Dickeya zeae Ech1591 uid59297

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|251787666|ref|YP_003002387.1| glutathione-disulfide reductase [Dickeya zeae Ech1591]
    MTRHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKHLGGTCVNVGCVPKKVMWYAAQIAEAIHHYGPDYGFDVTVNRFN
    WDTLLKNRSAYIDRIHQSYNNVLGKNQVDVIQGFARFVDAKTVEVNGERITADHILIATGGRPTRPDIPGAEYGIDSDGF
    FELTALPPRVAVVGAGYIAVEIAGVLNALGSDVHLFVRKHAPLRQFDPLIVETLVEVMNTEGPALHTESIPKAVVKNADG
    SLTLQLESGHEHTVDCLIWAIGREPANDKVNLEAAGVALNNKGYIVVDKFQNTTVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPEE
    KIVGVHGIGFGMDEILQGFAVAVKMGATKKDFDNTVAIHPTAAEEFVTMR

    >gi|251787679|ref|YP_003002400.1| uncharacterized peroxidase-related enzyme [Dickeya zeae Ech1591]
    MTQSTSDILDTLAEIAPNSPLAQARATRDAATRHTQGSYDALFSQTTGDALPLALRFFIAEQVSGWHQNTRLQQFYAQRL
    ADFPPPAPGAALDRALEHAERLAYQPVAAQPEQLQTLQQAGWAVDDIVTLSQLVAFVSFQSRLLHGYRLLAGHAEEPAPA
    APAAVAGRWHTQPLTHSGKTAPDAFTQGELGWEPWVPAKPLAAFTADEQAILARFGHTDSDYFRLLGRNLPVLEQRTLTD
    KGIFYTSGGLPRKDRELAAAVVSKINGCIY
    CASVHARKASQLSKQDDAVQRLLDVPPGGDIAAGQDARWQAIIAFAARLS
    TTPSQVNAQDLARLREQGLDTLDILDLIQSTAFFAWANRLMLTLGEPFWPLR

    >gi|251787777|ref|YP_003002498.1| glutaredoxin-family domain protein [Dickeya zeae Ech1591]
    MFVSQEGKKIPSVTFHTRQGDQWVDVTTEELFSNKTVVVFSLPGAFTPTCSSSHLPRYNELAAVFKQFGVDAVLCVSVND
    TFVMNAWKADQDAENITFIPDGNGEFTRAMNMLVEKADLGFGPRSWRYSMLVRHGMVEKMFVEPNKPGDPFEVSDADTML
    KYLAPHYKVQESVSLFTKPG
    CSFCAKAKQLLQDRGIQYEEIMLGKDATTVSLRAVTGRSTVPQVFIGGRHIGGSEELETF
    LTT

    >gi|251787779|ref|YP_003002500.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Dickeya zeae Ech1591]
    MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARV
    ISTSFSDILRHADSVIGQQTRMRQGFYERNHCEIFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPGGVDF
    DHPRIYDSDSILDLDYEPQHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMSDALSYHFWNNGVVIRHNE
    EFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGNTETLGLENVGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSL
    ASAAYDQGRIAAQAITKGDASAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|251787807|ref|YP_003002528.1| thioredoxin [Dickeya zeae Ech1591]
    MSDKIIHLTDDSFETDVLRSEHVTLVDFWADWCGPCKMIAPILDEIADEFEGKLKIAKLNIDDNPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLNANL

    >gi|251787880|ref|YP_003002601.1| Thiosulfate sulfurtransferase [Dickeya zeae Ech1591]
    MEQFQSIDIEQAYQRWQQGHTLVDIRDPQSFGAAHVPGSTHLTNETLADFVRDADFEQPVMVMCYHGISSRNAASYLMSL
    GFEAVYSVDGGFDAWQKRFPQDVAAG

    >gi|251788050|ref|YP_003002771.1| OsmC family protein [Dickeya zeae Ech1591]
    MSIEKVLYVAHAQATGGRDGRAVSSDQQLDVKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGALKFVGARDKVSIPAGT
    TINGSVGIGAIPNGFGIEVELKITLPGLDRATAEDLVQKAHIV
    CPYSNATRGNIDVTLTVI

    >gi|251788191|ref|YP_003002912.1| hydroxymethylbutenyl pyrophosphate reductase [Dickeya zeae Ech1591]
    MKILLANPRGFCAGVDRAISIVERALEVYGAPIYVRHEVVHNRYVVEGLRERGAVFIEQIEDVPDGAILIFSAHGVSQAV
    RAEAKSRELTIFDAT
    CPLVTKVHMEVARASRKGTEAILIGHAGHPEVEGTMGQYNNPDGGMYLVEGPEDVWSLQVKDETN
    LCFMTQTTLSVDDTSAVIDALRARFPQIIGPRKDDICYATTNRQEAVRNLAAEANVVLVVGSKNSSNSNRLAELAQRVGK
    PSYLIDSADDIQEQWLKDVACVGVTAGASAPDVLVQQVIKRLQAMGGKVAMEMQGREENIVFEVPKELRMDVREVE

    >gi|251788276|ref|YP_003002997.1| dihydrolipoamide dehydrogenase [Dickeya zeae Ech1591]
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQ
    TDIDKIRTWKEKVINQLTVGLSGMAKGRKVKVVNGFGKFTGPNTLVVEGESGSTTVNFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKTVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAVFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|251788424|ref|YP_003003145.1| peptide methionine sulfoxide reductase [Dickeya zeae Ech1591]
    MITNVDKTQLIGKSDALPGRTTPMPVARLHAVNQHSMTHVPDHMEEAIFAMGCFWGVERLFWQQPGVYSTASGYCGGYTP
    NPTYREVCTGKTAHAEAVRVVFDPSVVSYNQLLQLFWENHNPAQGMRQGNDIGTQYRSAIYTLTPEQDTAAKASYQRFQQ
    AMREAGDNRDITTEIRPAGPFYYAEDEHQQYLHKNPHGYCGLGGIGVCLPPQG

    >gi|251788491|ref|YP_003003212.1| thioredoxin [Dickeya zeae Ech1591]
    MNTVCASCNATNRLPENRINENHHAKCGRCGHPLFSGEVINATEKTLDKLLQDDLPVVVDFWAPWCGPCVNFAPVFESVA
    DENADKIRFIKVNTEAEPGLSARFRIRSIPTIMLFKQGKMVDMLNGAMPKAPFESWLNESL

    >gi|251788579|ref|YP_003003300.1| transcriptional regulator, AraC family [Dickeya zeae Ech1591]
    MSDYARIADAITFIASRVNSQPTLDEIAAHVHLSPFHFQRLFSRWAGVTPKRFLQVLTLERAKALLRESRPLLDVADSVG
    LSSGSRLYDHFVHLDAVTPGEYQQQGTGLVIEYAVQDTPFGNAFIAVTPRGICSLSFLDNADAGEQRAELHNMWPHALLH
    ENQPRIRSVIETMFAVKKPPDRPISLHVTGTNFQISVWKALLKIPPATVVSYSQVAAAVGHHNAARAVGLAVGANPVAFL
    IP
    CHRVIQQSGKIGGYHWGETRKHALHAWESARYE

    >gi|251788645|ref|YP_003003366.1| glutaredoxin [Dickeya zeae Ech1591]
    MNISIYSKKDCPQCDATCRILDSYGITYHKIDISDDKPAQVHVLALGYRQLPVVETSETHWCGFRPDKLRLLRVAAA

    >gi|251788668|ref|YP_003003389.1| iron-sulfur cluster assembly accessory protein [Dickeya zeae Ech1591]
    MSDDVALPLQFTDAAASKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEKQGVSLVVDPMSLQYLI
    GGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI

    >gi|251788736|ref|YP_003003457.1| iron-sulfur cluster assembly protein IscA [Dickeya zeae Ech1591]
    MSISLSDSAAQRVNAFMANRGKGVGLRLGVRTSGCSGMAYVLEFVDELNTDDVVFEDKGVKVIIDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|251788743|ref|YP_003003464.1| Rhodanese domain protein [Dickeya zeae Ech1591]
    MSISTAGLFVSASWLNAHRHDDDIALIDARMLPPGNDTRDIAAEYRAEHLPGAVFFDIESLSDHHTALPHMMPNITTFAD
    ALGKLGLNERQHLVIYDEGNLFSAPRAWWMLRLSGASHISILSGGLSGWKQQGLPLEQGDVSPTASVFHAQPPAASAIRS
    LNDVLALCRTGDEQIVDARPAPRFLGEVDEPRPGLRRGHIPGSVNVPWSLLVENGALKPADELAAIFHQAGVDIQRPIVA
    S
    CGSGVTASVVMLALFVLNAPQVSLYDGSWSEWGARDDVPVVTG

    >gi|251788793|ref|YP_003003514.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Dickeya zeae Ech1591]
    MNDVIIIGGSFAGLAAALQLGRARRKVTVLDTGLPRNRFADRSHGVLGHDHKLPQDILTEARQQLTRYPTIKLVSARAES
    VSGAIDDFSVLTSDGESLKARRLILSYGVADQIPAVPGFAEGWGSSIVP
    CPYCDGFEVAGRHWGLVWSGPMSHNYVRLYH
    DWTDTLTVFADGHDIPADIRVDLAHRGIPVIDGRITEIDYDVSHNATIRLDVAPPVAVDILFAHPRNKPSARLHESLGLA
    TVDTPQGIALKVDEHRETSMPGIYAAGDLANPSMHSVTTAAWQGAVAGISAQQSMLV

    >gi|251788974|ref|YP_003003695.1| OsmC family protein [Dickeya zeae Ech1591]
    MAVEKVLYRAQASVTGGRDGHAVSEDNHLDLKLTTPRELGGLGGSGTNPEQLFAAGYAACFTGALKLVASKEKVLVPSTT
    VIEGLVGIGQSGDGFGIEVELRITIPGMDKAQAQALVEKAHQV
    CPYSNATRGNVDVTLTVL

    >gi|251789021|ref|YP_003003742.1| NADH-quinone oxidoreductase, chain I [Dickeya zeae Ech1591]
    MTLKELLIGFGTQVRSICMVGSNAFKKRETKMYPEEPVNPPPRFRGRIVLTRDPDGQERCVACNLCAVACPVGCISLQKA
    EMKDGRWYPEFFRINFSRCIFCGMCEEACPTTAIQLTPDFEMGEFKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAVDG
    KEKGEAENEAKPIDVKGLLP

    >gi|251789219|ref|YP_003003940.1| Rhodanese domain protein [Dickeya zeae Ech1591]
    MPVLHNRVSNEELKARMLAETEPRTTVSFYKYFQLDEPQAFRDALYIAFHQIQVFGRVYIAKEGINAQISVPASRFEHFR
    AALFSSHPALDGIRLNIALEDDGKSFWVLRMKVRDRIVADGIDDDSFDPTRVGQYLNAEDVNRMVDEPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLADAHDKNIVMY
    CTGGIRCEKASAYMLHHGFKNVYHIEGGIIEYVRQAKSRGL
    PLKFIGKNFVFDERMGERVSGDVIAHCHQCGEPCDTHVNCKNQGCHLLFIQCPACAEKYAGCCSDVCQDEIRLPLEEQRQ
    RRKNREASMKIFNKSKGLLNAALGIPAPEEKKN

    >gi|251789266|ref|YP_003003987.1| Peroxiredoxin [Dickeya zeae Ech1591]
    MSNDIYAIPLQTIDGRQTTLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAVLGFPSNEFAGQEPGSNEEIS
    AFCRGTFGVQFPMFGKIAVNGSERHPLYQALTQAQPQALRPQGSEFYERRVSKGQAPVHPGDILWNFEKFLINRRGEVIA
    RFSPDMTPDDSVIIKAVEQALAQ

    >gi|251789270|ref|YP_003003991.1| protein of unknown function UPF0061 [Dickeya zeae Ech1591]
    MPHHLLFNNHYHQQLPGFYTELTPTPLHGARLLYYNAPLAETLGLSADYFEGDNRRIWSGEKTLPGMAPLAQVYSGHQFG
    VWAGQLGDGRGILLGQQQLADGRTQDWHLKGAGLTPYSRMGDGRAVLRSVVREFLASEALHHLNIPTTRALTIVTSDHPV
    QREQEERGAMLLRVADSHVRFGHFEHFYYRREPEKVRQLAEYVIACHWPHWQQETDRFYLWFNDVVERTARLIAHWQAVG
    FAHGVMNTDNMSILGLTIDYGPFGFMDDYQPGYICNHSDHQGRYAFDNQPAVALWNLHRLAQSLSGLMSADKLQQALNRY
    EPALMQRFGELMRAKLGFTTPLAQDNDVLVGLLQLMTREQADYSHIFRLLSETEQHSRHSPLRDVFIDRAAFDEWFSLYR
    QRLMLESTDDAVRQQQMKLANPRYILRNYLAQQAIERAETGDVGLLARLHQTLCQPYDDQPERADLAGLPPDWGKHLAIS
    CSS

    >gi|251789305|ref|YP_003004026.1| FeS assembly scaffold SufA [Dickeya zeae Ech1591]
    MQTHDDIDTFSLDEQVWQGLTLTDSAVAHIRSLMRRDESVQGIRLTVKQSGCAGLGYVLELVHQPDPTDQIYQHEGARLF
    IPLKAMPFLDGTEVDFVQEGINQVFKFNNPKARHACGCGESFGL

    >gi|251789329|ref|YP_003004050.1| glutaredoxin-like protein [Dickeya zeae Ech1591]
    MTTTTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LVGGCDIVIEMYQRGELQQLIKETADKYRSQQPEQQ

    >gi|251789378|ref|YP_003004099.1| Redoxin domain protein [Dickeya zeae Ech1591]
    MSTNVHFQGNPVPVAGSFPAAGSKAPAFSLVAKDLADVALSHYAGKRKVLNIFPSIDTGVCAASVRKFNQLASSLDNTVV
    LCISADLPFAQSRFCGAEGLNNVVVLSTLRGAEFKENYGVAIAEGALKGLTARAVVVLDENDDVLHSELVNEITNEPDYD
    AAIAVLK

    >gi|251789608|ref|YP_003004329.1| Disulphide bond formation protein DsbB [Dickeya zeae Ech1591]
    MLRFLNRCSRGRGAWLLMAFTALVFELVALYFQYVMMLKPCVLCIYQRTALYGVMAAGLVGAIAPGSALRYPAIGLWIYS
    AWEGLSLAIKHTNIQLNPSPFVT
    CDFFVSFPSWLPLDKWLPAIFTATGDCSERQWSFLSMEMPQWMIVIFGAYLLVAVLV
    LIAQPFRPKRRDLFGR

    >gi|251789686|ref|YP_003004407.1| methylated-DNA/protein-cysteine methyltransferase [Dickeya zeae Ech1591]
    MQTFLFDSLSTPIGELLLITDENYHLRAVEWREYEEKLYQSLNKRYRHDPFVLKACNNPGKLTDTLRAYFAGDLTIIDAL
    PVAAAGTDFQQRVWQALRTIPCGSTTTYGELAARLGQPGAARAVGLANGSNPVSIVVP
    CHRVIGSQGTLTGYAGGIHRKH
    WLLTHEGYLPQQDLFNPRR

    >gi|251789755|ref|YP_003004476.1| electron transport complex, RnfABCDGE type, A subunit [Dickeya zeae Ech1591]
    MSEYVLLFVGTILVNNFVLVKFLGLCPFMGVSKKLEAAIGMGFATTFVMTLGSVFSWLVNTYVLLPLNLLYLRTLAFILV
    FAVVVQFTELAVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLSVNQSHNFLQSTLYGFSAAVGFSLVLVLFAALRERLAV
    ADVPAPFRGSSIALVTAGLMSLAFMGFTGLVKL

    >gi|251789756|ref|YP_003004477.1| electron transport complex, RnfABCDGE type, B subunit [Dickeya zeae Ech1591]
    MTTIWIAIAALSALALVSGLVLGFASRRFRVEADPVVEQLEAMLPQSQCGQCGYPGCRPYAEAIALNGEQINKCVPGGEP
    LMIKLAERLNIEPQPLDAGTPQKPEPQVAWIDEENCIGCTKCIQACPVDAIIGSTRAVHTVIRDLCTGCNLCVAPCPTDC
    IELRPLAPTTTSWKWNLDAIPVRVIQAENRVIENHV

    >gi|251789760|ref|YP_003004481.1| electron transport complex, RnfABCDGE type, E subunit [Dickeya zeae Ech1591]
    MNPMKELAQQGLWKNNSALVQLLGLCPLLAVSSTATNAIGLGLATTLVLICTNIAVSALRRWVPGEIRIPIYVMLIASVV
    TIVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNTVVLSALDGLFMGLGATSALFVLGAMREILGNGTLFDG
    ADLLLGSWARLLRVEVVHMDSPFLLMILPPGAFIGLGMMLAVKYVIDERRKQRQARAVRSASLGSHTLAE

    >gi|251789815|ref|YP_003004536.1| methionine-R-sulfoxide reductase [Dickeya zeae Ech1591]
    MTKTTVFQRNLDELTDLQRHVTQQRGTESPYTGKLLHNKRTGVYHCLCCHQPLFYSDDKYDSGCGWPSFDRPVSANAIRY
    LDDYSHHMHRIEIRCSQCDSHLGHVFPDGPQETTGERY
    CVNSVSLSFIDAEDDQQTDG

    >gi|251789877|ref|YP_003004598.1| glutaredoxin, GrxB family [Dickeya zeae Ech1591]
    MKLFVYEHCPFCVKARMIFGLKRLPVELHVLSNDDETTPISMVGQKVVPILQKDDGSYMPESLDIVKYVDELDGKPVLTG
    PTNPAIDAWIRRVYEYAPRLLIPRFSRADFDEFATNAGRNYFIHKKEGQIGSFDTHFSQSAELISQLESDLQALVPLIVS
    PQACNGTLSLDDINLFALLRSLTIVADVNVPASVAAYCDTLSQNANVDLLLEQAQ

    >gi|251789961|ref|YP_003004682.1| thioredoxin reductase [Dickeya zeae Ech1591]
    MSTAKHRKLLILGSGPAGYTAAVYAARANLNPLLITGMEKGGQLTTTTEVENWPGDPDDLTGPLLMERMHAHAAKFNTEI
    VFDHITRVDLQTRPFRLFGDSDEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRAEKILIDRLMAKVSSGNIVLHTNRTLDEVVGDEMGVTGVRLREAAGDATEQLDVAGVF
    IAIGHSPNTAIFGDQLALENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDALAG

    >gi|251789989|ref|YP_003004710.1| glutaredoxin, GrxA family [Dickeya zeae Ech1591]
    MYAVIFGRPGCPYCVRAKELAEKLTEERDDFNYRYVDIHAEGITKADLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAR
    ENLFQ

    >gi|251790049|ref|YP_003004770.1| Glutathione S-transferase domain protein [Dickeya zeae Ech1591]
    MSTHDLTLISHPLCPFVQRSAIVLLEKNVPFERVNVDLSAKPDWFLALSPTGKVPLLKVRQANGEDAIIFESMVICEYLN
    ETQDGNSMYADDALVRARQRAWIEFSTSMLGNAWQFLNATDQAIADSKRAVFREQLERIESELSLGPYFSGAEFSMVDAV
    YAPIFRYFSIIDASVSEAIFEGLPRTCAWITALAKRESVKAAVSSDYAELFQNHLRQHSAILAA

    >gi|251790052|ref|YP_003004773.1| Peroxiredoxin [Dickeya zeae Ech1591]
    MTPFHQLTATSLSGQLIAMADYAGKVVLVVNTASHCGFTPQYGGLEALYQKYAAQGLVVLGFPCNQFGKQEPGNADEIAQ
    TCHINYGVSFPMFEKVDVNGTTAHPVFRYLKNELPGVLGGRIKWNFTKFLIGRDGKPLKRFAPFTTPEKMEATILAALEI


    >gi|251790059|ref|YP_003004780.1| arsenate reductase [Dickeya zeae Ech1591]
    MTEITIYHNPACGTSRNTLALIRNSGVEPNVIHYLETPPSRAELEGLISAMGITPRMLLRQNVEPYSELGLAEDNFSDEQ
    LIAFMLTHPILINRPIVVTPLGTRLCRPSEVVLDILPDAQQGVFIKEDGEQVVDKFGKRIKLN

    >gi|251790146|ref|YP_003004867.1| molybdopterin synthase sulfurylase MoeB [Dickeya zeae Ech1591]
    MLPELTDEETLRYNRQIVLRGFDFDAQERLKAAQVLIVGLGGLGCAASQYLASAGVGQLTLLDFDTVSLSNLQRQVLHRD
    DRIGMPKVESARLTLEHINPHVRITPVQDNLEDDALRALVAQHDVVVDCTDNVSIRDRLNHVCFMQKIPLVSGAAIRMEG
    QISVFTYQPEEPCYRCLSRLFGDSALT
    CVEAGVMAPLVGVIGSLQALETIKLLAHYGQPLAGKLLLFDAMTMQFREMRLS
    KNPGCDTCGQAT

    >gi|251790217|ref|YP_003004938.1| Thioredoxin domain protein [Dickeya zeae Ech1591]
    MGHPSVYPTGTTIYHPDKAWGGYTVFQALETGAVLIDMNGAALRLWEGLHGFPNKILPGGYILGHSGQRDARYGMQDMVD
    VVQLDWDGNRVWHFNRYEHIHDPDLPPEWMARAHHDYQRSGNPVGYYAPGLEPQALGGNTLILAHQNLHNPKISDKLLLD
    DTIIEVDWQGNILWEWRCSDHFDELGFDDAAKTALYRNPNMRSSGGGMGDWMHINSMSALGPNPWFDQGDTRFHPDNIIW
    DARESNIIAIIDKQSGNIVWRLGPDYSTPELKHLGWIIGQHHAHMIPAGLPGAGNILLFDNGGWAGYGAPNPASADGVKN
    AWRDYSRVLEINPVTLDIVWRYSPYEAGIPHPTDAFRFYSPYISNIQRLPNGNTLINEGANGRLFEVTADHEIVWEYISP
    FWGQSVNTNMLYRAYRVPYDWVPQLPRPQETPVQAPDNTRLRQPGAAPAGFASVISVSDTRPYKRGGDALCVATDSEELK
    RSPKLFAVNRSRFTALSLAPDETLSLPAGNQLLLVGAER
    CVHCKSLYRQLETVIADAAFSGLPCTYLDADHHLTQAAQLQ
    VRSLPTLLWLKDGQEQARLTGAQSTDALRQWLLAVLS

    >gi|251790555|ref|YP_003005276.1| arsenate reductase and related [Dickeya zeae Ech1591]
    MAITLYGIKNCDTIKKARRWLEDHHIDYRFHDYRVDGLTAERLQSFIDNIGWQPLLNTRGTTWRKLEDAYRNTINSEAAA
    KAVMLEHPALIKRPLLVSDDGKTLLAFSDDSYRHFFTENTSHVLPGN

    >gi|251790566|ref|YP_003005287.1| Peroxiredoxin [Dickeya zeae Ech1591]
    MTTLKAGDIAPKFSLPDQDGEQVNLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKFGVEVLGISTDKPEKLSR
    FAEKELLNFTLLADEDHQVAEQFGVWGEKTFMGKTYDGIHRISFLINAEGHIEKVFDDFKTSNHHDIVLNYLKDA

    >gi|251790568|ref|YP_003005289.1| arsenate reductase [Dickeya zeae Ech1591]
    MSQSVTIYHNPRCSKSRETLALLQQQGIEPQVVLYLDTPPDAATLSQLITQLGFAGARELMRRKDDLYRELNLDDDSLSE
    AQLIDAMVTHPKLIERPIVIANGRAKLGRPPEQVLDIL

    >gi|251790587|ref|YP_003005308.1| Thioredoxin domain protein [Dickeya zeae Ech1591]
    MLEQHANVIDINETNLHQVLEHSMSAPVLFYFWSNRSAHCQQLEPVLDKLAAEYAGQFILAKVDCDAEQRVAAQFGLRAI
    PTVYLFKDGQPVDGFQGPQPEEVIRDLLQRVLPKAEDLKLAQAQQLIQENQLKEAAVLLKDAWQLDAKRSDIALLLAEVQ
    IQLNRTDEAQAVLDTIPLQDQDTRYHGLVAQIELMKQAADTPEIQQLQQQLAASPDNQELAVQLSLQLHQVGRNEEALEL
    LMGILKKDLAAANGNARKTLMDIMAALGTGDALAARYRRQLYSLLY

    >gi|251790607|ref|YP_003005328.1| copper-translocating P-type ATPase [Dickeya zeae Ech1591]
    MSQTILLSLQGLSCQHCVGRVKKALESRADVEQVEVSLKYAKITGEADSQTWVATIEAAGYEASPATEPNITLQLSGLNC
    QHCVASTRKALETIPGVIGVDVTLQQASIYGDADPQALVAAVEQAGFHATQTQELSSPKSEPLTPHASSPDRLSAAFNQV
    PAHTLPVNAVFADAAPNHNYADNDHIVDSIEGTDSVQLLLDGMS
    CASCVSRVQQALQRVPGVTQAHVNLAERSALVSGSM
    SHQALIEAVRNAGYGAEIIIDEAERRARQEQTSRQAIRRFRWQATLGLALGIPLMVWGMIGDNMMLTDNNRTGWLLVGVL
    TLAVMIAAGGHFYRNAWRSLMNGSATMDTLVALGTGAAWIYSITVNLWPSGFPMEARHLYYEASAMIIGLINLGHALEQR
    ARQRSSQALERLLDLTPPTARQVTLQGDRVIPLAEVHTGMTLRLTTGDRIPVDGTLEQGELWIDEAMLTGEPIPQQKATG
    DKVHAGTQVQDGSATFRADAIGNQTTLARIIHLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWYMFGPAPHIV
    YTLVIVTTVLIIACPCALGLATPMSIISGVGRAAELGVLVRDADALQQASRLDVLVFDKTGTLTEGKPRVVAIHTFGDVS
    ESQALNWAASLEQGANHPLAQAIVQRADGITLSTVAQFRTLPGLGISGQVEGTSLLLGNPALLDQYQIPLADGENSPHYW
    LEKQSAQGITPVLLAANGQVAALFSIQDTLRQDSVSALQRLHRQGYQLVMLTGDNAGTAQAIAREAGIDQVIAGVLPDGK
    AEAIRHLQSQGKRVAMIGDGINDAPALAQADVGIAMGSGSDIAVETAAMTLMRHSLHGVADALALSRATLGNMKQNLLGA
    FIYNTLGIPLAAGILYPLTGTLLSPVVAGAAMALSSITVVSNANRLLRFTPSDAPARQG

    >gi|251790680|ref|YP_003005401.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dickeya zeae Ech1591]
    MVLVTRPAPDFTAAAVLGSGEIVENFNLKKHINGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVDNGGIGEVKYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGIVRHQVVNDLPLGRNIDEMVRMVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLKENANNL

    >gi|251790995|ref|YP_003005716.1| thiol:disulfide interchange protein DsbC [Dickeya zeae Ech1591]
    MKKRVVLFSLLTLALSSVARADDAAIKQTLNRLGIQNAEVKDSPISGMKTLLTENGVLYITDDGKHLLQGPLYDVSGKDP
    VNVTNHILNDRLNALKDQMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEQMKDYNALGITVRYLAYPRQGMNSQAAKDMQSI
    WCVADRNKAFDAAMKGDEVSPATCKTDIAPHYQLGILFGIQGTPAIVLSDGTVVSGYQPPKEMARMLEAHKASLKSGG

    >gi|251791104|ref|YP_003005825.1| cytochrome c biogenesis protein transmembrane region [Dickeya zeae Ech1591]
    MAQRILTLTALCLSLFFSTLVTAQNPFGRSAQSQFLPVDQAFAFDFQQRGDQLTVDWQIHPGYYLYRQQIKLDSALIAPP
    GVTLPPGESHRDEFFGEVAIYRQSLTLTIPLRDVPPGASLSITYQGCADAGFCYPPETRSVPLSAISSGTPAAPAVITPQ
    PDRTHTPQLPFSPFWALLIGIGVAFTPCVLPMYPLISGLILGRQQRLSTGRTLLLTLVYVQGMALTYTLLGLVVAAAGLR
    FQAALQHPYVLIGLSVMFAALALSMFGVYSLQLPSSLQTRLTLWSNRQQSGSATGVFAMGALAGLICSPCTTAPLSALLL
    YIAQSGNLLAGGGSLYLYALGMGLPLMAITLFGNRLLPKRGPWMNHVKEGFGFVILALPVFLLGRVLGEVWEWRMWALLG
    VAFFGWAFTLSLRSHAGGMRAVQILLFLGALLAARPLQDWLFAPAQPQPASAGQLHFTSANTLDELTTALGRSDNRITML
    DLYADW
    CVACKEFEKYTFRDATVQQSLSAMQRLQADVTANNETQRALLQHLNVLGLPTILFFDASGREIPGSRVTGFMDA
    AAFAAHLQTLKP

    >gi|251791131|ref|YP_003005852.1| heavy metal translocating P-type ATPase [Dickeya zeae Ech1591]
    MSEKHSSTSARQFHPVAQGKPGKALFRPQPQAHAVPEQAPHRHEQAPKDQSCAHHCCDKATPTVPVSALAAAERTGDQQR
    TPIRIMQMD
    CPTEETLLRKKLDTLPEVSALEFNLMQRVMTVTHHYDGLDKVLAAIRSLGFEPEIRTGNAREPLPPEPKKS
    WWPLGLAVVAAGAAEAVEWSALPEWWAAVLAILAVASSGLTTYRKGWIALRTGNLNINALMSIAVTGALFLQQWPEAAMV
    MVLFTLAEHIEARSLDRARNAIAGLMNLAPDTATVQQPDGSWRDQEANTVTPGSIVRVRPGERIALDGDITRGHSAVNQA
    PITGESLPVDKRVGDSVFAGTINESGSFEYRVTAAAANTTLARIIHAVEQAQGTKAPTQRFVDQFARVYTPLVFLGALLV
    AVLPPLFTGGSWLEWTYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGVFLEKGHALSWLALDKTGTLTHGK
    PVQTGFEAVADLDEAHCRQLAASLAGRSDHPVSQAVARAAQDAGTPLIDVDNFSAVAGQGVIGTLQGQRYFLGNLRLARE
    RLGETAEGIVGRLTTLEQAGNTTIILGDEQRVLALMAVADTVKPSSQEAINALHQAGIKTLMLTGDNQHVAQAIAREVGI
    DEARGNLLPEDKLSQIERLSAQGVTGMVGDGINDTPALARADIGFAMGAMGADSAIETADVALMNDDLRKIPEFVRISKS
    TRIILIQNIALALGIKALFLALTLLGLGTMWMAVFADVGASLLVVGNGLRLLRLSPVAAHQPHSA

    >gi|251791140|ref|YP_003005861.1| alkyl hydroperoxide reductase, F subunit [Dickeya zeae Ech1591]
    MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRALLIEIAGLSDKVSFFENNELPVRKPSFLVTNPGAANGPRFAG
    APMGHEFTSLVLALLQTGGHPSKEAKELLDQIRDLDGKFHFETYYSLT
    CHNCPDVVQALNLMSILNPNVTHTAIDGGVFQ
    DEIKDRNIMGVPTVFLNGEHFSQGRMSLAEIVGKVDTGATARVVDKLNSRPVYDVLIVGSGPAGAAAAVYSARKGIRTGL
    MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPGQPHQIETASGAVLKSRSIII
    ATGARWRNMNVPGEDQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKL
    RSLPNVDVIVNAQTTEVLGDGQKVTGLQYKDRTTDSIHKLALEGIFVQIGLLPNTGWLEGAVERNRIGEIEIDARCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA

    >gi|251791141|ref|YP_003005862.1| peroxiredoxin [Dickeya zeae Ech1591]
    MSVINTKVKPFKNQAFKDGQFIEVTEQNIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQKIGVDIYSVSTDTHFTHK
    AWHSSSDTIAKIKYAMIGDPTGALTRNFENMREDQGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|251791223|ref|YP_003005944.1| Rhodanese domain protein [Dickeya zeae Ech1591]
    MSAIEQLAYYQKKLSFETDSWDLYLALKNGENVVVVDGRSKEAYQREHIPGALHVPHKEICFNNTAELDKSKIYVCYCDG
    IG
    CNASTKTAMKLLVLGFQVKELIGGLDWWKRDGYATEGEKGQDGTSVSCGCQ

    >gi|251791430|ref|YP_003006151.1| UBA/THIF-type NAD/FAD binding protein [Dickeya zeae Ech1591]
    MLDDQAFMRYSRQLLLEDIGQEGQQKLTNSRVLLVGLGGLGSPAALYLAAAGVGTLLLADHDTLHISNLQRQILYRNADL
    SHPKAALARHALEAINPLVKTVALTTRLEGESLATAVAQADLVLDCCDNMTTRHAVNAACVTAQKPLISASAVGFSGQLL
    VLTPPYPHGCYACLYPDATEPQRN
    CRTAGVLGPVVGVMGTLQALEAIKLLCGLPSPLDGKLRLFDARRQQWTTLQLARSA
    TCPVCRGRA

    >gi|251791462|ref|YP_003006183.1| protein of unknown function DUF395 YeeE/YedE [Dickeya zeae Ech1591]
    MAAFTPLMSLTGGLVIGVAVVMLAVFCGRVAGISGILGGLLNRSSPDKGWRLAFVLGMIAAPWLYQLAAPLPESTISTST
    LWLAVSGLLVGIGTRYGAG
    CTSGHGVCGLSRLSLRSLVATLTFMGAAFATVWALGAFR

    >gi|251791499|ref|YP_003006220.1| Rhodanese domain protein [Dickeya zeae Ech1591]
    MQEIMPFISRHPILSVAWIALLVAVIVLTVKSKLSKVKEVARGEAIQLINKEDAVVVDTRNRDDYRRGHIAGAINLLPND
    IKNGSLSELEKHKAQPVIVV
    CANGMASRESAENLFKAGFERVMILKDGLAGWSGENLPLVRGK

    >gi|251791719|ref|YP_003006440.1| DSBA oxidoreductase [Dickeya zeae Ech1591]
    MKRLWLALAGIVLAFSASAADFSDGKQFATLSKPAPQSPQVLEFFSFYCPHCYQFSQVYHVPEAIQKSLPADTKVTKYHV
    DFLGDFGKEMTQAWAVAIALGVEDKVSPLMFDAVQKTQTVKKPEDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAA
    ADLQLRGVPAVFVNGKYMVKSDGLDTSSMDNYVKQYADVVKFLVSQK