Dictyoglomus thermophilum H 6 12 uid59439

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|206901225|ref|YP_002249962.1| hypothetical protein DICTH_0075 [Dictyoglomus thermophilum H-6-12]
    MANLVTFKAKGQWKGNLKVEVDIRNKFTINMDEPPSLGGEDTAPNPVEVVLAALIGCLGIVIPVVAKEKNIPLNSIEIET
    EGDLDPRGFMGDPTVRAGYQEVRAKVKINAPVEREKIEELMKEVERR
    CPVSDIIRNPVNLKISLE

    >gi|206901594|ref|YP_002250160.1| bacterioferritin comigratory protein [Dictyoglomus thermophilum H-6-12]
    MEKKAPNFTLPDQNGKEISLSDYKGKWVILYFYPKDMTSGCTKEAVGFSEKIDEFTKRNAVVIGISKDSVESHKKFADKY
    NLKITLLSDKDAKVIKEYGAWGKKKMYGKETEGTIRSTFIISPEGEILHEWKNVKVDGHVEEVIKKLDELIAS

    >gi|206901903|ref|YP_002250266.1| YeeE/YedE family protein [Dictyoglomus thermophilum H-6-12]
    MIWQGLLVGILFGVVLQRSRMCFNSAIRDIKFNKDNYLVKMAAVAILIETLGFHLVASLGWIKLNPLPFIPLAQIIGGFL
    FGMGMVLAGG
    CASGVTYRIGEGYITAILAGLFYGITASAVRGGVLNFVNSWFGSPITVTMQDPGIYNAVEGKVSPTIANV
    LGINPWIVAIVFAVLLAIYIWGTKTTERQVSGLNWLTGGVALGIVGILGYLSQKSYALGITGGWVNLLRGTVSGVAYNWI
    GMEVLGIIIGAFVSALISKEFKLRVPKDPKTYLQVILGGILMGFGAGVAAG
    CNIGHILSGLPHLALSSILATIFFVLGNW
    FMFWYLYARK

    >gi|206900609|ref|YP_002250267.1| hypothetical protein DICTH_0385 [Dictyoglomus thermophilum H-6-12]
    MHIAIQVNVPPYTYEDLDTAIHLAEAALKRGHKVSIFLFADSVLSVNSKVKPLRVDRNIPLKMKELCEKGVEVHICGLCA
    EYRGINSENTVEGPKFSGVPEMASLIFNADRYMNLMP

    >gi|206901008|ref|YP_002250270.1| dihydrolipoamide dehydrogenase [Dictyoglomus thermophilum H-6-12]
    MERFDVIFLGAGSGGYVGAIRAADLGKKVCIIEARELGGTCLNRGCIPTKALLKSAEVFHTVKDAKTFGINVDAYSFDVN
    GIYSWKENVVKKLVSGVEYLLKSRKVVIKKGRGRIIDNETIEVETPEGKEIVQGDNIVIATGSEPAMIPTFKIDGKNVLT
    SDDALNLREIPKDIVIIGAGAIGIEFATFYSTFGTKVTIVEMMPQVVPTLKDKKVASYLQRILNKKGIEVKVGAKIESVE
    VKDGKVYSTLSTGEVLESEKVLVSIGRKLNSDNIGLENIGVNVDRGRIVVDEYLRTNVKNVYAIGDVIGGLLLAHKAMKE
    GEVVAEIIAGENKKMDYRVVPWAIFSSPEIAACGLTEEEAKEQGIEVVTGEFPFSANGKAVSMNATDGFVKVVAKKEDKV
    IIGAQIIGPEASVMIAELALAIQNNLTLDDVADTVHTHPTLPEAVMEAVKVPLGSVVHIYLRR

    >gi|206900184|ref|YP_002250284.1| thioredoxin peroxidase [Dictyoglomus thermophilum H-6-12]
    MQKRGLEIGSQAPDFSLKDQNGDEFKLSNYKGKKILLSFHPLAWTSICSKQMLSLEENYNKFLELNTIPVGVSVDPVPSK
    KAWAENLQLKNLKILSDFWPHGKVAKLFNIFREEDGFSERANIIIDEEGKIVFFKIYPIRELPDINEIIEFLSNK

    >gi|206901885|ref|YP_002250307.1| antioxidant, AhpC/TSA family [Dictyoglomus thermophilum H-6-12]
    MENLERKGIPLLGEPFPKIEVQTTHGVKNLPDDYKGKWFVLFSHPADFTPVCTTEFVAFQKRYDKFRALNTELIGLSIDQ
    VFSHIKWVEWIKEKLGVEIEFPIIADDTGKVAEKLGLIHPGKGTNTVRAVFVVDDKGIIRLILYYPQEVGRNIDEILRAV
    EALQVTDKYGVATPAQWPDSEVVGKDHVIIPPAKDVETAKQRLESAKKGEIECFDWWLCHKKLER

    >gi|206901551|ref|YP_002250478.1| hypothetical protein DICTH_0595 [Dictyoglomus thermophilum H-6-12]
    MALLREEDRQYLENLFKENLKDKVKIILFSDKAAGSKLVVPGRVECPYCQQTREILEELVSLSDKLELEIHDFLTDEIIA
    KKYNVDKIPAILFEKNNNVLGVRYFGIPSGYEFSSLIEDILDISRGETQLSPTTKAFLATVNKPVHIQVFVTPT
    CPYCPR
    AVRLAHQFAMENPLITADMIEAIEFPHLAEKYNVTGVPKTIINEKVEIEGAVPENIFLEYFKSALKD

    >gi|206901383|ref|YP_002250479.1| thioredoxin-disulfide reductase [Dictyoglomus thermophilum H-6-12]
    MDFISLTKPIEKIEEEQDVIILGGGPAGLTAGIYAGRNLWRTLIIEKAIVGGNAALTEKIDNYPGFPEGITGEELVKRME
    AQAKKFGSKILEADVLSLKIDGNWKIVETSNGVFRAPTLIIATGTRPKKLGVPGEKEFIGKGVSY
    CAVCDGAFFTGKKVA
    VIGGGDSAVEEAIYLTKFAEEVTIIHRRDTLRAEKINQQRAFSNPKIKFLWSHIVKAIEGEKKVEKLILEDLKTGETKIF
    PVDGVFIYIGLIPNTELFKGILNLDSNGFIITDEKMHTSIPGIYAAGDVRGKILRQVVTAVSDGAIAGMEASKFLEELNY
    KEV

    >gi|206901357|ref|YP_002250602.1| methylated-DNA--protein-cysteine methyltransferase [Dictyoglomus thermophilum H-6-12]
    MKGALKLDKGFIVVEYESSLIKRVYWTNESEEEKNFPGRELFIDYFSGKKVDFGELNIDLTEFPSFFKRIYEVARRIPYG
    KVTSYKSIAELIGNSKLQRVVGNAMKNNPFLIIVP
    CHRVVKSDGSLGNFSLGVEFKKYLLTLEGVRLENEKVSCFRYWWY


    >gi|206901966|ref|YP_002250816.1| na(+)-translocating NADH-quinone reductase subunit d (na(+)-translocating nqr subunit d) (na(+)-nqr subunit d) [Dictyoglomus thermophilum H-6-12]
    MKDFLKYVVNGIFKENPVLILMIGLCSVLAVSTSVQNAIGMGLAFSFVMIFSNIFVSLLRPITPNEIRIPVFIIVIGTFT
    TIVDLVISAYFPELYKALGIFIPLIVVN
    CIIIGRAEAFAYRHNVLESIADGIGISIGYIWAIVALGLIREFLGNGTILGK
    TLFSWFNPAKVFTMPPGAFWGIGLLIGLLKWFEKRMGRR

    >gi|206901393|ref|YP_002250817.1| na(+)-translocating NADH-quinone reductase subunit d [Dictyoglomus thermophilum H-6-12]
    MNIIGKLFMLFISASLINNIVFMRFLALCPFVGMSTQIETSIGMGAAVTFVMVMASVVTFFIYYYILVPLNLLFLRTIAF
    ILVIAVLVQLVEMVIKRFLSGLYKAMGIYLPLITTN
    CAILGVTLLNINYGHNLIEAIVYSLGVSLGFTIALILLASIRDR
    LSYSDIPEFWKGYPIVFISAGLLALIFLGFQGLAH

    >gi|206900683|ref|YP_002250947.1| thiol:disulfide interchange protein [Dictyoglomus thermophilum H-6-12]
    MVILSSTLVYSKQPQVSENSPAVDFTLPDIKGKKYTLSSFKGNVVLLNFWATWCPPCRYEVPMLDRIQKEYKNEKFKVVA
    VSLDSDVNSLKEYLKSVSISFLVLSDSKGSVGYIYNILAIPTSFLIDKKFIVRKIYLGILPEKEFKKDLEKWLKD

    >gi|206900848|ref|YP_002251002.1| OsmC/Ohr family protein [Dictyoglomus thermophilum H-6-12]
    METKVVWNGKMQFVGTTPSNFTIVMDAVPEHGGENKGPAPMELIPVALGGCTGMDVISILNKMKEKVEHFEMRITTERAT
    EHPKVYTKVHIEYIFKGENLNEENIKKAIELSQNKYCSVSAILRGTAEVTYSYKIL

    >gi|206900427|ref|YP_002251289.1| copper-translocating P-type ATPase [Dictyoglomus thermophilum H-6-12]
    MEKIELPILGMSCAGCALRIENTLKEIDGIEDVSVNFSLERAELILDKKISLKYVKEKIEEIGYGIVTSKVNFPVLGMTC
    INCAKRIEQELSKVLGVVDVNVDFAQEKLFLEYVPTLVSVKDIKRVIDNLGYELLLENKEIEDVVKEAREKELKDIKRRF
    LISLILAIPVFLGSMFFKFNPVFLFLLTTPIQFYGGYPFYKSAYSAIKHRFFDMNTLVSLGTTSSYIYSVLSTFFPSVFS
    GTNVRPEVYYDSSAIIITFVLLGRFLEKKAKSKTSQAINKLLSLKPETAFVKRGDDFVEIPVEEIFKGDIILIKPSVRIP
    VDGEIIDGISYIDESMLTGESLPKEKRVGDKVYEGTINMSGVIKIRAEKVGQETLLSRIIRKVEEAQNTKSSVQRLVDRI
    ANVFVPIVLAIAFLTSVVWYIWGPSPSYKYALFSFVSVLVIACPCALGLATPTALVVGIGKGSEMGILINGAEVLEKVEK
    IDTVIFDKTGTLTYGKLKVKDVLSLKEYDKEKLLKIAGSLERFSEHPIAKSILEELKIQDLLDFYEVRNLREQPGYGIEG
    YIGEDKYFIGRIEDYLREDYKNFNLDFAISNLVGIYKNGELVGIIVLQDQLREDAKFVVERLMDKGYKVGMLTGDKKEVA
    EEVSKNLGLSFYISEVLPEEKAEKILELQKEGKKVAMIGDGINDAVALAQADLGIAMGNGTDIAIESGDIVLVNSDLKGV
    LRALELSEKIFKTIKWNLFWAFIYNVIGIPIASGLLYPFFGILLNPMFAGMAMAFSSVFVVTNSLRLGRFKTSV

    >gi|206901754|ref|YP_002251547.1| hypothetical protein DICTH_1736 [Dictyoglomus thermophilum H-6-12]
    MNSNLRVIVYSTPSCPWCNAAKRYFRERGIRFYDVDVSKDRKAAEEMVRKSGQMGVPVIDINGHIVVGFDRAKIDRLLGL
    K

    >gi|206901878|ref|YP_002251725.1| NADH oxidase [Dictyoglomus thermophilum H-6-12]
    MDKRTDVLIIGGGPAGIVCASTAKKYYPDKKITVMRNVQNSVVPCGIPYMFYSLQKPEDNKMGYAGLENAGIEVLVDEAV
    NINRKEKYVETKGGDKYYYEKLVLATGSLPIIPKIPGIEKKNIFPIYKNLDYLKEVVEEIRKSKNVLILGGGFIGVEIAD
    EVSKLQGINVYLVEMLPHLLAQSFDEEFSILVEEKLKSKGVNVLTNAKVVEFIGDEKVRKVRLEDGREIDVDVVLLGIGA
    RPNSELAKTAGLEVINTGAIWVDEYMRTSDPDIFAVGDCALKRDFYTRRNTAVMLASTATAEARIAGANLYKIKLIRENK
    GTIAVYSTYVDGLVLASAGLTENSAMREGFEVVTGIAEGIDKHPGTLPGVNKTKVKLIFSKHSGVLLGGQIAGGMSFAEL
    INLIGLAIQQRITASELETLQMATHPYLTCAPTVYHVVMAAQEAIKKIYKDS