Dickeya dadantii Ech703 uid59363

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|242237473|ref|YP_002985654.1| glutathione-disulfide reductase [Dickeya dadantii Ech703]
    MTKHYDYLAIGGGSGGIASINRAALYGKKCALIEAKHLGGTCVNVGCVPKKVMWHAAQIAEAIHQYGPDYGFDVTVNRFD
    WSTLLKNRSAYIDRIHQSYHNVLGKNQVEVIHGFARFVDAHTVEVNGERITADHILIATGGRPTRPEIPGAEYGIDSDGF
    FALQAQPTRVAVVGAGYIAVEIAGVLKALGSEVHLFVRKHAPLRQFDPLIVETLVEVMNTEGPTLHTESIPKAVVKNADG
    SLTLQLQNGHEQTVDCLIWAIGREPATDNLNLDAAGVARNAQGYIPVDQFQNTNVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPGEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPEE
    RIVGVHGIGFGMDEILQGFAVAVKMGATKQDFDNTVAIHPTAAEEFVTMR

    >gi|242237479|ref|YP_002985660.1| methylated-DNA/protein-cysteine methyltransferase [Dickeya dadantii Ech703]
    MFDLPDDDELYRALIARDPTWEGFAYVGVKSTGIFCRLSCAARKPKRENVQFFSSVATALEAGFRPCKRCRPLMAKGDEE
    GSIVATLTAALEKQPEKLWSESDLIAMQMDPSTVRRTFKRQFGITFLEMARLRRLAKGITTLSFGEDVISAQLDASYESG
    SGFRSAVIRHLGISPSQARRHRLLKAAWIDTPIGTMLAVADEHALHLLEFVDRKGLPGELEKLKQHTASNIIMGTLPVIE
    HLREELRDYFAGRRFRFETPLAQHGTLFTRRVWDALSAIPYGTVESYRTLATRVGNTAACRAVARANGANPLAIVVP
    CHR
    VIGADGSLTGYAGGLWRKKWLLEHERRTRPDDAPSGDVTA

    >gi|242237486|ref|YP_002985667.1| uncharacterized peroxidase-related enzyme [Dickeya dadantii Ech703]
    MSFSTQDILQQLAEIAPNTDLAQARTVRDAATRHTQGSHEALFSASASGNLTPALRFLLAEKISGWHQDSVLQRFYAERL
    ADFPVPADSDALQLALAHAERLTFRPATATHEHLHALLQAGWITDDIVTLSQLTAFVSFQSRLLRGFRLLAGQPVAETDT
    VAVAAGAWHTQALTHNGKPAPLAFTQEELAWEPWIPAKPLAEFSAAEQAVLAKFGHTHSDYFRLLGRNQPVLEQRTLTDK
    GIFYTSGGLPRAERELAAAVASKVNGCIY
    CASVHARKASQLAKRHDAVQRLLAVAPGGDLSVEQEPRWQAIIDVAARLSV
    TPAQLNPQDIERLRQQGLSTLEILDLIQSAAFFAWANRLMLTLGEPFQPQG

    >gi|242237637|ref|YP_002985818.1| Rhodanese domain protein [Dickeya dadantii Ech703]
    MQEIMPFISKHPILSVAWIALLVAVIVLTVKSKFSKVKEVARGEAIQLINKEDAVVVDLRNRDDFRRGHIANAINVQPND
    IKNGSLGELEKHKAQAIILV
    CANGMASREAGENLYRAGFERVLTLKDGLAGWSGDNLPLVRGK

    >gi|242237661|ref|YP_002985842.1| thioredoxin [Dickeya dadantii Ech703]
    MSDKIIHLTDGSFDAEVLQAEGPTLVDFWAEWCGPCKMIAPILDEIADEFEGKLTVAKLNIDENPATAPKYGIRGIPTLL
    LFKNGELAATKVGALSKGQLKEFISHNL

    >gi|242237747|ref|YP_002985928.1| Thiosulfate sulfurtransferase [Dickeya dadantii Ech703]
    MEQFEAIDIEQAYQRWQRGNVLVDIRDLQSFGAAHVPGATHLTNETLSDFVRGADLEQPVLVMCYHGISSRNAAQYLISL
    GFDAVYSVDGGFEAWRQRFPQEVAAG

    >gi|242237804|ref|YP_002985985.1| glutathione S-transferase [Dickeya dadantii Ech703]
    MNESRSICVLWLLEAAHIPYELIIYQRNQDNPLAPDTLKATPPLGKSPELEDNGEIIVESGAIVEYWIKRYASQFAPAEH
    SEDNIAYLQWIRCAESAAMTPMLFILFNGTLSQPCHPSRAYFSS

    >gi|242237972|ref|YP_002986153.1| OsmC family protein [Dickeya dadantii Ech703]
    MSIEKVLYVAHAQANGGRDGRAVSSDSQLDVRLTTPRELGGAGGEGTNPEQLFAAGYSACFLGALKFVAARDKVAIPADT
    AINGSVGIGVIPNGFGIEVELKISLPGLDRAVAEDLVQKAHIV
    CPYSNATRGNIDVTLTLI

    >gi|242238042|ref|YP_002986223.1| hydroxymethylbutenyl pyrophosphate reductase [Dickeya dadantii Ech703]
    MKILLANPRGFCAGVDRAISIVERALEVYGAPIYVRHEVVHNRYVVDGLRERGAIFIEQIDEVPDGAILIFSAHGVSQAV
    RAEARNRDLTVFDAT
    CPLVTKVHMEVARASRKGMEAILIGHAGHPEVEGTMGQYSNPKGGMYLVEGPDDVWSLQVKNETN
    LCFMTQTTLSVDDTSAVIDALRARFPQIIGPRKDDICYATTNRQEAVRNLAQEADVVLVVGSKNSSNSNRLAELAQRVGK
    PSYLIDSADDIQESWFSRTACVGVTAGASAPDVLVQQVVKRLQGMGGQIALEMQGREESIVFEVPKELRVEVRQVE

    >gi|242238128|ref|YP_002986309.1| dihydrolipoamide dehydrogenase [Dickeya dadantii Ech703]
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQ
    TDIDKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGFGKFTGPNTLVVEGENGSTTVNFDNAIIAAGSRPIQLPFIPHDDA
    RVWDSTDALELKSVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDERGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAVFPWAASGRAIASDCSDGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|242238272|ref|YP_002986453.1| peptide methionine sulfoxide reductase [Dickeya dadantii Ech703]
    MTHFDKTRIVSQAEALPGRITPMPVARLHVVSQHSMTHVPAQMEVALFAMGCFWGAERLFWQQPGVYSTAAGYSGGYTPN
    PTYREVCTGQTGHAEVVRVVFDPAEISYSQLLQLFWESHDPAQGMRQGGDIGTQYRSAVYTTTPAQTSAAEESRRRFQQA
    MRDAGDLRAVTTEVKPAGPFYYAEDEHQQYLHKNPHGYCGLGGTGVCLPPAG

    >gi|242238336|ref|YP_002986517.1| thioredoxin [Dickeya dadantii Ech703]
    MNTVCPACHTTNRLSEARLNDNPHAKCGRCGQALFSGAVINATEHTLDKLLQDDLPVVVDFWAPWCGPCVNFAPIFESVA
    QENGGKLRFVKVNTESEPALSARFRIRSIPTIMLFRQGKPVDILNGAMPKAPFENWLNESL

    >gi|242238477|ref|YP_002986658.1| copper-translocating P-type ATPase [Dickeya dadantii Ech703]
    MSQTVLLSLQGLSCEHCVGRVKKALESRPDVEKADVSLTYANVTGEVGSSALIDTIVQAGYEASPATTPDTTLSLSGLNC
    QHCVASTRKALEAVAGVSAVDVSLEQARIYGSADAQTLVSAVEQAGFHAAPAEASSLPKSEPLAPTDASPEHLSAASATH
    PANTVSGNDDDSVQLLLEGMS
    CASCVARVQQALQNVPGVTQARVNLAERSALVSGNAPHQALISAVENVGYGAEIILDEA
    ERRTRREQTAQAAMRRFRWQAALGMLLGIPLMLWGLFGDGMMLTDSNRAGWLAIGVLTLAVMAIAGNHFYRNAWRSLRNG
    SATMDTLVALGTGVAWLYSITVNLWPDKFPMEARHLYYEASAMIIGLINLGHALEQNARQRSSQALERLLDLTPPTARLV
    TPQGDRQIPLSEIQAGMRLRLTTGDRVPVDGCIEQGELWLDEAMLTGEPLPQQKNGGDTLHAGTQVQDGSAIFQAQAIGN
    QTTLARIIRLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWYAVGPEPRLVYTLVIATTVLIIACPCALGLATP
    MSIIAGVGRAAELGVLVRDADALQQASQLDVLVFDKTGTLTEGKPRVVAIHTFGGASEQQVLAWAASLEQGASHPLARAI
    VERAQGVPLHIIETFRTLPGLGISGQCGTVELLLGNPALLTQHGINLTAPTGERSPQQSLEQLAQQGITPVLLAADNNVV
    ALFAIQDTLRQDSIPALKRLHRQGYQLVMLTGDNPATAHAIAQVAGIDQVIAGVLPDGKADAIRQLQAGGRKVAMIGDGI
    NDAPALAQADVGIAMGGGSDIAVETATMALMRHSLQGVADALELSKATLGNMKQNLLGAFVYNSLGIPIAAGLLYPFTGT
    LLSPVVAGAAMALSSITVVSNANRLLRFSPGAR

    >gi|242238498|ref|YP_002986679.1| Thioredoxin domain protein [Dickeya dadantii Ech703]
    MLEQHANVIDINETNLHQVLEQSMSAPIMFYFWSDRSAHCQQLGPMLDKLAAEYAGQFVLAKVNCDIEQRVAAQFGLRAI
    PTVYLFKDGQPVDGFQGPQPEEVIRDLLQQVLPKPEDVKLAEAQQHIQENQLPEALTLLKDAWALAPKRSDIALLLAEVQ
    IQLNRADDAEAVLAAIPLQDQDTRYHGLVAQIELMRQAADTPEIQQLQQRLDADPQNAELVVQLGLQLHQVGRNEEALEL
    LMGLLKTDLSAADGAVRKTLMDIMAALGTGDALAARYRRQLYSLLY

    >gi|242238514|ref|YP_002986695.1| arsenate reductase [Dickeya dadantii Ech703]
    MNKHIVIYHNPRCTKSRETLALLKQQDIEPEIILYLETPPDAATLTALIKQLGFHSARDLMRQKEDLYRELKLADNALTE
    TQLIDAMVQHPKLIERPIVVVGQQARIGRPPESVLEIL

    >gi|242238516|ref|YP_002986697.1| Peroxiredoxin [Dickeya dadantii Ech703]
    MNTLKAGDIAPTFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDDLKKHGVEVLGISTDKPEKLSR
    FTEKELLNFTLLSDEDHQVAEQFGVWGEKSFMGKTYDGIHRISFLIDANGAIENVFDDFKTSNHHDVVLDYLKGA

    >gi|242238527|ref|YP_002986708.1| arsenate reductase and related [Dickeya dadantii Ech703]
    MAITMYGIKNCDTIKKARRWLENNHIDYRFHDYRTDGLDDKLLQSLIALAGWQALLNTRGTTWRKLDEAVRITIDNESAA
    KTVMLEHPSLIKRPLLVTHDQQTLLGFSEESYQHFLTENK

    >gi|242238628|ref|YP_002986809.1| Rhodanese domain protein [Dickeya dadantii Ech703]
    MLIDASTLRRRLAAGEKFDLIDVRDHADWQQATLPNAHHLNVYDYFIPDATEAGVQQMAASFLHAWRQLPRRPDAIPVFF
    EQQVGMRSPRGVWFCELTGERSMLLDGGLDAWRLAGGTVLPGQGISAVVSASRHLPLPVDFRRECTATRDEVIRADGVTT
    VILDARRPAEFDGSFVHPCCPRAGRIPGATLLFWEDMVQDGRFLPPEEIARRAQAAGLQPHQRIIAY
    CHRGARAATVTTA
    LRLAGYTRLAVYVGSWHEWAEHEELPLQRGEPTDAGPQA

    >gi|242238794|ref|YP_002986975.1| Thioredoxin domain protein [Dickeya dadantii Ech703]
    MGHPSVYPTGTTLYNPDKAWGGYTVFQALETGAALIDMNGNELRLWEGLHGFPNKILPGGYILGHSGQRDSRYGMQDMVD
    LIQLDWDGNKVWEFNRYEYISDPELPPEWMARAHHDYQRSGNPVGYYAPGLEPQALGGNTLILAHKNLHNPKISDKLLLD
    DTIIEVDWQGNLLWEWRCSDHFDELGFDDDAKTALYHNPNMRNSGGGMGDWMHINSMSALGPNPWFDQGDTRFHPDNIIW
    DARESNIIAIIDKQTGNIVWKIGPDYRTPELKHLGWIIGQHHAHMIPAGLPGAGNILVFDNGGWAGYGAPNPASADGVKN
    AWRDYSRILEINPVTLDVVWRYSPYEAGIPHPTDAFRFYSPYISNIQRLPNGNTLINEGANGRIFEVTPDHEIVWEFISP
    YWGKSVNTNMLYRAYRVPYDWVPQLPRPQETAIQAPDNTRFRQPGAGQPGFARVVKVDGVRPFKRGGDALCVATDNESLK
    RSPKLFAVDRERFAPLAVSADNGLPALPGRRLLLVGAER
    CVHCKGLYRQLERVVDDPAFRALAGHYLDADSHIALTAQLG
    VKSLPTLLWLNDGQEQARLTGAQSAEQLRRWLTTLAERSR

    >gi|242239014|ref|YP_002987195.1| Rhodanese domain protein [Dickeya dadantii Ech703]
    MPVLHNRVSNEELKARMLAETEPRTTVSFYKYFSLDDPQSFRDALYIALVDLKVFGRIYIAREGINAQISVPASHFERFR
    CTLFAAHPALVGIRLNVALQDDGKSFWVLRIKVRDRIVADGIDDPSFDPCKVGQYLNAAEVNRMAADPDTLFIDMRNHYE
    YEVGHFEHAIEVPSDTFREQLPMAVDMLAREKDKNIVMY
    CTGGIRCEKASAYMRHNGFKHVFHIEGGIIEYVRQANALGL
    PVKFIGKNFVFDERMGERVSEDVIAHCHQCGEPCDTHTNCRNQGCHLLFIQCQSCAEKYKGCCSQECLDETALPPAEQRR
    RRQLRESRMNVFNKSRGFMRESLHIPDTDKKS

    >gi|242239064|ref|YP_002987245.1| Peroxiredoxin [Dickeya dadantii Ech703]
    MSNDLYAIPLQTIDGRATTLDSWQNNVMLIVNVASQCGLTKQYEALENLYETYRDRGFVVLGFPSNEFAGQEPGSNEEIL
    AFCRGTFGVQFPMFGKIDVNGAGRHPLYQALIAAQPEAVRPAGSEFYERRVSRGQAPAHREDILWNFEKFLINRRGKVIA
    RFSPDMTPDDGVLVKVIEQVLAQ

    >gi|242239069|ref|YP_002987250.1| protein of unknown function UPF0061 [Dickeya dadantii Ech703]
    MSRHLQFDNHYHRQLPGFYTELQPTPLQGARLLYHSAPLARDLSLDQHWFEGDNQRIWSGEISLPGMAPLAQVYSGHQFG
    VWAGQLGDGRGILLGQQRREDGYTYDWHLKGAGLTPYSRMGDGRAVLRSVVREFLASEALHHLGIPTTRALTIVTSDHPV
    QREQEERGAMLLRVAESHVRFGHFEHFYYRREPERVRQLADYVIAHHWPHLQTDVDKYAVWFGEVVVRTAQLIAQWQAVG
    FAHGVMNTDNMSILGMTLDYGPFGFMDDYQPGYVCNHSDHQGRYAFDNQPAVALWNLQRLAQSLSELIPVAQLQQGLAGY
    EPALMQRFGELMRAKLGFMTADSQDNALLVELLQLMHKESADYSSVFRLLSETEQQSALTPLQDVFIDRPAFDVWFSAYR
    RRLAADGCDDDRRQRVMRQANPRFTLRNYLAQQVIEHAERDDVAPLQRLHQALMHPYDEQPDASDLAVPSPDWGKHLVIS
    CSS

    >gi|242239124|ref|YP_002987305.1| glutaredoxin-like protein [Dickeya dadantii Ech703]
    MTTTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGEL
    IGGCDIVVEMYQRGELQKLIKETAAKHQSQQDDQ

    >gi|242239171|ref|YP_002987352.1| Redoxin domain protein [Dickeya dadantii Ech703]
    MSKNVHFQGNPVPVAGTFPAKGSKAKAFSLVAKDLSDVALSHYTGKRKVLNIFPSIDTGVCAASVRKFNQFAAELNNTVV
    LCISADLPFAQSRFCGAEGLNSVVVLSTLRGDVFKEDYGVAIAEGALKGLTARAVVVLDENDNVLHSELVNEITNEPDYD
    AALAVLK

    >gi|242239299|ref|YP_002987480.1| methylated-DNA/protein-cysteine methyltransferase [Dickeya dadantii Ech703]
    MQTFLSDKLKTPLGELWIIADENYHLRAIEWCEYEEKLYRTLNKSYHRDPFVLLACNNPGGLTARLEDYFSGNLDAIANL
    PVAAVGTEFQQRVWRELRTISCGNTISYGQLAVRLGQPGAARAVGLANGSNPISIVVP
    CHRVIGANGTLTGYAGGIERKR
    WLLAHEGYLPSSDLFDVGH

    >gi|242239347|ref|YP_002987528.1| electron transport complex, RnfABCDGE type, A subunit [Dickeya dadantii Ech703]
    MSEYILLFVGTILVNNFVLVKFLGLCPFMGVSKKLETAIGMGFATTFVMTVASVFAWLVNAYILLPLSLVYLRTLAFILV
    LAVVVQFTELAVRKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNVNQSHNFLQSTVYGFSAALGFSLVMVLFASLRERITV
    ADVPAPFRGSSIALVTAGLMSLAFMGFTGLVKF

    >gi|242239352|ref|YP_002987533.1| electron transport complex, RnfABCDGE type, E subunit [Dickeya dadantii Ech703]
    MTIRELILQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLFCTNATVSALRRWMPAEIRIPIYVMIIASVVT
    IVQMLMNAWAYGLYQSLGIFIPLIVTN
    CIVMGRAEAFAYQNGVLLSALDGLFTGLGATCAMFVLGALREILGNGTLFDGA
    DLLLGSWASALRIEIVHLDSPFLLMILPPGAFIGLGLLLAGKYVIDEKIRQRRASTVRPAPIPGHINGGTQ

    >gi|242239403|ref|YP_002987584.1| methionine-R-sulfoxide reductase [Dickeya dadantii Ech703]
    MFIRCIHQVKLFVYGANNMTKLPLNQRNPETLTEIQRYVTQQRGTEAPFTGKLLHNRRTGVYHCLCCHQPLFESMHKYDS
    GCGWPSFDQPCTTESVRYLDDYSHHMHRIEIRCGHCDAHLGHVFPDGPQDSTGERY
    CVNSASLSFVDAENNQQTDG

    >gi|242239416|ref|YP_002987597.1| Disulphide bond formation protein DsbB [Dickeya dadantii Ech703]
    MLRYLNRCSRGRGAWLLLAFTALAFELIALYFQYGMLLKPCVLCIYQRTAILGIMGAGVVGAIAPGTILRYPAIALWLYS
    AYEGLDLAIKHTNIQLHPSPFVT
    CDFFVSFPSWLPLDKWIPAIFTATGDCSERQWNFLNLEMPQWMIVIFGVYLLIGLLV
    LFAQPFRPKRRDLFSR

    >gi|242239610|ref|YP_002987791.1| glutaredoxin, GrxB family [Dickeya dadantii Ech703]
    MKLFIYEHCPFCVKARMIFGLKSLPVDVTVLSNDDEATPISMVGQKMVPILQKADGGYMPESLDIVRYVDGLDGKPVLNG
    AVNPAIDDWIRQVYLYAGQLLIPRFSRARFEEFATEAGRNYFIHKKEGQIGSFAGHFAQTEALVARLEHDLLALEPLIVS
    ADACNGALSLDDINLFPLLRSLSIVANVAVPPQVAAYRDAMARLSNISLLAGQAQ

    >gi|242239688|ref|YP_002987869.1| thioredoxin reductase [Dickeya dadantii Ech703]
    MSTAKHRKLLILGSGPAGYTAAVYAARANLQPLLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHDHAVKFNTEI
    VFDHINRVDLQQRPFRLFGDSDEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRQQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRAEKILIDRLMAKVDSGNIVLHTYRTLDEVIGDDMGVTGVRLRNTQSDATEQLDIAGVF
    IAIGHSPNTAIFNGQLALENGYIKVQSGTNGNATQTSIPGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDSLNDK

    >gi|242239716|ref|YP_002987897.1| glutaredoxin, GrxA family [Dickeya dadantii Ech703]
    MYAVIFGRPGCPYCVRAKELAEKLASDRDDFSFRYVDIHAEGITKDDLSKTVGKPVQTVPQIFLDEQHIGGCTDFEAYAK
    EHLGLYQ

    >gi|242239769|ref|YP_002987950.1| UBA/THIF-type NAD/FAD binding protein [Dickeya dadantii Ech703]
    MVDHTDTLLQQGIAALRGALGEDAALALLQPVATRADEAASYIFPLPVDYTGAERRLRIGFPRNFPRSGLRLTVEPSPWL
    IWPHAMEVELCLHGFQERPVMGTPEYVVSDSLARLRKIVNLSRMGSCAATRDAEFQREITSYWSRQQGLSLQNLILLDRP
    QAASKLFALSDPRQALPSGQETVWLATDLSSLKKHCRRTIGRSPRMRAPETPGFYAKLQSYPDLRLPAPELLLTWLMPHL
    TPGDSTQLLAWFNERGSLPNRWIALELPGDSNAPIYCLNIRAYGPQLDRGSKFYLRSARRRPAVAVNYPPVLIRATTLDV
    LDRTEILSRDLSGVAQKLEGAHVVCVGVGSLGSTVALQLARSGVGHLTLIDPDHLVSANLGRHVLGADDLGLSKAKALQE
    QIRKDLPTTEVTAFATFAEVVMYKNPEVFDKADLVVVTTADWQSEVALWGAKSNGVSWGLLQAWSEPHTQVGHALLAPSG
    AFDARGLFTDNGDFKHKFTEWPEGGVVALPA
    CGESFIPGGSLGMVNIASMVSQTALRVLSGNIGSPSWISSINRPNDVVT
    LGGKYLGPDLPAGIQQAQLERDWPETLERGK

    >gi|242239876|ref|YP_002988057.1| molybdopterin synthase sulfurylase MoeB [Dickeya dadantii Ech703]
    MMLPELTDAEALRYNRQIVLRGFDFDAQEKLKSSRVLIVGLGGLGCAASQYLAAAGTGHLTLLDFDTVSLSNLQRQVLHR
    DDRIGMTKVASAAATLQDINPHVVLEPINGVLDDAALQALIVRHDVVVDCTDNVTARDQLNRGCYAAKTALISGAAIRME
    GQISVFTYQQDEPCYHCLSRLFGDSALT
    CVEAGVMAPLVGVIGSLQALEAIKVLTHYGQPLVGKLLLFDAMTLQFREIRL
    PRHPGCSVCGATE

    >gi|242239961|ref|YP_002988142.1| NADH-quinone oxidoreductase, chain I [Dickeya dadantii Ech703]
    MTLKELLIGFGTQVRSICMVGSNAFKKRETKMYPEEPVNPPPRFRGRIVLTRDPDGQERCVACNLCAVACPVGCISLQKA
    EMKDGRWYPEFFRINFSRCIFCGMCEEACPTTAIQLTPDFEMGEFKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAING
    KDKGEAENEAKPIDVKGLLP

    >gi|242240160|ref|YP_002988341.1| Rhodanese domain protein [Dickeya dadantii Ech703]
    MSASSSSLFVSAAWLAERLNTDDITLIDARMLPVGATNRDVTAEYRAEHIPGAVFFDIEALSDSNTSLPHMMPTPDVFAQ
    AMARLGISERQQLVIYDSGNLFSAPRAWWMLKTFGAKHIVILSGGLAEWKHQGYPLEQGDVTRPSVTFNAVLDASVIRHR
    DDVLAICRDRSEQIIDARSAPRYLGDVDEPRPGLHRGHIPGSLNVPWDALVANGAMKPNAELATILHKAGVEFGRPIVAS
    CGSGVTAAVIVLALTLLDVPNVSLYDGSWSEWGSRDDVPIAVGV

    >gi|242240167|ref|YP_002988348.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech703]
    MSITLSDSAAQRVSNFLVNRGKGIGLRLGVKTSGCSGMAYVLEFVDELSEDDVVFEDKGVKVIIDGKSLVYLDGTQLDFI
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|242240227|ref|YP_002988408.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii Ech703]
    MSDDVALPLQFTDAAANKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEKQGVSLVVDPMSLQYLL
    GGSVDYTEGLEGARFVVHNPNAKTTCGCGSSFSV

    >gi|242240307|ref|YP_002988488.1| thiamine biosynthesis/tRNA modification protein ThiI [Dickeya dadantii Ech703]
    MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVRYWDHIDVRAKDESQRDAIRDALTRIPGIHHILEVE
    DHAYNDIHHIFEQTLAMYREQLEGKTFCVRVKRRGKHEFNSQGVERYVGGGLNQHIESARVNLTAPQVTVHLEIDQDRLL
    LIKGRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVKQVAHYLWNRFGSSHRVRFV
    AVDFEPVVGEILEKVDDGQMGVVLKRMMVRAASRIAERYGVEALVTGEALGQVSSQTLTNLRLIDNASDTLILRPLISHD
    KEHIIKLARELGTEDFAKTMPEYCGVISKSPTVKAVKAKIEHEEANFDFAILDKVVSEARNIDIREIAEQTSQNVVEVET
    VGALGASDVLLDIRSPDEQEDKPLTMEHVTVQSLPFYKLGTGFGDLDQNKTYLLY
    CERGVMSRLQALYLREQGFTNVKVY
    RP

    >gi|242240325|ref|YP_002988506.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dickeya dadantii Ech703]
    MVLVTRPAPDFTAAAVLGSGEIVENFNLKKHINGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFQKRGVEVVGVSFDSEF
    VHNAWRSTPIEKGGIGPVKYAMVADIKRDIQQAYGIEHPDAGVALRGSFLIDKNGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKSGMGASPDGVAKYLKENASSL

    >gi|242240522|ref|YP_002988703.1| arsenate reductase [Dickeya dadantii Ech703]
    MTAITIYHNPACGTSRNTLALIRNSGVEPTVIHYLETPPSRDQLIKLIADMGIPARELLRTNVDPYQQLGLAENNFTDDE
    LIDAMLEHPILINRPVVVTPLGTKLCRPSEVVLDILPDPQQGSFIKEDGEAVIDEQGQRIKR

    >gi|242240702|ref|YP_002988883.1| thiol:disulfide interchange protein DsbC [Dickeya dadantii Ech703]
    MKKQVLLLAVLTAMMSGGVAQADDAAIKQTLSRLGLQNAEIQPAPVAGMKTLLTESGVLYITEDGKHLLQGPLYDVGGKT
    PVNVTNGILMNKMEALKDQMIVYKAAKEKHVITVFTDII
    CGYCHKLHEQMKDYNALGITVRYLAFPRQGLNSQAEKDMQS
    IWCVADRNKAFDAAMKGDEISPATCKTAIAPHYQLGILFGVQGTPAIVLDDGTVVPGYQDPKEMMAMLEAHRASQKSGG

    >gi|242240813|ref|YP_002988994.1| cytochrome c biogenesis protein transmembrane region [Dickeya dadantii Ech703]
    MAQRILTLILIGISLLFTCQAVAQNPFERSAQPSSSRFLPVDQAFAFDFQQQGSQLTLQWQIHDGYYLYRQQIRLIGNNA
    DIANVELPPGTPHHDEFFGEVSIFRQTLSLPVSLLSAESNATLSVTYQGCADNGFCYPPETRKVPLSAVSQTPAAITAMP
    VDTPSIPLPFSPLWALLIGVGVAFTPCVLPMYPLISGLILGQRQRLSSRRTLLLSILYIQGMALTYTLLGVLIAYAGLRF
    QAALQHPYVLTGISVLFIALALSMFGLYNLQLPSSLQTRLTLWSNRQQGGSAIGVFMMGTLAGLICSPCTTAPLSALLLY
    IAQSGDLPAGAGTLYLYALGMGLPLLGVTLFGNRLLPKRGAWMNHVKEGFGFVILALPVFLLGRVLGDIWEARMWALLGV
    AFFGWGFVLSLAHRSGWMRIVQVIMLAGALLTVRPLQDWLFMPVQAAQDRPRPLAFSPVGNLNELHRSLSGAGRITMLDL
    YADW
    CVACKEFEKYTFSDAQVRQRLSQLQLLQADVTANSDAHQALLRHFQVLGLPTILFFDASGREIPGSRVTGLLNATD
    FVGHLQKLPR

    >gi|242240846|ref|YP_002989027.1| heavy metal translocating P-type ATPase [Dickeya dadantii Ech703]
    MSHEHPRYTLFKHDSAHRAGKGALQPISRVSGTHPDRHEHEHHRLDTGHGLPGTDGCHCHGTDPAHGDQSCCAAPTDPLS
    PLNGGERQGDQQRTPIRIMQMD
    CPTEEAMIRKKLATLNAVQSLEFNLMQRVLTVTHRHDALDSILAAIRSLGFEPEINLV
    GRAAEHAQPKKAWWPLGLAIAAAGMAEVAEWMGWPWWTAALLAIIAVAASGLTTYRKGWMAIRNGNLNINALMSVAVTGA
    LLLQQWPEAAMVMVLFTIAELIEARSLDRARNAIAGLMALTPETATVQLPNGDWQDVDAKTLQPGRIVRVKPGERIALDG
    EIVRGSSAVNQAPITGESLPVDKTVGDSVFAGTINESGSFEYRVTAAAANTTLARIIHAVEEAQGAKAPTQRFVDRFAKI
    YTPAVFLVALLVALIPPLFIGGWLDWAYRALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGAFLEKGHALSWLA
    LDKTGTLTLGKPTQTGFINCGELDERRSQALAASLADRSDHPVSQAIASAAQQAQIAPIAVDTFTALGGLGVTGVIDGHA
    YFLGSPRLAQQRLGDAATRHADRMAGLEQDGNTVVVLGDERQVLALIAVADTVKPGSRDAVASLHRAGIKTLMLTGDNPH
    VAQAVAREVGIDEARGNLLPTDKLSIIEQLAGKGVIGMVGDGINDTPALARADIGFAMGAMGTDSAIETADVALMNDDLR
    KIPEFVRISTSTRRILIQNIVLALGIKAVFLLLTLMGLGTMWMAVFADVGASLLVVGNGLRLLRQSTPREQSAPAA

    >gi|242240854|ref|YP_002989035.1| alkyl hydroperoxide reductase, F subunit [Dickeya dadantii Ech703]
    MLDNTMKIQLKAYLEKLTKPVELVATLDGSAKSSDVRGLLADIAGLSDKVSFFENNDLPVRKPSFLVTNPGSASGPRFAG
    APMGHEFTSLILALLQVGGHPSKEAQELLDQIRELDGKFHFETYYSQT
    CHNCPDVVQALNLMSILNPNITHTAIDGGVFQ
    DEIKDRNIMGVPTVFLNGDQFGQGRMTLGEIVAKLDTGAGDKLVEKLNNRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
    MGERFGGQILDTVDIENYISVPKTEGAKLAMALKSHVDDYEVDVIDLQSAQRLIPASKPGMPHQIETASGAVLKSRSIII
    ATGARWRSMNVPGEEQYRTRGVTF
    CPHCDGPLFKGKHVAVVGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQAKL
    RSLPNVDVIVNAQTTEVIGDGQKVTGLEYRDRVTSDTHKLALEGIFVQIGLLPNTHWLEGSVERNRIGEIIIDAKCETTV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTPTSA

    >gi|242240855|ref|YP_002989036.1| peroxiredoxin [Dickeya dadantii Ech703]
    MSVINTQVKPFKNQAFKDGQFIEVTEQSIEGKWSVFFFYPADFTFVCPTELGDVADHYAEFQKIGVDIYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDQGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAA
    HPGEVCPAKWQEGDATLAPSLDLVGKI

    >gi|242241113|ref|YP_002989294.1| UBA/THIF-type NAD/FAD binding protein [Dickeya dadantii Ech703]
    MLSDNDFMRYSRQLLLEEVGPEGQQRLAQARVLLVGMGGLGSPAALYLAAAGVGMLRLADDDRLHISNLQRQILYRTADL
    DRAKAELARQQLTALNPSIRVEALAARLEGDALHHAVDDVDLVLDCSDNMATRHAVNAVCIAAGKPLVSASAVGFSGQLL
    VLTPPYRHGCYACLYPDDAEPQRN
    CRTAGVLGPVVGVMGTLQALEAIRLLCGHASPLDGKLRLFDARQQQWTTLQLSPAP
    GCTVCGGHA

    >gi|242241147|ref|YP_002989328.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Dickeya dadantii Ech703]
    MQKIIIIGGVAGGASAAVRARRLSESAEIILLERGPYVSFANCGLPYHIGGDIPNRQSLLLKTPADFATRFNVEVRIEQE
    VTAIDAAAQTLSIHNLRDGNIYTESYDRLLLSPGANPVVPPLPGIDLPGIFTLRNITDMDRILDHIQRHTPQHVTVVGGG
    FIGLEVTEALVQLGLRVTVLELGSQVMPPLDPEMAAPLHQVIRQHGVDLRLDTGLTAIHQESDNQLRLSLSDGAEQVTGM
    VLLSIGVKPDTHLAQTAGLALGARGGIAVNSLMQTSDAHIYAVGDAVETAEWVSGIPALFPLAGPANRQGRLAADNMLGR
    QHHYLRTQGTAICKVFDHSAGCVGMNEKSLQRLNRAYQKVYVHAADHAGYYPSAETISLKLLFSPDDGAILGAQATGKAG
    IDKRIDVIAVAQRAGLHVRDLENLELAYAPPFNSARDVVNQAGMLAANILNGDTAICHADRVDALDPATQCLLDIRTTGE
    LGKFGEYPHALHIPLDELRQRLAELPRDKEIIIG
    CQSGLRGHVAYRMLSQLGFRAKNLSGGFKTWQAASPA

    >gi|242241181|ref|YP_002989362.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Dickeya dadantii Ech703]
    MTIQQQYDYDAIVIGSGPGGEGAAMGLSKQGAKVAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRV
    ISSSFSDILRHAGSVINQQTRMRQGFYERNHCDLFSGEANFIDAHTLAVRYPDDTHDTLTAENIIIATGSRPYHPAEVDF
    THPHIYDSDSILELDYEPRHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMSDALSYHFWNSGVVIRHNE
    EFERIEGVDDGVIVHLKSGKKVKADCLLYANGRTGNTENLGLENIELEADGRGQLKVNSMYQTALSHIYAVGDVTGYPSL
    ASAAYDQGRIAAQAITKGDATAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETRKILGIHCFGERAAEIIHIGQAIMEQKGEGNTIDYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|242241362|ref|YP_002989543.1| DSBA oxidoreductase [Dickeya dadantii Ech703]
    MKKIWLALVGMVLAFSASAADFSNGKQFVTLDKPAQQEPQVLEFFSFYCPHCYQFSQVFHVTEAIEKSLPAGTKLTKYHV
    DFLGPLGAELTKAWAVAIALGVEDKVSPLMFDAVQKTQTVQRVEDIRNVFVAAGVKPEDYDNALNSFVVKSLVAQQEKAA
    ADLQLRGVPAVFVNGKYMVKSDGLDTSSMDAYVKQYADVVNFLLSQK