Dictyoglomus turgidum DSM 6724 uid59177

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217966480|ref|YP_002351986.1| glutaredoxin-like protein, YruB-family [Dictyoglomus turgidum DSM 6724]
    MSSNLRIIVYSTPSCPWCNAAKRYFRERGIRFYDVDVSKDRKAAEEMVRKSGQMGVPVIDINGHIVIGFDRNKIDRLLGL
    R

    >gi|217966626|ref|YP_002352132.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Dictyoglomus turgidum DSM 6724]
    MEKRTDVLIIGGGPAGIVCASTAKNYYPDKKITVLRSVQNSVVPCGIPYMFYSLKKPEDNKMGYAGLESAGIEVLVDEAV
    SINRKEKYVETKSGTKYYYEKLVLATGSLPIIPKITGIEKKNIFSIYKNLDYLKDVVEKVKESKNVLILGGGFIGVEIAD
    EISKLEGINVYLVEMLPHLLAQSFDKEFSVLVEEKLRSKGVNVLTNAKVIEFIGDEKVRRVKLEDGREIDVDVVLLGIGA
    RPNSELAKNTGLEVISTGAIWVDEYMRTSDPDIFAIGDCALKRDFYTRRNTAVMLASTATAEARIAGANLYKIKLIRENK
    GTIAVYSTYVDGLVLASAGLTESNAVREGFEIVTGTFEGIDKHPGTLPGVNKTKVKLIFSKHSGVLLGGQIAGGMSFAEL
    INLIGVAIQQRMTASELETLQMATHPYLTCAPTVYHVVMAAQEAISKI

    >gi|217966761|ref|YP_002352267.1| OsmC family protein [Dictyoglomus turgidum DSM 6724]
    MANLVTFKAKGEWKGNLKVEVNIRNKFTINMDEPPSLGGEDTAPNPVEVVLAALIGCLGIVIPVVAREKNIPLESIEIET
    EGDLDPRGFMGDPSVRAGYQEVRAKVKIISPVERERIEELMKEVERR
    CPVSDIIRNPVNLKISLE

    >gi|217966817|ref|YP_002352323.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dictyoglomus turgidum DSM 6724]
    MSKKAPDFTLPDQNGKEVSLSDYKGKWVVLYFYPKDMTSGCTKEAVSFSEKIDEFKKRNSVVIGISKDTVESHKKFAEKY
    NLEIILLSDKDAKVIKEYGAWGKKRMYGKETEGTLRNTFIISPEGEILHEWKNVKLDGHVEEVLKKLDELISAS

    >gi|217966912|ref|YP_002352418.1| protein of unknown function DUF395 YeeE/YedE [Dictyoglomus turgidum DSM 6724]
    MIWQGLIVGILFGVVLQRSRMCFNSAIRDIKFNKDNYLAKMAAVAILLETLGFHLVASLGWIKLNPLPFIPLAQIIGGFL
    FGMGMVLAGG
    CASGVTYRIGEGYITAILAGLSFGVTAAAVRGGVLNFVNSWFGSPITVTMQDPGIYNAVEGKVSPTIANV
    FGINPWIVAIIFAILLAVYIWGTKTTERQVSGLNWLTGGIALGVVGILGYLSQKTYALGITGGWVNLLKGTVAGVPYNWI
    GMEVLGIIIGAFISAVASKEFKLRVPKDPKTYLQVILGGILMGFGAGVAAG
    CNIGHILSGLPHLALSSILATIFFVLGNW
    FMYWYLYARK

    >gi|217966913|ref|YP_002352419.1| DsrE family protein [Dictyoglomus turgidum DSM 6724]
    MYIVIQVNVPPYTYEDLDTAIHLAEAALKRGHKVSIFLFADSVLSINSKVKPLRVDRNIPLKMKELSEKGVEIHICGLCA
    EYRGISSENAVEGPKFSGVPEMASLIFNADRYVNLMP

    >gi|217966916|ref|YP_002352422.1| dihydrolipoamide dehydrogenase [Dictyoglomus turgidum DSM 6724]
    MEKFDVIFLGAGSGGYVGAIRAADLGKKVCIIEARELGGTCLNRGCIPTKALLKSAEVFRTVKEAKTFGVNVDSYSFDVN
    GIYSWKENVVKKLVSGVEYLLKSRKVVIKKGRGRIIDNETVEIETSEGKEIVQGENIVIATGSEPAMIPTFKIDGKNVLT
    SDDALTLGEIPKDIVIIGAGAIGIEFATFYSTFGTKVTIVEMMPQVVPTLKDKKVANYLQRILNKKGIEVKVGAKIESVE
    VKDGKVYSTLSTGEVLESEKVLVSIGRKLNSDNIGLENIGVNVDRGRIVVDEYLRTNVKNVYAIGDVIGGLLLAHKAMKE
    GEVVAEIIAGENKKMDYRVVPWAIFSSPEIAACGLTEEEAKEQGIDVITGEFPFSANGKAVSMNATDGFVKVVARKEDKV
    IIGAQIIGPEASVMIAELALAIQNNLTLDDVADTIHTHPTLPEAIMEAVKVPLGSVVHIYLRR

    >gi|217966969|ref|YP_002352475.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dictyoglomus turgidum DSM 6724]
    MENLERKGIPLLGEPFPEMKVKTTHGEKVLPNDYKGKWFVLFSHPADFTPVCTTEFVAFQKRYDKFRALNTELIGLSIDQ
    VFSHIKWVEWIKEKLGVEIEFPIIADDTGKVAEKLGLIHPGKGTNTVRAVFVVDDKGIVRLILYYPQEVGRNIDEILRAV
    EALQVTDKYGVATPAQWPDSEVVGKDHVIIPPAGDVETVKARLEAAKKGEIECFDWWFCHKKLTK

    >gi|217967149|ref|YP_002352655.1| glutaredoxin-like domain protein [Dictyoglomus turgidum DSM 6724]
    MALLKEEDRQYLENLFRENLKDKLKIILFSDKAAGSKLVVPGRVECPYCQQTREILEELVSLSDKLELEIHDFLTDEILA
    KKYNLDKIPAILFEKNNNVLGVRYFGIPSGYEFSSLIEDIIDISRGETQLSPNTKAFLATVDKPVHIQVFVTPT
    CPYCPR
    AVRLAHQFAMENPLITADMIEAIEFPHLAEKYDVTGVPKTIINEKVEIEGAVPENVFLEYFKSALKA

    >gi|217967150|ref|YP_002352656.1| thioredoxin reductase [Dictyoglomus turgidum DSM 6724]
    MEFISITKPIEKIEEVQDVIILGGGPAGLTAGIYTGRNLWRTLIIEKGILGGNAALTEKIDNYPGFPEGITGEELVKRME
    TQAKKFGSKILESDVLSLKIDGNWKIVETSQGTFRAPTLIIATGTRPRKLEVPGEEDFIGKGVSY
    CAVCDGAFFIRKKVA
    VIGGGDSAVEEAIYLTKFAEEVTIIHRRDTLRAEKITQQRAFSNPKIKFLWSHVVKAIEGEKKVERLVLEDLKTGETKIF
    PVDGVFIYVGLIPNTELFKDILNLDPNGFIITDEKMHTSMPGIYAAGDVRGKVLRQIVTAVADGAIAGMEASKFLEELNY
    KEV

    >gi|217967275|ref|YP_002352781.1| methylated-DNA/protein-cysteine methyltransferase [Dictyoglomus turgidum DSM 6724]
    MKGALRVNNGFIMVEYEKSVIKRIYWTYKCEEEKDFPGKELFIDYFLGKKVDFGDLIIDLKRVPSIFKKIYEFTREIPYG
    KVISYKGIAEFLGNSKLQRVVGNAMKSNPFLIVVP
    CHRVVRSNGSIGNFSLGSEFKKYLLNLEGVKIENEKISCLRYWWH


    >gi|217967481|ref|YP_002352987.1| electron transport complex, RnfABCDGE type, E subunit [Dictyoglomus turgidum DSM 6724]
    MRNFFKYVVNGIFKENPVLILMIGLCSVLAVSTSVENAIGMGLAFSFVMIFSNLFVSLLRPITPNEIRIPIFIIVIGTFT
    TIVDLVISAYFPELYKALGIFIPLIVVN
    CIIIGRAEAFAYRHSVLESVADGIGISLGYIWAIVALGLIREFLGNGTILGK
    VIFSGFDPAKVFTMPPGAFWGIGLLIGLLKWFEKRVSRR

    >gi|217967482|ref|YP_002352988.1| electron transport complex, RnfABCDGE type, A subunit [Dictyoglomus turgidum DSM 6724]
    MNIIGKLFMLFISASLINNIVFMRFLALCPFVGMSTQIETSIGMGAAVTFVMVMASVVTFFIYYYILVPLNLLFLRTISF
    ILVIAVLVQLVEMVIKKFLSSLYKAMGIYLPLITTN
    CAILGVTLLNINYGHNLIEAIVYSLGVSLGFTIALILLASIRDR
    LSYSEIPEFWKGYPIVFISAGLLALIFLGFQGLAH

    >gi|217967610|ref|YP_002353116.1| Redoxin domain protein [Dictyoglomus turgidum DSM 6724]
    MRKSLILKFLILFIFMVFFLTTSIYPKQTQISENSPALDFTLPDIKGKQYSLSSFKGNVILLNFWATWCPPCRYEVPMLD
    KIQKEYKDKKFKIVAVSLDSDINALRDYLKNVNVSFLVLSDKKGSVGYAYNILAIPTSFLIDKKFVVRKIYLGILPEKEF
    KKDLEKWLKD

    >gi|217967658|ref|YP_002353164.1| OsmC family protein [Dictyoglomus turgidum DSM 6724]
    METKVVWDGKMQFTGTTPSNFNIVMDAVPEHGGENKGPAPMELIPVALGGCTGMDVISILNKMKEKVEHFEMRITTERAT
    EHPKVYTKVHIEYIFKGENLNEENIKKAIELSQNKYCSVSAILRGTAEVTYSYKIL