILSGMT
    CASCVASVEKIISAVANVQSVSVNLAERTALIYGDINAPELIKAIEKGGYGAEISLSEEQRRKSQK
    EQYLKTTVAHKRNTIMSLAIGAPLMLWGVFGGNMQITTVNDQLAWGLIGLICLGLLLTAGKHFFVNAWKAFTHHRATMDT
    LVSLGTGSAWLYSMALVIYPAFFPEQARHVYFEATAMILGLITLGNLIETKARNRTSNAIEKLLNLQPQTATVIQDGKEV
    ELPVALVTKGMIIKIKPGEKIPVDGSIISGESYLDEAMLTGEPLPCLKIKDDVVHAGTINQQGSFTFTATNVGEHTMLAR
    IIAMVRNAQSSKPKLAKLADKISSVFVPSVMIIAIFSALLWYNFGPEPTSSYMLVVATTVLIIACPCALGLATPMSVTVG
    VGKAAEFGALIKDADVLQTASHIDTVVVDKTGTLTEGKPTVSKVTSFAAYNEKDIISFAAAIESHSEHPLAHAVMTYLNQ
    HSWDLVTSTQFNAQLGLGASANIAGETVFIGNTSYLLNNEIATPDVELSPASTPLFVAINKECIGVIEVSDAIRPDSKLA
    VAQFTQLGINVVMLTGDRKETANYVAQQLGITHVVSGVLPDGKAQTIKDLQAQGKKVAMIGDGINDAPALAQAEVGIAMG
    NGSDVAIESAQLTLIRHSLLTAVNAIELSRATITNMKQNLFGAFIYNAIGIPIAAGILFSFTGMLLSPVVAGAAMALSSI
    TVVSNANRLRLFKSQFSNKHTD

    >gi|209694519|ref|YP_002262447.1| Na(+)-translocating NADH-quinone reductase subunit D [Aliivibrio salmonicida LFI1238]
    MNTKDLKKNILAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTIAVMFVTAFSNFFVSLIRNHIPSSVRIIVQMAIIAS
    LVIVVDQILRAYLYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKSKPLPSFIDGIGNGLGYGFVLITVAFFRELLGSGKLF
    GVEVLPLVSNGGWYQPNGLMLLAPSAFFLIGFMIWAIRIFKPEQVEAKE

    >gi|209694520|ref|YP_002262448.1| Na(+)-translocating NADH-quinone reductase subunit E [Aliivibrio salmonicida LFI1238]
    MEHYISLLVKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTLAVPLNNLVYTYLLKDGALVEGVDLSFLNF
    ITFIGVIAALVQILEMVLDRFFPPLYNALGIFLPLITVN
    CAIFGGVSFMVQRDYNFTESIVYGFGSGVGWMLAIVALAGI
    REKMKYSDVPPGLRGLGITFITVGLMALGFMSFSGVQL

    >gi|209694943|ref|YP_002262872.1| sulfurtransferase (rhodanese-like protein) [Aliivibrio salmonicida LFI1238]
    MNNPLVTTDWLAAHINDENIVIVDAYMANVVGKVPLAYDVFSCLPNAIKLDVEADFCDPTSSQTHALPTESQFTQAVQAL
    GINTDSTVIIYDNQGIYSSPRAWWTFKVMGFDNVYVLDGGLPQWIEEGREIAFEYSINQTIGNAVAKLHDQLACDSASVL
    NVINTNAAIVDARAEMRFLGKAPEPREGVRSGHIPSSANLPFSILLDGFAYQNKEALRTIFQERIPTLETQSFFS
    CGSGI
    TACILMLAAVSVGYNDVVLYDGSWADWGSNHALPIE

    >gi|209694949|ref|YP_002262878.1| hypothetical protein VSAL_I1428 [Aliivibrio salmonicida LFI1238]
    MTSPILYSLRQCPYAMRARLGIIHAHQIVLLRDVDMNNKPEEMLSISPKGTVPVLLLENGSVIDESIDVMIWALNQSDPN
    NLLYSHDKALLPVMLELINRSDTEFVNALQKYRAASRYHDDNETACRDMCCGWLMEIEQRLSQHAYIMGEKPSLVDYSIL
    PFIRQFSRVDKKWYAQAPLPYLRAWLVNHYNDPLFSKVMMTYPKWKNNDDSILFGDVHSRKKQR

    >gi|209695034|ref|YP_002262963.1| putative glutaredoxin [Aliivibrio salmonicida LFI1238]
    MKPIKITLYRWAGSWGPFKVNVPCGECTLTKDILQDTFDTELAGIPIELEVKDWLSHWWEPLKLKAWHAPIIIVEDKVIS
    QGEALNRGVLVQAVIAKVAQRDEIKGNVVFGKAT
    CPFCIKAKAALDEAGIEYTYHDVVKDSAALYRMIPEVKAIIGEKTP
    VTVPQIWLDGKYIGGFDNLEKSMTMTD

    >gi|209695071|ref|YP_002263000.1| putative cation-transporting ATPase [Aliivibrio salmonicida LFI1238]
    MSKDCYHCNEPVPIGSSFQVDILGQKRDMCCLGCESVAQTIIDNGLSSYYQYRTAPADKANLVPDQLKALEHYDHKEIQK
    EFVRTTENNKEVTLSLDGVS
    CAACAWLIEKQLAKAKGIHQITVNTSTHRALLSWDPKETELSTLLTLIHQLGYKAAPFEA
    DKQEEEYHRSMKQYLYRLGIAGLATMQVMMLAVALYLEVFGDLDPEFRNYLRYVSLVFATPVMLYSALPFYMNAWRSLKA
    RTLGMDVPVSIAMLFAYFASVVATVTEKGEVFFESVAMFTFFLLLGRFLEMRARRKAAAITGNLLKLVPVMATLQSGKRV
    PARTLDIDDIVIVPPGEHLPADGVVISGCSAIDESMFTGESMPVAKNESDPVFSGTINGDGNLTVRVTKTKADSLISTIV
    KLQDEAQMSKPKVAEIADLIARYFVAGILIISAFTWFYWHETKPDDAFWIMLSVLVATCPCALSLATPTAITCSTSRLAQ
    LGLMLRRGHVLETLCKVNRLVIDKTGTLTEGNVQLTHIHCFTDVTEKESKTLAAELESFANHPIARAFSEFRDPNKSHFD
    RVENIIGSGLIGYSGSDEWKIGHHQFTCPKATLENKQNYQVWLSKNNCPIAAFSLNDPIRKESYEFIQSLHALNIKITML
    TGDNSSAVAKVAKELNIDTVISGVSPKGKLDYLTSLPKNEVSLMVGDGINDAPTLAGAHLSIAMGSGTDVAKASADMILI
    GDNLTRLIEARTLAIKTRKIIRENLAWALGYNAIILPLAVMGLVAPYIAVVGMSASSIIVVSNSLRLLKNG

    >gi|209695129|ref|YP_002263058.1| putative radical SAM superfamily protein [Aliivibrio salmonicida LFI1238]
    MNFILPNDLQKFNFPQIERKGLDTLQVNLGYKCNMTCRHCHVDAGPNRKEMMSRKNIDLILPVIKYHNIKTLDLTGGAPE
    LHEDFRYLVKEAFKADIHVIDRCNLTILYEENQEDLAEFLAQHNVEIIASLPCYSINNVDKQRGKGTFDKSIEALKKLNS
    LGYGHHNSPLKLNLVFNPQGTNLPPSQLQLEQDYKKELFELFSISFNELYTITNVPIKRFGYQLKSKGQFTSYLNLLINN
    FNKANLENLMCRTTVSVDWQGYLYDCDCDFNQQLNMNLGKNTQAHLTSLINSPMENSPICVADHCFACTAGQGSS
    CGGAL


    >gi|209695189|ref|YP_002263118.1| glutaredoxin-3 (grx3) [Aliivibrio salmonicida LFI1238]
    MLTTYQNIMFSKTVCPFCVKAKAILDDKGIEYKVLTVDVDLSKEEMVGLIQDKEGILVNTVPQIFLDGKFVGGHDDLVAL
    FERQDTDMDLDDFEL

    >gi|209695305|ref|YP_002263234.1| thioredoxin reductase [Aliivibrio salmonicida LFI1238]
    MSNVKHSKLLILGSGPAGYTAAVYAARANLNPVMITGMQQGGQLTTTTEVENWPGGATDMTGPGLMEEMKAHAERFNTEI
    IFDHINETDFSQRPFRLKGDSSEYTCDALIISTGASAKYLGLESEEAFKGRGVSA
    CATCDGFFYRNQKVAVIGGGNTAVE
    EALYLSNIAAEVHLIHRRDTFRSEKILIDRLMDKVENGNIILHTDRTLDEVLGDEMGVTGVRLKDTKSDMTEDLDVMGAF
    IAIGHQPNTAIFNGQLDMENGYIKVKSGLEGNATQTNIEGIFAAGDVMDHNYRQAITSAGTGCMAALDAERFLDALDVKE
    S

    >gi|209695312|ref|YP_002263241.1| thioredoxin 2 [Aliivibrio salmonicida LFI1238]
    MSQFQSRCPSCQGINRLPIERINDKPTCGRCKELLLDGKPLEGTSENLSALLDSEQPIVIDFWAPWCNPCVGFSPVFEDV
    AAERNGQVRCVKVNTEAQQQIAAQYQIRSIPTIMVFKNGERVDMINGALPKGQFDQWLNQALLK

    >gi|209695317|ref|YP_002263246.1| methionine sulfoxide reductase B [Aliivibrio salmonicida LFI1238]
    MNQSKSFSDFTNEDWKSELTDEEFVVCRQKGTEAPFSGKLLQNKATGNYACTCCHVDLFSSENKYDSGCGWPSFDEPLNT
    QVIRYIKDNSHGMARVEIRCARCDSHLGHVFNDGPKTTGERF
    CVNSISLRFKGK

    >gi|209695326|ref|YP_002263255.1| putative glutaredoxin [Aliivibrio salmonicida LFI1238]
    METIDKIKQQIAENHIILYMKGSPKLPSCGFSSQASQALMNCGEKFAYVDILLNPDIRAELPAYAQWPTFPQLWVEGELV
    GGCDIILEMFQKGELKPLVQEAAQRNAPEAE

    >gi|209695334|ref|YP_002263263.1| electron transport complex RsxE subunit [Aliivibrio salmonicida LFI1238]
    MATHKELIKNGLWDNNPALVQLLGLCPLLAVSATVTNALGLGIATTLVLIGSNLIVSLVRQWIPQEVRIPVFVMIIASLV
    TCVQLLMNAYAYGLYLSLGIFIPLIVTN
    CIIIGRAEAFASKNDPLPAALDGLWMGLGMTSVLVLLGAIREILGNGTLFDG
    ADLLLGDWATTLRIELFHVDSHFLLAMLPPGAFLGVGFLIAIKNIIDKKLADRQPKQEKTEIERARVS

    >gi|209695339|ref|YP_002263268.1| Na(+)-translocating NADH-quinone reductase subunit E [Aliivibrio salmonicida LFI1238]
    MTEYLLLLIGTVLVNNFVLVKFLGLCPFMGVSKKLESAIGMGLATTFVLTLASVCSYLIETYILAPLGIEYLRTMSFILV
    IAVVVQFTEMVVHKTSPTLYRVLGIFLPLITTN
    CAVLGVALLNVTENHNFIESIIYGFGAAVGFSLVLILFSAMRERIAA
    ADVPLPFKGASIAMITAGLMSLAFMGFTGLVKL

    >gi|209695394|ref|YP_002263323.1| molybdopterin biosynthesis protein MoeB [Aliivibrio salmonicida LFI1238]
    MSELSDQEMLRYNRQIILRNFDFEGQEKLKDSTILIIGAGGLGCASTQYLAAAGLGSMTLVDDDVVELSNLQRQILHCDD
    TIGEKKVISAKNALNRINPNCHITPIDKRLSDDELRVLISSHDLVLDGTDNVETRNQLNRLCFESKTPLISGAAIRMEGQ
    VSVYTYQDNEPCYQCLSSLFGEQALT
    CVEAGVMSPVVGIIGVTQALEAIKVLTNYGHPLIGKLLILDALSMNWREMKLAK
    TPHCSVCGK

    >gi|209695421|ref|YP_002263350.1| glutaredoxin 2 [Aliivibrio salmonicida LFI1238]
    MKLFIFDHCPFCMKAKMVAGIKNLPVEFTYLQNDDVDTRIEMVGANMVPILEKDDGTYMAESLDIAKYLDENDHYPVIEQ
    GTCADDISEWLSNVRPLFNKLTFPRWTKFDLPEFERPEAVTWFTDKKEAFIGMSFDDAFAQSDKFINELTPLLVDVNFIT
    LPSEKGNKITWDDINFFPFLRNLTVVKGLDFPPHLKNYLEEISELTGVNLYLDIAV

    >gi|209695459|ref|YP_002263388.1| thiol/disulfide interchange protein [Aliivibrio salmonicida LFI1238]
    MKSTIKIGIAVGVCAIVFILLLTGLETKESTTSTAMVGQPIPAFELPELTDTSIVLTESLFEKSPLTLLNVWASWCGICK
    TEHQFLHQLKEQGVNIIGLDYRDDRIAAKQVLEQTGSPYQAVIFDPRGSLAMDLGVFGTPTTFLIDQKGVILHRFTGALD
    AKKWQREFVDFFGEK

    >gi|209695480|ref|YP_002263409.1| glutaredoxin 1 [Aliivibrio salmonicida LFI1238]
    MFVVIFGRPGCPFCVRAKEHAETLKAKREDFNYRYVDIHAEGISKADLEKTVGKPVDTVPQIFIDQDHIGGCTEFEAYAK
    ENLGLFD

    >gi|209695514|ref|YP_002263443.1| zinc/cadmium/mercury/lead-transporting ATPase [Aliivibrio salmonicida LFI1238]
    MCTSHKTLDLNTKQHNHDHKHNPSSSCCAAPKITSIKAESAVSDCCSSVDKSSDSDSCCGSDSGESDPLVVIPAISTFSR
    SWLIADMD
    CPSCAAKLKKAILAIPEVTDANVIFATEKLTVRTNNEAAFERVISVAKTTGFPLSDMGSKNASESDAQPFWR
    KNILLIILVAFLVIATGINLVNKELGTIAFTVAGLFGLIPIGKKAIRLAINGSPFSIETLMTVAAIGAVYLGETVEAAMV
    ILLFMLGEQLEGYASAKARSGVKALMDLVPDTALRINKDGTKEEVSASDLKVGDRVQVSPGDRLAADAILASEFASFDES
    ALTGESVPVDKKTGDVLMAGSIVNDRVIEIEITSAQGENAIDRILHLIEEAESRKAPLERFLDKFSRWYTPAMMLLSLLV
    IIIPPLMFGQSWDTWIYRGLAMLLIACPCALVISTPAAITSGLATAAKRGALIKGGAALEELGHIKNIAFDKTGTLTQGK
    PVLTDIRVLVETETEDSILLQSAAVEMGSSHPLAKAVVIKAQEQGLMVIEADDRETVVGKGIKGIVDEKRIALYAPQQFD
    GEVTSEAESQIAFLEEQGKTVVLVLVNDQISGLLAWRDELRPDAKIAVQKLVALGITPIMLTGDNERAAKAIAAELNIDY
    KAGLLPSDKVKYVEQLTAKAKTAMVGDGINDAPAMKTASIGIAMGGGTDVALETADAALTHNRLEELAPMVALSKATLSN
    IRQNITLALGLKSIFLVTSLFGITGLWVAVLADSGATALVTLNALRLLRFKEK

    >gi|209695590|ref|YP_002263519.1| disulfide bond formation protein B [Aliivibrio salmonicida LFI1238]
    MQALNHFSRIRLSWLILLIFILFFEACALTFQHIIKLPPCVMCIYERVAMMGIAGAAIIGLLNPNNIIFRWCGLIAWGIS
    AGWGLKLAMQHVDFQLNPSPFST
    CDLFVTFPSWAPLNKWAPWMFEAYGDCSKIVWQFLTLTMPQWLVIIFAGNLVALAII
    VIAQFFNKKSA

    >gi|209695647|ref|YP_002263576.1| hypothetical protein VSAL_I2210 [Aliivibrio salmonicida LFI1238]
    MSIWNSLSLSTRYSELPPLLFTHVPPQPLNNVHWIMWNEKLAKRFNLPLDPAADAELLSGFSGEVVPPQFSPLAMKYAGH
    QFGSYNPDLGDGRGLLLAEIKDKAGASFDIHLKGAGRTPYSRSGDGRAVLRSTIREYLCSEAMFGLGIPTTRALGMMGSD
    TPVYREGYETGALLLRVAETHVRFGHFEHLFYSNLLAEHKLLADKVIEWHFPDCLDNENPYAVMFNEIVDRTAKMIAHWQ
    AVGFAHGVMNTDNMSIIGQTFDYGPFGFLDDYEPGYICNHSDYQGRYAFNQQPRIGLWNLSALAHALSPLIDKADLDQAL
    EQYEVQLHGYFSQLMRQKLGLITKQDGDSRLFESMFELLSQNSVDYTRFLRELSNVDTHNEQAIIDLFIDRDAAKLWVSL
    YITRCEKEHETVASRCKKMREVNPKYILRNYLAQQAIDKAQEGDYSELEALSLLLRSPFDEHIEFEHYANLPPSWGKKME
    IS
    CSS

    >gi|209695689|ref|YP_002263618.1| hypothetical protein VSAL_I2253 [Aliivibrio salmonicida LFI1238]
    MTILYSFRRCPYAMRARLSLLLSHRTVMLREIELKHKPEALLIASSKGTVPVLVKDNGCVIDESLDIMKWALIDSDLLIN
    ATEEMHLLIQENDHEFKGWLDKYKYSDRYPEHSEAYYREQGEIFLEKIESRLSKSTMLFNEQYSFADIAILPFIRQFAFV
    DIQWFKQSNYTLTRQWLDHFIESHLFLSIMTKYPTWLDSQHEVSFPQNKDRTL

    >gi|209695707|ref|YP_002263637.1| thiol:disulfide interchange protein DsbE (cytochrome c biogenesis protein CcmG) [Aliivibrio salmonicida LFI1238]
    MKKFLFVPLALFLLLVAVFATQLTRNSNGDDPTKLESVLVGKPVPEFRLEDLAEKGKLYDQSIFRGEPLLLNVWAKWCPT
    CYAEHQYLNTLATEGVKIIGMNYKDERAGTVKWLKELGNPYLITLFDGDGMLGMDLGVYGAPETFLIDRNGIVRYRHVGD
    VNDRNWNEKLKPMYDQLVAESK

    >gi|209695799|ref|YP_002263729.1| putative arsenate reductase [Aliivibrio salmonicida LFI1238]
    MKKVMTIIYGIKNCDTIKKCKKWLEANDINFTYHDYRTDGIDKEMITTFVQQLGWENVVNKRGTTYRQLNDEQKASLNET
    TAIDLLLEMQAMIKRPNFNP

    >gi|209695806|ref|YP_002263736.1| thioredoxin-dependent thiol peroxidase [Aliivibrio salmonicida LFI1238]
    MITPLAAGSPAPDISLLDQNGETISLSDLKGKKVLFYFYPKAMTPGCTVQAQGLRDVKAELDAHNVVVLGVSIDAVKRLG
    KFIERDQLNFTLLSDEDHSAADAFGVWGEKKFMGKVYDGLHRISFLINEDGIIEHVFTKFKTKTHHEVVLDYLNEK

    >gi|209695810|ref|YP_002263740.1| putative arsenate reductase [Aliivibrio salmonicida LFI1238]
    MSVVIYHNQKCSKSRQTLALLEEKGIVPEVIKYLEQTPSIDELKTLFSQLGFSSVREMMRTKEDIYKELNLGENALSNEQ
    LFEAMNANPKLIERPIVVHNNHAKIGRPPEQVLDIL

    >gi|209695865|ref|YP_002263795.1| putative peroxidase/antioxidant [Aliivibrio salmonicida LFI1238]
    MVLVGRQAPDFTAAAVLGNGEIVDSFNFKEFTKGKKAVVFFYPLDFTFVCPSELIAFDNRLADFQAKGAEVIGISIDSQF
    SHNAWRNTAIEDGGIGQVKYPLVADVKHEICKAYDVEHPEAGVAFRGSFLIDADGLVRHQVVNDLPLGRNIDEMLRMVDA
    LNFHEKNGEVCPAQWEEGKAGMDASPKGVAAFLSEHADDLSK

    >gi|209695915|ref|YP_002263845.1| integral membrane protein [Aliivibrio salmonicida LFI1238]
    MSISIPWESLFGGMLLGVSATLLLLLNGKIAGISGVLTGLLVPKKQDYAWRVLFIVGMIFGGVVGVHYLGAYVPSEYNAT
    VSTLVIAGLLVGIGTRLGNG
    CTSGHGICGIGRLSVRSMIATATFMIVAAITVFVLNHLL

    >gi|209695988|ref|YP_002263918.1| iron-sulfur cluster insertion protein ErpA [Aliivibrio salmonicida LFI1238]
    MSDVSVPLTFSDVAAAKVKTLIAEEENPNLKLRVYITGGGCSGFQYGFTFDEEVNEGDMTLVNDGVTLVVDPMSLQYLIG
    GIVDYTEGLEGSRFFINNPNATTTCGCGASFSV

    >gi|209696033|ref|YP_002263963.1| dihydrolipoamide dehydrogenase [Aliivibrio salmonicida LFI1238]
    MSKEIKAQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVCLNVGCIPSKALLHVAKVIEEAKAMAAHGIVFGEPQ
    TDIDKIRLWKEKVVTQLTGGLGGMAKMRKVTVVNGFGKFTGANTIEVTAEDGNTTINFDNAIVAAGSRPIKLPFIPHEDP
    RIWDSTDALELKEVPKKLLIMGGGIIGLEMGTVYHALGSQVDVVEMFDQVIPAADKDIVKVYTKRIKDKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEAERYDAVLVAIGRVPNGALLDVEKAGVAVDERGFINVDKQMRTNVPHIHAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGKTEKEAKAEGINYEAASFPWAASGRAIASDCADGLTKLL
    FDKDTNRVIGGAIVGTNAGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESIGMAAEIYEGSITDLPNAKAVKKK

    >gi|209696119|ref|YP_002264049.1| dihydrolipoamide dehydrogenase [Aliivibrio salmonicida LFI1238]
    MKQVNVDVAVIGGGTAGLGSYRAAKAHTDSVVMIEGGPYGTTCARVGCMPSKLLIAAAESVHQIEKAPQFGIHPQGDIVI
    NGREVMARVKFERDRFVGFVLEGVDEIPAEDKISGYAKFLNDNTLQVDDHTIITAKRIVIATGSRPAYPAVWNELGDRLI
    INDDVFDWDDLPTSVAVFGPGVIGLELGQSLHRLGVETKLFGLGGQVGPVTDPEVMAYANKAFNEEFYLDADVKIESMKR
    ISLNDDEDKVEIKFINKQGEQETILVEYVLAATGRRPNTDKLGLENTLVELDERGVPTADHYTLQTSLPTIFIAGDASNQ
    LPLLHEAADQARIAGDNAGRFPEIRAGLRRSKISAVFSDPQIAMVGESYKEITTRLGTCGCFATGEVSFENQGRSRVMLR
    NKGILHVYGEQGTGRFLGAEMMGPNAEHLAHLLAWAHQNKMTISEMLDMPFYHPVIEEGIRTALRDLNAKLHLGPEMIKH
    CMDCGPGC

    >gi|209696120|ref|YP_002264050.1| hybrid peroxiredoxin (thioredoxin reductase) [Aliivibrio salmonicida LFI1238]
    MFTSKEGQSVPQVTFPTRKGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYNELYSVFKDNGVDEIVCVSVND
    TFVMNAWKADQEAENITFIPDGNGDFTDGMGMLVEKNDIGFGKRSWRYSMLVKNGIVEKMFIEENVPGDPFKVSDADTML
    NYLAPEHKEQESITVFTKPG
    CPFCMKAKQTLIDKGLNYEEVVLGKDATTVSLRAITGRTTVPQVFIGGKHIGGSEELEVF
    LA

    >gi|209696209|ref|YP_002264139.1| hypothetical protein VSAL_I2803 [Aliivibrio salmonicida LFI1238]
    METSIIDFVTNNMILAVVWIGIVVALLQNVVKQKTAGYQEVDSAQTTTLMNRENAIVVDVRSKDEFKSGHITDARHILPS
    DIKAGNLAGLENSKTTPIIVV
    CKTGQTAQAAANDLHKAGFEQVKLLKNGLISWNEANLPLVKGKK

    >gi|209696215|ref|YP_002264145.1| thiol:disulfide interchange protein precursor [Aliivibrio salmonicida LFI1238]
    MTNLLRFRAALLSFFILFASFAPQAVAAFDLTKLQNQQDSSFVTVNEAFPFNFMQQGDRVYLDWQVKPDYYLYQQRISVS
    AHDANIADLVMEQGTPHNDEFFGDVNIYTKPLTITVPLISVDKDAELTVRYQGCAKAGFCYPPEIRKIPLSMLTASSSSS
    YQNETANTHVVAKSETAPVSVEKATSPSVNSLNTAGIQQPKNQTQQQALASDLGDAWWTPFLFLALGIGLAFTPCVLPMY
    PILTGIVLGGGKLSHGKAFKLSFVYVQGMALTYTLLGLVVASAGLQFQAALQHPYVLIGLSVMFVLLALSMFGVYTIQLP
    SSLQTKLNDISNQQKGGNLGGVFAMGAISGLVCSPCTTAPLSGALLYVAKSGDLLTGAVALYALAIGMGIPLILAAVFGN
    KLLPKAGVWMTYVKTLFGFILLAVPVFLLERILPHNITPFIWSALGIVAFGWLYHVKATMPQSWKTSVAGIIAILGIVGS
    AIPVIDAISGKTSSQVATTQAVAFKRISTIDELNKELKVAKIQGKPVMLDFYADW
    CVACKEFEKYTFHDENVEPLLSNFI
    LLQADVTKNSPVDIELLKQLKVLGLPTIDFWNANGDYLSDSRLTGFMKAEPFIQHLQQNVSLVE

    >gi|209696289|ref|YP_002264220.1| soluble pyridine nucleotide transhydrogenase [Aliivibrio salmonicida LFI1238]
    MTNSTTTRSTHFDAIVIGSGPGGEGAAMGLTKANLNVAIIEREPSVGGGCTHWGTIPSKALRHAVSRILEFNSNPLYCKN
    NTSLHSTFSDILGHAKSVIDKQTRMRQGFYDRNQCSLIFGEASFVEKNTIAVTAKDGSIETYTADKFIIATGSRPYRPAG
    VNFNHSRVYDSDSILSLKHDPRHIIIYGAGVIGSEYASIFRGLGVKVDLINTRDRLLSFLDNEMSDALSYHFWNSGIVIR
    NDETFKKIEATDDGIIMHLESGKKMKADCVLLANGRTGNTDKLNLSSVGLEADSRGQLTVNGNYQTDVDHIYAVGDVIGY
    PSLASAAYDQGRFTAQAIVKGKSEAKLIDHIPTGIYTIPEISSVGKTEQELTAEKVPYEVGRASFKHLARAQIAGMDIGS
    LKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGNANTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|209696298|ref|YP_002264229.1| thiosulfate sulfurtransferase [Aliivibrio salmonicida LFI1238]
    MEQFQHISVTDAQEKLNQKDHNARMVDIRDPQSFGRGHVDGAFHLTNDTIVTLMNEVEFEQPVLVMCYHGHSSQGAAQYL
    INQGYEEVYSVDGGFEGWNKAGLPVEK

    >gi|209696379|ref|YP_002264310.1| thiamine biosynthesis adenylyltransferase ThiF [Aliivibrio salmonicida LFI1238]
    MSNLLMEGLNDQDFLRYSRQIMLPDIGERGQLSLRNSTVLMVGCGGLGSSVGMYLAAAGVGTLIIADGDDVDLSNLQRQV
    VYREQSIKQNKALAMAQELQSINKTITIEVITKHLTEPALSRFITQVDVVLDCTDNLTTRHNINAACVQHQVPLISGAAI
    GWQGQLMLFSNKSDELGNTSSSCYHCLFPFIESQQTKN
    CQSFGIVGPVVGMIGNLQALETIKYLTQPEWMTWSSLHQFNG
    KSLSWSTMGIPKDHCCPVCQSPSDLQDVSRETHHKERESVSE

    >gi|209808931|ref|YP_002264469.1| peptide methionine sulfoxide reductase [Aliivibrio salmonicida LFI1238]
    MKYRLKITTIALLFIPFFAVMTSFFSTAEDMSTLKKGNYEVATLAGGCFWCTESDLEKLDGVVDVVSGYSGGSLENPTYK
    QVSSGKSGHIEVIQVTFDPKIVSYEQVLDQLFRHMDPTDSKGSFVDRGPQYRPAIFFHNEDQQVIAQEFMNAIDAAGIYP
    KPLATELIEFEKFWPAEDYHQDYYKNNPVRYKYYRYNSGRDQYLDAVFGEDRNENPKTLRQYIDEKTMAQNVKPYNKPSD
    SEIKKMLTDQQYYVTQEEGTERPFNNKYWDNKAEGIYVDIVSGEPLFSSTDKYKSGTGWPSFTKPINKAYIAEEDDFALF
    SKRTEIRSKFADSHLGHVFSDGPKPTGLRY
    CMNSAAMRFVAKSDLEKEGYEEYLYLFNQSS

    >gi|209809016|ref|YP_002264554.1| methylguanine-DNA--protein-cysteine methyltransferase [Aliivibrio salmonicida LFI1238]
    MNVYTQFDSPIGLITVNGNDDGLLGVWYESHARTLSDFGVQDDEHPILQLTISQLTEYFNGERREFSIPLAANGTEFQNK
    VWQALTTIPYGETWCYKDLAIAVGNPKASQAVGGANGKNPISIIVP
    CHRVIGKNGSLTGYAGGLDIKDALLKLEGVR

    >gi|209809097|ref|YP_002264635.1| glutaredoxin [Aliivibrio salmonicida LFI1238]
    MKRIVLYVADKCPHCKDAQRYLDSKKIAYRLTNAKMQRGRKELQAMGARSIPVLKIGDQVMVGWNQKNFDKMYNS

    >gi|209809197|ref|YP_002264735.1| NAD-dependent formate dehydrogenase alpha subunit [Aliivibrio salmonicida LFI1238]
    MMKITIDKQTFTIDEEITLLAAAKECNIEIPSLCGNNINGEKLPCDLCVVEIEGQGVQRACETQVVDGMQVITSSEVLAK
    RRQSALNKILSDHYADCEAPCQTACPAGVDIQSYLYYISQNDHQKAIEVIKRTLPMPLSIGRVCPAFCETECRRGLVDEP
    LAIRQLKRHAADADLHAQESYVPPKKADKGKSIAVIGSGPGGLTCGYYLTNEGYNVTVFDSMPKAGGWLRYGIPEYRLPK
    SILDKEIELMCRNGMEIKTSVKLGEDFLLSQLSDDYDAVCLAVGASKAVEMQYEGSELGG
    CYLGVDYLKDYVMESKLITG
    KKVAVIGGGNTAIDCARTAVRDGADTTLIYRRTRADMPAEDYEVVEAEHEGVKFHFLTNPVENIADSKGRVTQVRLEKMA
    LGEPDASGRRSPKATGEFFIEDFDTVISAVSQKPDLSFLENDNIDLPLTRWNTADSNSLTMHSGVKNIFSIGDFRRGPAT
    AIEAVADGRIAAEAIDRFFKGDMEKIPTKLFNSQKEKKTKQVDPTYFEHIQKAMRVIMPELTAEQREQSFEEVETGFDNA
    DAIREAERCLECACQANTDCGLRDYATEYKADETDLSNESKQKFAIDTSSEFIVFDANRCISCGQCVEACNEKGVHGVLS
    FMKNEDGTNASRPECRAGFEHGYDMGNSNCVQCGACIQACPVGALVDARDKSQGRIELLKPVDTICTYCGVGCKLTMLVD
    ESKNKIKYIQGAKGSPVNEGMLCVKGRFGFDFVGSDQRLTTPLIRKHGELVPASWEEAITLVADKFSAIKTQYGGNALAG
    FSSAKTTNEDNYAFQKLVRCEFETNNLDHCARL
    CHSTTVTGLEASIGSGAMTNDIPSIKYSDLIFIIGSDTTSAHPIIAS
    HIKQAIRHHGARLVVADPKQVDISDHAELYVAQRPGTDVMLLNGIMQQIIKNNWHDQAYITERVEGFEELKAEVMSETYS
    PEKIELITGVKAHDVIEMARYIGTAERTAIYYSMGITQHTTGHDNVRSIANLQMLCGNIGIEGGGINPLRGQSNVQGACD
    MGALPTDFPGYQKVENPAVYEKFVKAWNKPNLPDKKGLTLTEIIDAACHKQVKGLFIMGENPVLSDPDQAHVIHGLETLD
    FLVVQDIFMTETAAYADVILPSCSFAEKAGHFTNTERRVQRISPAVNPPGEAKEDWWIIQEIAKAMGGDWSYQSVEEITE
    EITQVTPQYQGMHWDAIGKNGLQWPCNDANPEGTRIMHSDQFIRGKGQMAAVPFRYAAELPDEEYPLVLTTGRLLEQYHT
    GTMTRKTKGLNNLAGPRAMISVADAERLGISNSEMVRVSTRRGTIEAPAFVTKRMQEGVVFVPFHFVEAAANKLTTTALD
    PHAKIPEFKVAAVKVEKIVVPEMCE

    >gi|209809477|ref|YP_002265015.1| putative lipoprotein [Aliivibrio salmonicida LFI1238]
    MKSIIKPLLLILSSALFLTACSDSNEPKEGVQYEVLPAELAGANMAPVTEVFALSCGHCRNMENFLPVISQEAGTDIDKM
    HITFNQSAHVAAMFYYAADMQVEGTPDHAFMEDLFAATQMGEGTTLTQQQEAYSKAFTSRGLTSPYDFNDEQRDILIQKV
    DNAKMLSEQSGISSVPTFVVNGKYNVLIGGHDDPKKIAETIRYLLEK

    >gi|209809531|ref|YP_002265069.1| putative suppressor for copper-sensitivity B precursor [Aliivibrio salmonicida LFI1238]
    MFKIQSVKIVSVLRLAILLTSTLLLSAFSVSAQPITTGWLTHPDHPPAQVRFMLTGEVDEENNQARGLLEVKLDGEWKTY
    WRSPGEAGVSPVLDWSKSTNLSNLAWHWPTPAYYEQSGLMTLGYKHDVVFPMELTVDDITKPVSFLGKLTLPTCTNICVL
    TEYDLELPPINLTNIETDADAQHLYQQGLSNVPTASDSITIVAASFDKVSQQLHVKLRQDAGWDKPQILIDGSEITDDYF
    SQPSIDINGNDVTATYKVTNWLGETDLVGKPISITVSDALFSHELKAVINDKPFAQTTSTSLLTMIGFALLGGLILNIMP
    CVLPVLGMKLNSMVASSQASKRSIRLQFFSSAAGILTSFWLLAAGLLILKFTGSAIGWGIQFQNPIFIGFMVTITALFTA
    NLFGVFEIQLPSRFSTSLANKGNDSALGHFVQGMFATLLATPCSAPFLGTAVAFGLGASTVEMLMIFTFLGLGMALPWLV
    FALFPRLVSFMPKPGMWMNKVKLIFGLMMLITTLWLLSLLTPFIGGLSAAIIGLLLSTYLLYQIGKTQGKNTVIAIIAVI
    VFATSAALLIGSMTTKHWSTPTEDNLAWQPLNEHAIDEYVKQGKTVFVDVTADW
    CITCKANKIGVILQDPVYSALQQDNV
    ITMKGDWTHPSDKITNYLKSHQRFGVPLNVVYGPNAPQGLPLSVLLTSDDVINALEYAGRTN

    >gi|209809532|ref|YP_002265070.1| putative suppressor for copper-sensitivity D [Aliivibrio salmonicida LFI1238]
    MAKKDIMPKKTQTMKAKITRWVKEIVKFTLIITLFSVAVDFWRSQDMPSEAIPSLSINTIDGEWVDIKKMSQDEPVLLYF
    WGTW
    CPVCNVVSPSVSWLSSDHHVVSVAITSGDDARLTTFMNYKDYEFPVINDSTGSISKEWGVTATPSIVIVKNGEISS
    ITTGVTTPMGLWLRLLFA

    >gi|209809533|ref|YP_002265071.1| putative suppressor for copper-sensitivity C precursor [Aliivibrio salmonicida LFI1238]
    MKSLLLSVSIAASLVLSPVALAEKINPAQEKQLTEISDLLRKNPEIIDGLYSNLTQYIDGQKSLSSVLEQNHDYLYNNPE
    QPYFGAENPKLTIINFTDYN
    CPYCKRLESSLVNIIKKYPEIRVVNVLLPFQQRMVPGLKTNTAWYALNVWENDKTKFAEV
    HRLMMAKPSRHDSTSIMKIADLTDTQKDLTPNQKKKRLLKKMKKYSLNLACEEHQA

    >gi|209809644|ref|YP_002265183.1| glutaredoxin [Aliivibrio salmonicida LFI1238]
    MKPIKITLYRWGGSWGPFKVNIPCGECTLTKDILQDTFDSELSGIPIELEVKDWLTYWWEPLKLKAWHTPIIIVENTVIS
    EGEALNRGVLIQAVIAQVVQRDEIKGNVVYGKAT
    CPFCIKAKAALDEKGIDYIYHDVVKNSAALYRMIPEVKAIIGEKTP
    VTVPQIWLDGKYIGGFDNLTLHLNK

    >gi|209809792|ref|YP_002265331.1| putative rhodanese-related sulfurtransferase [Aliivibrio salmonicida LFI1238]
    MRIKAGLYLLLAMISFTSWASERGELAWDLVEQGALLIDVRTPSEFNQGHLEGAANLPLDTINTAFSDIDKQTPIVVYCR
    SGNRSGQAMSYLKKAGFTQVYNGGSLDEMEVSQPTQ

    >gi|209694175|ref|YP_002262103.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Aliivibrio salmonicida LFI1238]
    MKIVLANPRGFCAGVDRAISIVERALELYKAPIYVRHEVVHNRFVVEGLKQRGAIFVEELSEVPDDNIVIFSAHGVSQAV
    RTEAKERALTVFDAT
    CPLVTKVHMEVARASKKSIEVVLIGHAGHPEVEGTMGQYASEAGGMYLVETPEDVEKLIVQDPNN
    LHYVSQTTLSVDETADVIDELRRVFPKIQGPRKDDICYATQNRQDAVRDMAGQVDVMIVVGSKNSSNSNRLRELSEKLGT
    TSYLIDCPEELKEEWLTNQAKVGVTAGASAPEELVNQIIEQVKVFGGTTVDELKGREENMFFEVPKELQIKTVS

    >gi|209695055|ref|YP_002262984.1| putative glutaredoxin [Aliivibrio salmonicida LFI1238]
    MITLYSTEGCHLCEQAFDLLVEVGVNMEQVDTVDIAFDNVLFSRYGVTIPVVANGLSELNWPFDISQLKNWLEDNGITYN