Dickeya dadantii Ech586 uid42519

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|271498592|ref|YP_003331617.1| glutathione-disulfide reductase [Dickeya dadantii Ech586]
    MTRHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKHLGGTCVNVGCVPKKVMWHAAQIAEAIHHYGPDYGFDVTVNQFN
    WDTLLKNRSAYIDRIHQSYNNVLGKNQVDVIQGFARFVDAKTVEVNGERITADHILIATGGRPTRPDIPGAEYGIDSDGF
    FELTALPPRVAVVGAGYIAVEIAGVLNALGSDVHLFVRKHAPLRQFDPLIVETLVEVMTTEGPALHTESIPKAVVKNADG
    SLTLQLESGHEHTVDCLIWAIGREPANDKVNLEAAGVVLNNKGYIVVDKFQNTTVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTIGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPEE
    KIVGVHGIGFGMDEILQGFAVAVKMGATKQDFDNTVAIHPTAAEEFVTMR

    >gi|271498609|ref|YP_003331634.1| uncharacterized peroxidase-related enzyme [Dickeya dadantii Ech586]
    MTQSTFDIVDTLSEIAPDSPLAQARATRDAATRHTQGSYDALFSQTTGDALPLALRFFIAEKVSGWHQNTRLQHFYAQRL
    ADFPAPTSGVALDLALEHAKRLALQPIAAQPEFLQALQQAGWAADDIVTLSQLVAFVSFQSRLLYGYRLLAGHTEEVAPV
    APAAVAGHWHTQALTNSGKTAPNAFTQGELGWEPWLPAKPLAEFTPDEQAILARFGHTDSDYFRLLGRNLPVLEQRTLTD
    KGIFYTSGGLPRQDRELAAAVVSKVNGCIY
    CASVHARKASQLSKQHDAVQRLLDVPPGEDLAAEQNPRWQAIITFAARLS
    TTPSQANAQDLAHLREQGLDTLEILDLIQSTAFFAWANRLMLTLGEPFWPGNQG

    >gi|271498747|ref|YP_003331772.1| Rhodanese domain protein [Dickeya dadantii Ech586]
    MQEIMPFISRHPILSLAWIALLVAVIVLTVKSKLSKVKEVARGEAIQLINKEDAVVVDTRNRDDYRRGHIAGAINLLPND
    IKNGSVGELEKHKAQPVIVV
    CANGMSARESAEHLFKAGFERVMVLKDGLAGWSGENLPLVRGK

    >gi|271498806|ref|YP_003331831.1| UBA/THIF-type NAD/FAD binding protein [Dickeya dadantii Ech586]
    MLDDQAFMRYSRQLLLEDIGQEGQQKLAASRVLLVGLGGLGSPAALYLAAAGVGTLLLADHDTLHISNLQRQILYRHADL
    SHPKAVLARHALEAINPLVKTVALTTRLEGESLATAVAQADLVLDCCDNMTTRHAVNAACVAAQKPLISASAVGFSGQLL
    VLTPPYPHGCYACLYPDATEPQRN
    CRTAGVLGPVVGVMGTLQALEALKLLCGLPSPLDGKLRLFDARQQQWTTLQLARSA
    TCRVCGERA

    >gi|271499009|ref|YP_003332034.1| alkylhydroperoxidase like protein, AhpD family [Dickeya dadantii Ech586]
    MSTLRLPYATLSPEAYQGLLTTKKALEKSTLGLELIELVYLRISQINGCAFCLNMHAGWLRRAGVSNEKVDSLAGWRVCS
    LYSPREQAALAWTESLVDVAQTHAPDADFAPLREHFTEAEIADLCFAIALMSAFNRLAIGARQ

    >gi|271499079|ref|YP_003332104.1| peroxiredoxin [Dickeya dadantii Ech586]
    MSVINTKVKPFKNQAFKDGQFIEVTEQNIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQKIGVDIYSVSTDTHFTHK
    AWHSSSETIAKIKYAMIGDPTGALTRNFENMREDQGLADRGTFIVDPQGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|271499080|ref|YP_003332105.1| alkyl hydroperoxide reductase, F subunit [Dickeya dadantii Ech586]
    MLDNNVQLQLKTYLEKLTKPVELVATLDDSAKSAEVRALLTDIAGLSDKVSFFENNDLPVRKPSFLVTNPGAANGPRFAG
    APMGHEFTSLVLALLQTGGHPSKEAQELLDQIRDLDGKFHFETYYSLT
    CHNCPDVVQALNLMSILNPNVTHTAIDGGVFQ
    DEIKDRNIMGVPTVFLNGEHFSQGRMSLAEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
    MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDVQSAQKLIPASEPGQPHQIETASGAVLKSRSIII
    ATGARWRNMNVPGEEQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQAKL
    RSLPNVDVIVNAQTTEVLGDGQKVTGLQYKDRTTDSVHKLALEGIFVQIGLLPNTNWLDGAINRNRIGEIEIDARCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA

    >gi|271499084|ref|YP_003332109.1| heavy metal translocating P-type ATPase [Dickeya dadantii Ech586]
    MSEKHSPTSVRQFQPVAPEKPGKALFRQHHQTQTGSCQTVHAAGHEQQTEPAACAHHCCDNAVQHNPMQHNAVQPVSALA
    GAERTGDQQRTPIRIMQMD
    CPTEETMLRKKLDMLPEVSALEFNLMQRVMTVTHRYDALDTVLAAIRALGFEPEVRAANDR
    SALPPEPKKSWWPLGLAVLAAGAAEAVEWSALPEWWAAVLAILAVAVSGLTTYRKGWTALRTGNLNINALMSIAVTGALI
    LQQWPEAAMVMVLFTLAEHIEARSLDRARNAIAGLMNLAPETATVQQSDGSWRDVEANTITPGSIVRVRPGERIALDGDI
    TRGHSAVNQAPITGESLPVDKRVGDSVFAGTINESGSFEYRVTAAAANTTLARIIHAVEQAQGTRAPTQRFVDQFARVYT
    PLVFLGALLVAVLPPLLTGGSWLEWTYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGGVFLEKGHALSWLAL
    DKTGTLTHGKPVQTGFESVADADDAGCRQLAASLASRSDHPVSQAVAKAAQEAGTTLLDVDNFSAVAGQGVIGTLQGQRY
    FLGNLRLARQWLGDAAAAISERLTAQEQAGNTVIILGDERRILALMTVADTVKPSSREAINALHQAGIKTLMLTGDNQYV
    AQAIARDVGIDEARGNLLPEDKLSQIERLSAQGIIGMVGDGINDTPALARADIGFAMGAMGADSAIETADVALMNDDLRK
    IPEFVRISKATRAILIQNIVLALGIKALFLTLTLLGMGTMWMAVFADVGASLLVVGNGLRLLRQTAVSTYQPQSA

    >gi|271499104|ref|YP_003332129.1| cytochrome c biogenesis protein transmembrane region [Dickeya dadantii Ech586]
    MAQRILTLTLLCLSLFFSPLAPAQNPFGRSAQSQFLTVDQAFALDFQQHGDQLTVSWQIHPGYYLYRQQIKLDSTLIAPP
    GVTLPPGESHRDEFFGDVSIYRQSLTLNVPLRNVPPGAALSITYQGCADAGFCYPPETRSIPLSATNAGSTNVSTTNTDT
    PATPAAIVPQPDATHTPTLPFSPLWALLIGIGVAFTPCVLPMYPLISGLILGRQQRLSTGRTLLLTLVYVQGMALTYTLL
    GLIVAAAGLRFQAALQHPYVLTGLSVMFAALALSMFGVYSLQLPSSLQTRLTLWSNRQQSGSVVGVFAMGALAGLICSPC
    TTAPLSALLLYIAQSGNLLAGGGSLYLYALGMGLPLMAITLFGNRLLPKRGPWMNHVKEGFGFVILALPVFLLGRVLGDT
    WEWRLWALLGVAFFGWAFALSLRSHAGAMRVVQILLLLGALLAARPLQDWFFTPVQAEPTHTSQLSFTPANTLAELTTAL
    NHNDNRITMLDLYADW
    CVACKEFEKYTFRDATVQQSLSTLQRLQANVTANNEAQRTLLQQLKVLGLPTILFFDASGQEIP
    GSRVTGFMDAAAFAAHLQTLKR

    >gi|271499211|ref|YP_003332236.1| Disulphide bond isomerase, DsbC/G-like protein [Dickeya dadantii Ech586]
    MKKRVILLSLLTLAFGNMARADDAAIKQTLNRLGIQNAEVKDSPISGMKTLLTENGVLYITDDGKHLLQGPLYDVSGKDP
    VNVTNHILNDRLNALKDQMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEQIKDYNALGITVRYLAFPRQGMNSQAAKDMQSI
    WCVADRNKAFDAAMKGDDVSPATCKTDIGAHYQLGVLFGVQGTPAVVLSDGTVVPGYQPPKEMMAMLEAHKASLKSGG

    >gi|271499532|ref|YP_003332557.1| UBA/THIF-type NAD/FAD binding protein [Dickeya dadantii Ech586]
    MNNIVDGIDGIRSISVDELKDNTGFLLIDVRESHEYLDGTIPQALTIGRGFLEIELKKRKIELDKPIVLFCASGLRSRYA
    ALNLMLLNYSNIYSLQGGFEAWKAQGNPIEYPLSLSENDKKRYARHLSLQDIGTDGQLKIMQAKVLVIGAGGLGSSCLLY
    LAAAGVGEIAVVDHDIVDLSNLQRQVIHNEKMLKKKKVDSALHTLRALNSEITVNTIDERITPENVDGLVDGYDIIVDCT
    DNFNARYIINDSAVKAGKPVVSAAVFRYSGQVMTRSNNQAPCYRCVYPEAPPAELAPS
    CTENGVIGVIPGMLGIYQANEV
    LKIILGIGDCLNGKLLKIDMLNNQHQLLTTKKRPGCQCHNH

    >gi|271499565|ref|YP_003332590.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Dickeya dadantii Ech586]
    MVLVTRPAPDFTAAAVLGSGEIVENFNLKKHINGKAAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVDNGGIGEVKYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGIVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLKENANNL

    >gi|271499637|ref|YP_003332662.1| copper-translocating P-type ATPase [Dickeya dadantii Ech586]
    MSQTIRLSLQGLSCEHCVGRVKKALESRPDVEQVDVSLKHANVTGDADTQTLITAIEEAGYEASPAIPNVTLQLSGLNCQ
    HCVASTRKALEAVPGVAAADITLQQAAVYGDADPQTLVAAVEQAGFHATLAAESHHPKSEPLTTPHAFTPDRLSAAFTSV
    PANTDAVNTRTGVDMSTANAVTAGVTPADNLAASDDDTVQLLLSGMS
    CASCVSRVQSALQRVPGVTQAHVNLAERSALVS
    GSVPHQTLIEAVQNAGYGAEIILDEAERRARQEHTSRQAVRRFRWQAALGLTLGIPLMVWGMIGDNMMLTDHNRTGWLLV
    GVLTLAVMIAAGGHFYRNAWRSLMNGGATMDTLVALGTGAAWLYSITVNLWPTAFPMEARHLYYEASAMIIGLINLGHAL
    EQRARQRSSQALERLLDLTPPTARLVTEQGDHVIPLSQVQTGMTLRLTTGDRIPVDGQLEQGELWVDEAMLTGEALPQQK
    SAGDKVHAGTQVQDGSATLRAGAIGNQTTLARIIHLVRQAQSSKPAIGQLADRISAVFVPVVVAIALVSGAIWYVVGPAP
    HLVYTLVIVTTVLIIACPCALGLATPMSIISGVGRAAELGVLVRNAQALQQASQLDVLVFDKTGTLTEGKPHVVALHTFG
    GISESQALSWAASLEQSAHHPLAQAIVQRADDIPLSTVTQFRTLPGLGVSGQVGDTSLLLGNPALLKQHQVTLDDGENSP
    RYWLEKQSADGMTPVLLVANGHIAALFSVQDTLRQDSVSALQRLHRQGYQLVMLTGDNAATAQTIAREAGIDQVIAGVLP
    DGKADAIRQLQSQGKRVAMIGDGINDAPALAQADVGIAMGSGSDIAVETAAMTLMRHSLHGVADALALSRATLGNMKQNL
    LGAFIYNTLGIPIAAGVLYPLTGTLLNPVVAGAAMALSSITVVSNANRLLRFTPPDAPTGHG

    >gi|271499657|ref|YP_003332682.1| Thioredoxin domain protein [Dickeya dadantii Ech586]
    MFEQHANVIDINETNLHQVLEQSMSAPVLFYFWSERSTHCQQLGPVLDKLAAEYAGQFILAKVDCDAEQRVAAQFGLRAI
    PTVYLFKDGQPVDGFQGPQPEDVIRDLLQRVLPKAEDLKLAQAQQLIQENQLKEAVVLLKDAWQLDTKRSDIALLLAEVQ
    IQLNRSEDAQAVLDTIPLQDQDTRYHGLVAQIELMKQAADTPEIQHLQQQLAASPDNQELAVQLSLQLHQVGRNEEALEL
    LMGLLKKDLAAADGSARKTLMDIMAALGTGDALAARYRRQLYSLLY

    >gi|271499676|ref|YP_003332701.1| arsenate reductase [Dickeya dadantii Ech586]
    MSKSVTIYHNPRCSKSRETLTLLQQQGIEPEVVLYLDTPPDAATLTRLIKQLGFNSARELMRRKEELYRELNLADDTLTE
    AQLIEAMVTHPKLIERPIVIANGHAKLGRPPEQVLDIL

    >gi|271499678|ref|YP_003332703.1| Peroxiredoxin [Dickeya dadantii Ech586]
    MTTLKAGDTAPKFSLPDQDGEQVNLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKTFGVEVLGISTDKPEKLSR
    FTEKELLNFTLLADEDHQVAEQFGVWGEKTFMGKTYDGIHRVSFLINAEGNIEKVFDDFKTSNHHDIVLNYLKGA

    >gi|271499689|ref|YP_003332714.1| arsenate reductase and related protein [Dickeya dadantii Ech586]
    MAITLYGIKNCDTIKKARRWLEEHRIDYRFHDYRADGLTAERLQSFIDDIGWQPLLNTRGTTWRKLDEAYRNSINNDVAA
    KAVMLEQPALIKRPLLVTDDGKTLLGFSDDSYQHFFTENTAHVLPGN

    >gi|271499953|ref|YP_003332978.1| DSBA oxidoreductase [Dickeya dadantii Ech586]
    MSKIWLILASITFAFNAVATQITDGKQYTTLDKSVAGEPQVLEFFSFNCPHCYQFEQVFHISEHVKKELPEGIHLTKYHV
    EFLEPLGKYLTQAWAVAMALGVEDKISAPLFEGIQKTQTIKTDADIRKVFIDAGVKPEEYDAAWNSFVVKSLVAQQEKAV
    ANLQLQGVPAMYVNGKYIVNMQGMDISSMDVFVQQYVETIKFLIDKK

    >gi|271500117|ref|YP_003333142.1| Rhodanese domain protein [Dickeya dadantii Ech586]
    MPVLHNRVSNEELKARMLAETEPRTTVSFYKYFQLDEPRAFRDALYVAFEQARVFGRVYIASEGINAQISVPASRFEAFR
    TALYGAHPALNGVRLNIALEDDGKSFWVLRMKMRERIVADGIDDASFDPTRVGQYLKAEEVNRMADDPDTLFVDMRNHYE
    YEVGHFDNAIEVPSDTFREQLPMAVDMLAEARDKNIVMY
    CTGGIRCEKASAYMLHHGFRNVYHVEGGIIEYVRQAKSRGL
    PLKFIGKNFVFDERMGERVSDDVIAHCHQCGEPCDTHVNCKNQGCHLLFIQCPTCAEKYEGCCSSTCQEETRLPVEEQRL
    RRKDREVSMKIFNKSKGLLNTTLGIPAPEKAK

    >gi|271500164|ref|YP_003333189.1| Peroxiredoxin [Dickeya dadantii Ech586]
    MSNDIYAIPLQTIDGRQTSLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAVLGFPSNEFAGQEPGSNEDIQ
    AFCRGTFGVEFPMFGKIEVNGSGRHPLYQTLIQAQPQALRPQGSEFYERRVSKGQAPAYPGDILWNFEKFLINRRGNVVA
    RFSPDMTPDDSAIIKAIEQALAQ

    >gi|271500169|ref|YP_003333194.1| protein of unknown function UPF0061 [Dickeya dadantii Ech586]
    MPHDLPFNNHYHQQLPGYYTELTPTPLHGARLLYHNVSLAQELGLSADWFEGDNQRIWSGERLLPGMAPLAQVYSGHQFG
    VWAGQLGDGRGILLGQQQLADGRTQDWHLKGAGLTPYSRMGDGRAVLRSVVREFLASEALHHLGIPTTRALTIVSSDHPV
    RREQEERGAMLLRVADSHVRFGHFEHFYYRREPEQVRQLAEYVIACHWPQWQQDADRYYLWFSDVVARTARLIAHWQAVG
    FAHGVMNTDNMSILGLTIDYGPFGFMDDYQPDYICNHSDHQGRYAFDNQPAVALWNLHRLAQSLSGLMPVERLQQALKGY
    ESALMQRFGELMRAKLGFDTPQAQDNDLLVGLLQLMKRERADYTHIFRLLSETERHSSHSPLRDVFIDLAAFDGWFSAYR
    QRLMLESADDTERQQRMKQANPRYILRNYLAQQAIDLAEKEDVSALARLHQTLQQPYAEQPDKADLAALPPDWGKHLEIS
    CSS

    >gi|271500215|ref|YP_003333240.1| glutaredoxin-like protein [Dickeya dadantii Ech586]
    MTTTTLEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LVGGCDIVIEMYQRGELQQLIKETADKYRSQQEDQQ

    >gi|271500274|ref|YP_003333299.1| Redoxin domain protein [Dickeya dadantii Ech586]
    MSTNVHFQGNPVPVAGSFPAAGSKAPAFSLVAKDLSDVALSHYAGKRKVLNIFPSIDTGVCAASVRKFNQLASSLDNTVV
    LCVSADLPFAQSRFCGAEGLNNVVVLSTLRGAEFKENYGVAIAEGALKGLTARAVVVLDENDNVLHSELVNEITNEPDYD
    AAIAVLK

    >gi|271500369|ref|YP_003333394.1| Peroxiredoxin [Dickeya dadantii Ech586]
    MTPFHQLTATSLGGQLISMADYAGKVVLVVNTASHCGFTPQYGGLEALYQKYAAQGLVVLGFPCNQFGKQEPGNADDIAQ
    TCHINYGVSFPMFEKVEVNGTEAHPVFRYLKNELPGVLGGRIKWNFTKFLIGRDGKPLKRFAPFTTPEKMEATILAALES


    >gi|271500529|ref|YP_003333554.1| Disulphide bond formation protein DsbB [Dickeya dadantii Ech586]
    MLRFLNRCSRGRGAWLLMAFTALAFELVALYFQYVLMLKPCVLCIYQRTALYGVMAAGLVGAIAPGTALRYPALGLWIYS
    AWEGLALAIKHTNIQLHPSPFVT
    CDFFVSFPSWLPLDKWLPAIFTATGDCAERQWNFLNLEMPQWMIVIFGAYLLVAVLV
    LIAQPFRPKRRDLFGR

    >gi|271500567|ref|YP_003333592.1| methylated-DNA/protein-cysteine methyltransferase [Dickeya dadantii Ech586]
    MQTFLFDSLPTPIGELLLIADENYHLRAVEWREYEENLYQSLNKRYRHDSFVLKACNNPGQLTDALSAYFAGDLNIIETL
    PVAAAGTDFQHQVWQALRTIPCGTTTTYGELAARLGQPGAARAVGLANGSNPISIVVP
    CHRVIGARGALTGYAGGIHRKQ
    WLLTHEGYLPQQDLFNSRR

    >gi|271500634|ref|YP_003333659.1| electron transport complex, RnfABCDGE type, A subunit [Dickeya dadantii Ech586]
    MSEYVLLFVGTILVNNFVLVKFLGLCPFMGVSKKLEAAIGMGFATTFVMTIGSVFSWLVNTYVLLPLNLLYLRTLAFILV
    FAVVVQFTELAVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLSVNQSHNFLQSTIYGFSAAVGFSLVLVLFAALRERLAV
    ADVPAPFRGSSIALVTAGLMSLAFMGFTGLVKL

    >gi|271500639|ref|YP_003333664.1| electron transport complex, RnfABCDGE type, E subunit [Dickeya dadantii Ech586]
    MNQTKELALQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTCTNIAVSALRRWVPGEIRIPIYVMLIASVV
    TIVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNTVILSALDGLFMGLGATSALFVLGAIREILGNGTVFDG
    ADLLLGSWARVLRVEVVHMDSPFLLMILPPGAFIGLGMMLAGKYLIDEKRKQRQARTVRPTVIGSSQTLAE

    >gi|271500695|ref|YP_003333720.1| methionine-R-sulfoxide reductase [Dickeya dadantii Ech586]
    MTKTTVFQRNLDELTDLQRHVTQQRGTESPYTGKLLHNKRTGVYHCLCCHQPLFYSDSKYDSGCGWPSFDRPVNEQAVRY
    LDDHSHHMHRIEIRCGQCDAHLGHVFPDGPQETTGERY
    CVNSVSLSFIDAENGQQTDG

    >gi|271500751|ref|YP_003333776.1| glutaredoxin, GrxB family [Dickeya dadantii Ech586]
    MKLFIYEHCPFCVKARMIFGLKQLPVELCVLSNDDETTPISMVGQKMVPILQKEDGSYMPESLDIVKYVDELDGKPVLTG
    TTNPAIDAWIRGVYDYAPRLLIPRFSQADFEEFATEAGRNYFINKKEGQIGSFATHFSQTDTLTKQLESDLQALAPLIVS
    SQACNGTLSLDDINLFPLLRSLTIVADVNVPAAIATYCDTMSQLANIDLLIEQAQ

    >gi|271500831|ref|YP_003333856.1| thioredoxin reductase [Dickeya dadantii Ech586]
    MSTAKHRKLLILGSGPAGYTAAVYAARANLSPLLITGMEKGGQLTTTTEVENWPGDADDLTGPLLMERMHAHAVKFNTEI
    VFDHITRVDLQTRPFRLFGDSDEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRAEKILIDRLMAKVSSGNIVLHTNRTLDEVLGDDMGVTGVRLREAAGEAVEQLDVAGVF
    IAIGHSPNTAIFGDQLALENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDALAK

    >gi|271500859|ref|YP_003333884.1| glutaredoxin, GrxA family [Dickeya dadantii Ech586]
    MYAVIFGRPGCPYCVRAKELAEKLTEERDDFNYRYVDIHAEGISKADLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAR
    EHLFN

    >gi|271500939|ref|YP_003333964.1| arsenate reductase [Dickeya dadantii Ech586]
    MTEITIYHNPACGTSRNTLALIRNSGVEPTVIHYLDTPPSKAELEELIRAMGITPRMLLRQNVEPYTALGLADDSFSDEQ
    LIAFMLAHPILINRPIVVTPLGTRLCRPSEVVLDILPDAQQGEFIKEDGERVIDASGKRVKS

    >gi|271501028|ref|YP_003334053.1| molybdopterin synthase sulfurylase MoeB [Dickeya dadantii Ech586]
    MLPELTDEETLRYNRQIVLRGFDFDAQERLKAARVLIVGLGGLGCAASQYLASAGVGQLTLLDFDTVSLSNLQRQVLHRD
    DRIGMPKVESARQTLQRINPHVQITPIQDNLDDDALQAVVMQHDVVVDCTDNVSIRERLNHLCFLQKIPLVSGAAIRMEG
    QISVFTYQPQEPCYRCLSRLFGDSALT
    CVEAGVMAPLVGVIGSLQALETIKLLAHYGQPLAGKLLLFDAMTMQFREMRLS
    KNPDCDTCGQAT

    >gi|271501073|ref|YP_003334098.1| disulfide isomerase/thiol-disulfide oxidase [Dickeya dadantii Ech586]
    MKYRYLLLCSLLAAVSAQADTAIPPAVKQLEKQGIRIIKPFSAPGGVQGWLGEYQKMGVTIYLTPDGKHAISGYMYDAQG
    NNLSEQLIDKELYLPAGREMWKKLERAPWIAEGKADAPRTIVVFADPF
    CPYCKQFWEKAQPWVASGKVQIHTLLVGIIRP
    DSGRYAAAILSAKNPAQAWHDFELSNGKTVPPFPDATPPDVVKKLQFNQQLLDELGANVTPAIYYMNADNALQQVVGLPD
    EKQLADMMGK

    >gi|271501261|ref|YP_003334286.1| NADH-quinone oxidoreductase, chain I [Dickeya dadantii Ech586]
    MTLKELLIGFGTQVRSICMVGSNAFKKRETKMYPEEPVNPPPRFRGRIVLTRDPDGQERCVACNLCAVACPVGCISLQKA
    EMKDGRWYPEFFRINFSRCIFCGMCEEACPTTAIQLTPDFEMGEFKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAVDG
    KEKGEAENEAKPIDVKGLLP

    >gi|271501438|ref|YP_003334463.1| protein of unknown function DUF395 YeeE/YedE [Dickeya dadantii Ech586]
    MINLEQFTPLPSLSGGLLIGIAASLLVLFCGRIAGISGILVGVLPKRGKIIEKWRLAFLAGLILAPLLYTAFFHHPDVTL
    STSTPGLLLAGFLVGVGTRLGSG
    CTSGHGVCGLSRFSIRSLVATLVFMVVGFATATLIGYFQW

    >gi|271501576|ref|YP_003334602.1| Rhodanese domain protein [Dickeya dadantii Ech586]
    MSTSAAGLFVSASWLNTHRHDADIALIDARMLPPGNDTRDIAAEYRAEHVPGAVFFDIESLSDHHTPLPHMMPDIATFAD
    ALGKLGLSEQQHLVIYDEGNLFSAPRAWWMLRLAGAPRISILSGGLAGWKQQGFALEQGNASPVANVFHAPMPTAGAIRS
    LAEVLELCHTGNEQIVDARPAPRFLGEMDEPRPGLRRGHIPGSFNVPWNLLVDHGTLKPADELAAIFHQAGVDIQRPIVA
    S
    CGSGVTASVVLLALFVLNAPHISLYDGSWSEWGARDDVPVVTG

    >gi|271501583|ref|YP_003334609.1| iron-sulfur cluster assembly protein IscA [Dickeya dadantii Ech586]
    MSISLSDSAAQRVNAFMANRGKGIGLRLGVRTSGCSGMAYVLEFVDELNTDDVVFEDKGVKVIIDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|271501646|ref|YP_003334672.1| iron-sulfur cluster assembly accessory protein [Dickeya dadantii Ech586]
    MSDDVALPLQFTDAAANKVKLLIADEENPELKLRVYITGGGCSGFQYGFTFDDKVNDGDMTIEKQGVSLVVDPMSLQYLI
    GGSVDYTEGLEGSRFVVTNPNAKTTCGCGSSFSI

    >gi|271501741|ref|YP_003334767.1| transcriptional regulator, AraC family [Dickeya dadantii Ech586]
    MTMPDYTHSDAAHSNDEHSDYARIADAITFIANSVNSQPTLDEIAAHVHLSPFHFQRLFSRWAGVTPKRFLQVLTLERAK
    ALLRESRPLLDVADAVGLSSSSRLYDHFVHLEAVTPGEYKQQGAGLIIEHAVHPTPFGNAFIAVTPRGICSLSFLDNKDA
    GEPLAALHHTWPHAVMHENPQRTQTVIDTLFAMKTPPDRPISLHVTGTNFQISVWKALLQIPPATVVSYSQVADAIGHHN
    AARAVGLAVGANPVAFLIP
    CHRVIQQSGKIGGYHWGETRKHAIHAWESARYERYE

    >gi|271501803|ref|YP_003334829.1| thioredoxin [Dickeya dadantii Ech586]
    MNTVCAFCNATNRLPEERINENQSAKCGRCGHPLFNGEVINATEKTLDKLLQDDLPVVVDFWAPWCGPCVNFAPVFESVA
    DENADKIRFVKVNTEAEPALSARFRIRSIPTIMLFKQGKMVDMLNGAMPKAPFESWLNESL

    >gi|271501873|ref|YP_003334899.1| peptide methionine sulfoxide reductase [Dickeya dadantii Ech586]
    MIVNFDKTQLLDKSDALPGRTTPMPVARLHVVNQHSMTHVPDNMEVAIFAMGCFWGVERLFWQQSGVYSTASGYCGGYTP
    NPTYREVCTGKTGHAEAVRVVFDPAEVSYTQLLQLFWENHNPAQGMRQGNDIGTQYRSAIYTLTPEQNAAAKASYQRFQQ
    AMREAGDNRAITTEIQPAGPFYYAEDEHQQYLHKNPYGYCGLGGIGVCLPPQG

    >gi|271502016|ref|YP_003335042.1| dihydrolipoamide dehydrogenase [Dickeya dadantii Ech586]
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQ
    TDINKIRTWKEKVITQLTGGLAGMAKGRKVKVVNGFGKFTGPNTLVVEGENGSTTVNFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKTVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKNGPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAVFPWAASGRAIASDCADGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|271502095|ref|YP_003335121.1| hydroxymethylbutenyl pyrophosphate reductase [Dickeya dadantii Ech586]
    MKILLANPRGFCAGVDRAISIVERALEVYGAPIYVRHEVVHNRYVVDGLRDRGAVFIEQIEDVPDGAILIFSAHGVSQAV
    RAEAKSRELTVFDAT
    CPLVTKVHMEVARASRKGTEAILIGHAGHPEVEGTMGQYNNPAGGMYLVEGPEDVWSLQVKDETN
    LCFMTQTTLSVDDTSAVIDALRARFPQIIGPRKDDICYATTNRQEAVRNLAAQANVVLVVGSKNSSNSNRLAELSQRVGK
    PSYLIDSADDIQEEWLKGVACVGVTAGASAPDVLVQQVIKRLQSMGGEVAMEMEGRAENIVFEVPKELRMDVREVE

    >gi|271502171|ref|YP_003335197.1| peroxiredoxin, Ohr subfamily [Dickeya dadantii Ech586]
    MSIEKVLYVAHAQATGGRDGRAVSSDQQLDVKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGALKFVGVRDKVSIPAGT
    TINGSVGIGAIPNGFGIEVELKVTLPGLDRAVAEDLVQKAHIV
    CPYSNATRGNIDVKLTVI

    >gi|271502345|ref|YP_003335371.1| Thiosulfate sulfurtransferase [Dickeya dadantii Ech586]
    MEQFEAIDIEQAYQRWQQGQALVDIRDPQSFGAAHVPGSTHLTNETLSDFVRGADFEQPVMVMCYHGISSRNAANYLISL
    GFEAVYSVDGGFDAWQNRFPQDVAAG

    >gi|271502411|ref|YP_003335437.1| thioredoxin [Dickeya dadantii Ech586]
    MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEYEGKLTIAKLNIDDNPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLNANL

    >gi|271502438|ref|YP_003335464.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Dickeya dadantii Ech586]
    MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVGGGCTHWGTIPSKSLRHAVSRIIEFNQNPLYSDNARV
    ISSSFSDILRHADSVIGQQTRMRQGFYERNHCEIFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPAGVDF
    DHPHIYDSDSILDLDYEPKHVIIYGAGVIGCEYASIFRGLNVKVDLVNTRDRLLAFLDQEMSDALSYHFWNSGIVIRHNE
    EFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGNTENLGLDTIGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSL
    ASAAYDQGRIAAQAITKGEAIAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRDTKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|271502440|ref|YP_003335466.1| glutaredoxin-family domain protein [Dickeya dadantii Ech586]
    MFVSQEGKKIPSVTFHTRQGDQWVDVTSEELFNNKTVVVFSLPGAFTPTCSSSHLPRYNELAEVFKQFGVDAILCVSVND
    TFVMNAWKADQNAENITFIPDGNGEFTRAMNMLVEKAELGFGPRSWRYSMLVRHGVVEKMFVEPNKPGDPFEVSDADTML
    KYLAPHYKIQESVSLFTKPG
    CPFCAKAKQLLQDRGLQYEEIMLGKDATTVSLRAVTGRSTVPQVFIGGRHIGGSEELETF
    LTI

    >gi|271502640|ref|YP_003335666.1| DSBA oxidoreductase [Dickeya dadantii Ech586]
    MKKIWLALVGVVLAFSASAADFSDGKQFTTLDKPVPQSPQVLEFFSFYCPHCYQFAQVYHIPDAIQKALPADAKLTKYHV
    DFLGPLGKELTQAWAVAIALGVEDKVSPLMFDAVQKTQTVKTTEDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAA
    ADLQLRGVPAVFVNGKYMVKSDGLDTSSMDGYVKQYADVVKFLLSQK