Dickeya dadantii 3937 uid52537

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307128780|ref|YP_003880796.1| periplasmic protein disulfide isomerase I [Dickeya dadantii 3937]
    MKKLWLALAGMVLAFSASAADFSDGKQYATLDKPVPQSPQVLEFFSFYCPHCYQFAQVYHIPDAIQKALPADAKLTKYHV
    DFLGELGKELTQAWAVAIALGVEDKVSPLMFDAVQKTQTVKQPQDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAA
    ADLQLRGVPAVFVNGKYMIKSDGLDTSSMDNYVKQYADVVKFLLSQK

    >gi|307128958|ref|YP_003880974.1| Peroxiredoxin family protein/glutaredoxin [Dickeya dadantii 3937]
    MFVSQEGKKIPSVTFHTRQGDQWVDVTTAELFNNKTVVVFSLPGAFTPTCSSSHLPRYNELAAVFKQFGVDAVLCVSVND
    TFVMNAWKADQDAENITFIPDGNGEFTRAMNMLVEKAELGFGPRSWRYSMLVRHGVVAKMFVEPNKPGDPFEVSDADTML
    KYLAPHYKVQESVSLFTKPG
    CPFCAKAKQLLQDRGIQYEEIMLGKDATTVSLRAMTGRSTVPQVFMGGRHIGGSEELETV
    LTT

    >gi|307128960|ref|YP_003880976.1| Soluble pyridine nucleotide transhydrogenase [Dickeya dadantii 3937]
    MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVGGGCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARV
    ISSSFSDILRHADSVIGQQTRMRQGFYERNHCELFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPAGVDF
    HHPRIYDSDSILDLDYEPKHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMSDALSYHFWNSGVVIRHNE
    EFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGNTETLGLENVGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSL
    ASAAYDQGRIAAQAITKGDATAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLKI
    LFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF

    >gi|307128994|ref|YP_003881010.1| thiamin (thiazole moiety) biosynthesis protein [Dickeya dadantii 3937]
    MLDDQAFMRYSRQLLLEDIGQEGQQKLAAARVLLVGMGGLGSPAALYLAAAGVGTLLLADHDTLHISNLQRQILYRNADL
    SHPKAVLARHALEAVNPLVKTVALTTRLEGQPLEKAVAQADLVLDCCDNMTTRHAVNAACVAAQKPLISASAVGFSGQLL
    VLTPPYTHGCYACLYPDASEPQRN
    CRTAGVLGPVVGVMGTLQALEAIKLLCGLPSPLDGKLRLFDARQHQWSTLQLTRSP
    ACPVCGGLA

    >gi|307129194|ref|YP_003881210.1| hypothetical protein Dda3937_01328 [Dickeya dadantii 3937]
    MNALRLPYATLSPEAYQGLLMTKKALEKSTLGLELIELVYLRISQINGCAFCLKMHAGWLRGAGVSNEKLDSLAGWRVCT
    LFSPREQAALAWTESLADVALTHAPDEHFTPLREHFTETEIADLCFAIALMSAFNRLAIGARQ

    >gi|307129272|ref|YP_003881288.1| ABC transporter periplasmic-binding protein [Dickeya dadantii 3937]
    MWIHYQRKSMKISCGGASLVNGSAALMGLLWGLSAVTAQASGFPVTVQSCGKPLTFTQAPQRAIINDLNMSEMAFALHLQ
    PQIVGLTGISGWYKMTPEFRRQMGTIPELSPKYPLLETLLAASPDFFFAGWNYGMKVGGDVTPDTLAKYGVKTLVLSES
    C
    IFEDQHRPRASMDLLYGDELTLGKIFGREEQAQALVEQWKARLAALPKPPSGQAALKVFVYDSGEDKPFTSGVYAMPTAI
    IDAAGGRNVMDGMAASWATTSWETVAAAEPDLIILLDYQNGGGAAASQHFLEAHPLMKHTPAVAHQRYLKLQYAELTPGP
    ANIDAIEKLAHALYPAAAR

    >gi|307129274|ref|YP_003881290.1| alkyl hydroperoxide reductase, C22 subunit [Dickeya dadantii 3937]
    MSVINTKVKPFKNQAFKDGQFIEVTEKSIEGKWSVFFFYPADFTFVCPTELGDVADYYDEFQKIGVDIYSVSTDTHFTHK
    AWHGSSDTIAKIKYAMIGDPTCQLTRNFENLREDQGLADRGTFIVDPEGIIQAVEITAEGIGRDASDLLRKVKAAQYVAS
    HPGEVCPAKWKEGDATLAPSLDLVGKI

    >gi|307129275|ref|YP_003881291.1| alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding protein [Dickeya dadantii 3937]
    MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTEIAGLSDKVSFFENNDLPVRKPSFLITNPGSANGPRFAG
    APMGHEFTSLVLALLQTGGHPSKEAKELLDQIRDLDGKFHFETYYSLT
    CHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQ
    DEIKDRNIMGVPTVFLNGEHFSQGRMSLGEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
    MGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPGQPHQIETVSGAVLKSRSIII
    ATGARWRNMNVPGEDQYRTRGVTY
    CPHCDGPLFKGKHVAVIGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQNKL
    RSLPNVDVIVNAQTSEVLGDGQKVTGLQYKDRVTDSVHKLALEGIFVQIGLLPNTGWLEGAVDRNRIGEIEIDARCETSV
    KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA

    >gi|307129281|ref|YP_003881297.1| zinc, cobalt and lead efflux system [Dickeya dadantii 3937]
    MIPLDPVVATGFLLQQNPEQESTMSEKHSPTSRRQFQPVALEKPGKALFRPHQQGHAGLGQTAPNSALAQHSEQSCANHC
    CDNSAPPQPTSELTSAERTGDQQRTPIRIMQMD
    CPTEEAMLRKKLDALPEVSELEFNLMQRVMTVTHRYDALDKVLTAIR
    SLGFEPEVRTENDRTPLPPEQKKAWWPLGLAVVAAAAAEAVEWTGLPEWWAAALAILAVAASGLTTYRKGWIALRTGNLN
    INTLMSIAVTGALFLQQWPEAAMVMVLFTLAEHIEARSLDRARNAIAGLMNLAPDTATVQQPDGDWREVEAKTVTPGSIV
    RVRPGERIALDGEITSGHSAVNQAPITGESLPVDKRVGDSVFAGTINESGSFEYRVTAAAANTTLARIIHAVEQAQGTKA
    PTQRFVDQFARVYTPLVFLGALLVAVLPPLFADGDWLDWTYKALVLLVIACPCALVISTPVTIVSGLAAAARRGILIKGG
    VFLEKGHALAWLALDKTGTLTHGKPVQTGFESVADVDDARCRQLAASLASRSDHPVSQAVARAAQQAGTPLIDVDDFSAV
    AGQGVIGTLQGQRYFLGNQRLARLWLGDAADGIIERLSALEQAGNTAIILGDGRQILALMAVADTVKPSSQEAINALHQA
    GIKTLMLTGDNQHVAQAIARDVGIDEARGNLLPEDKLSQIERLSAQGVTGMVGDGINDTPALARADIGFAMGAMGTDSAI
    ETADVALMNDDLRKIPEFVRISKATRAILIQNIVLALGIKALFLTLTLLGMGTMWMAVFADVGASLLVVGNGLRLLRQAP
    VSTRQHQQPQPA

    >gi|307129314|ref|YP_003881330.1| cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase [Dickeya dadantii 3937]
    MAQRIFTLTVLCLSLFFSTLAPAQNPFGRSTQSQFLPVDQAFAFDFQQRGDRLTLNWQIHPGYYLYRQQIKLDSALIAPP
    GLTLPPGEQHRDEFFGEVAIYRQSLTLNVPLRDVPPGASLSITYQGCADAGFCYPPETRSVPLSAISSGTPKAPAAVTPQ
    PDRAYTPQLPFSPLWALLIGIGVAFTPCVLPMYPLISGLILGRQQRLSAGRTLLLTLVYVQGMALTYTLLGLIVAAAGLR
    FQAALQHPYVLIGLSVMFVALALSMFGVYSLQLPSSLQTRLTLWSNRQQSGSAAGVFAMGALAGLICSPCTTAPLSALLL
    YIAQSGNLLAGGGSLYLYALGMGLPLMAITLFGNRLLPKRGPWMTHVKEGFGFVILALPVFLLGRVLGDTWEWRLWGLLG
    VAFFGWAFALSLRSHAGGMRAVQILLFLGALLAARPLQDWVFAPVQAEPTSGSQLHFMPTNTLDQLTTALNRSDNRITML
    DLYADW
    CVACKEFEKYTFRDAAVQQSLLAMQRLQADITANNETQRALLQHLQVLGLPTILFFDASGREIPGSRVTGFMDA
    AAFTAHLQTLAR

    >gi|307129431|ref|YP_003881447.1| protein disulfide isomerase II [Dickeya dadantii 3937]
    MKKRVVLFSLLTLALSGVARADDAAIKQTLNRLGLQSAEVKDSPIGGMKTVLTENGVLYITEDGKHLLQGPLYDVSGKTP
    VNVTNHILNERLDALKDQMIVYKAPQEKHVITVFTDIT
    CGYCHKLHEQMKDYNALGITVRYLAYPRQGMNSQAAKDMQSI
    WCVADRNKAFDAAMKGDDVSPATCKTDIGAHYQLGVLFGVQGTPAIVLDDGTVVPGYQPPKEMMAMLDAHKASLKSGG

    >gi|307129890|ref|YP_003881906.1| alkyl hydroperoxide reductase subunit C-like protein [Dickeya dadantii 3937]
    MVLVTRPAPDFTAAAVLGSGEIVENFNLKKHINGKPAVIFFWPMDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSFDSEF
    VHNAWRKTPVENGGIGEVKYAMVADIKREIQKAYGIEHPEAGVALRGSFLIDKNGIVRHQVVNDLPLGRNIDEMVRMVDA
    LQFHEEHGEVCPAQWEKGKAGMGASPDGVAKYLKENANNL

    >gi|307129974|ref|YP_003881990.1| Lead, cadmium, zinc and mercury transporting ATPase; Copper-translocating P-type ATPase [Dickeya dadantii 3937]
    MSQTILLSLQGLSCEHCVGRVKKALEARPDVEQADVSLKYANVTGEADSQSLVATIEAAGYEASPATVPNITLQLSGLNC
    QHCVASTRKALQAVPGVAATDVTLQQAAVYGDAEPLALVQAIEQAGFHVTLAQENTLPKSEPLTPHASSPDRLSAAFNPV
    PANTVHDDNVAHDDGNRIHDNGGIHDISNVHDNDSVQLLLSGMS
    CASCVSRVQRALQSVPGVTQARVNLAERSALVSGDM
    PHQALIDAVQNAGYGAEIILDEAERRARQEQTSRQAIRRFRWQAALGLALGIPLMVWGMIGDNMMLTDDNRSGWLLVGGL
    TLAVMIAAGGHFYRNAWRSLINRSATMDTLVALGTGAAWLYSITVNLWPAWFPMEARHLYYEASAMIIGLINLGHALEQG
    ARQRSSQALERLLDLTPPTARLVTPQGDRVIPLAEVQTGMALRLTTGDRIPVDGLLEQGELWIDEAMLTGEPIPQQKAAG
    DKVHAGTQVQDGSATLRAGAIGNQTTLARIIHLVRQAQSSKPAIGQLADRISAVFVPVVVAIALLSGAIWYVVGPAPHIV
    YTLVIVTTVLIIACPCALGLATPMSIISGVGRAAELGVLVRDADALQQASQLDVLVFDKTGTLTEGKPRVVAIHTFGDIS
    ESQALRWAASLEQGASHPLAQAIVQRADGVELGDVTQFRTLPGLGVSGQVDGASLLLGNPALLAQHQIPLAGGENSPRDW
    LEKQSALGMTPVLLVANGQVAALFSVQDTLRQDSISALQRLHRQGYQLVMLTGDNPTTAQAIAREAGIDQIIAGVLPDGK
    ADAIRHLQSLGKRVAMIGDGINDAPALAQADVGIAMGGGSDIAVETAAMTLMRHSLHGVADALALSRATLSNMKQNLLGA
    FVYNTLGIPIAAGVLYPLTGTLLSPVVAGAAMALSSITVVSNANRLLRFTPADAPARRD

    >gi|307129996|ref|YP_003882012.1| putative thioredoxin domain-containing protein [Dickeya dadantii 3937]
    MLEQHATMIDINETNLHQVLEQSMSAPVLFYFWSERSTHCQQLEPVLDKLAAEYAGQFILAKVDCDAEQRVAAQFGLRAI
    PTVYLFKDGQPVDGFQGPQPEEVIRDLLQRVLPKAEDLKLAQAQQLIQENQLKEAAVLLKDAWQLDAKRSDIALLLAEVQ
    IQLNRTEDAQTVLDAIPLQDQDTRYHGLVAQIELMKQAADTPEIQQLQQQLAASPDNQELAVQLSLQLHQVGRNEEALEL
    LMGMLKKDLTAAGGNARKTMMDIMAALGTGDALAARYRRQLYSLLY

    >gi|307130015|ref|YP_003882031.1| putative oxidoreductase [Dickeya dadantii 3937]
    MSKPVTIYHNPRCSKSRETLALLQQQGIEPEVVLYLETPPDAATLGNLLKQLGFAGARELMRRKEDLYRELNLADDSLTE
    AQLIQAMVTHPKLIERPIVIANGKAKLGRPPEQVLDIL

    >gi|307130017|ref|YP_003882033.1| thiol peroxidase, thioredoxin-dependent [Dickeya dadantii 3937]
    MTTLKAGDIAPKFSLPDQDGEQVNLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKTFGVEVLGISTDKPEKLSR
    FTEKELLNFTLLADEDHQVAEQFGVWGEKTFMGKTYDGIHRVSFLINAEGNIEKVFNDFKTSNHHDIVLDYLKGA

    >gi|307130028|ref|YP_003882044.1| hypothetical protein Dda3937_02498 [Dickeya dadantii 3937]
    MAIILYGIKNCDTIKKARRWLENHQIDYRFHDYRVDGLKGERLQFFIDRMGWQPLLNTRGTTWRKLEEAYRNTIVNEAAA
    KAVMLEQPALIKRPLLVADDGKILLGFSEDSYQYFFTENTSHVLPGN

    >gi|307130431|ref|YP_003882447.1| putative PQQ enzyme repeat protein [Dickeya dadantii 3937]
    MPRPRPPPRLSLTKYSSPTNWSTHMGHPSVYPTGTTIYHPDKAWGGYTVFQALETGAVLIDMNGAALRLWEGLHGFPNKL
    LPGGYILGHSGQRDARYGMQDMVDLVQLDWDGNRVWQFNRYEHIHDPDLPPEWMARAHHDYQRSGNPVGYYAPGLEPQAL
    GGNTLILAHQNLHNPKISDKLLLDDTIIEVDWQGNVVWEWRCSDHFDELGFDDAAKTALYHNPNMRSSGGGMGDWMHINS
    MSALGPNPWFDQGDARFHPDNIIWDARESNIIAIIDKQSGDIVWRLGPDYSTPELKHLGWIIGQHHAHMIPAGLPGAGNI
    LVFDNGGWAGYGAPNPASADGVKNAWRDYSRVLEINPVTLDIVWRYSPYEAGIPHPTDAFRFYSPYISNIQRLPNGNTLI
    NEGANGRLFEVTVDHEIVWEYISPFWGKSVNTNMLYRAYRVPYDWVPQLPRPQETPVQAPDNTRLRQPGAAPAGFASVVA
    VSETRPYKRGGDALCVATDSDDLKRSPKLFAVNRSRFTALSLTPDEALSLPAGNQLLLVGAER
    CVHCKSLYRQLETVIGD
    AAFSGLPSYYLDADHHLPHTAQLQVRSLPTLLWLQDGQEQARLTGAQSADKLRQWLGAILH

    >gi|307130537|ref|YP_003882553.1| molybdopterin synthase sulfurylase [Dickeya dadantii 3937]
    MPELTDEETLRYNRQIVLRGFDFDAQERLKAARVLIVGLGGLGCAAAQYLASAGVGRLTLLDFDTVSLSNLQRQVLHRDD
    RIGMPKVESARLTLQGINPHVHITPVQDNLDDDALLALVMQHDAVVDCTDNVSIRDRLNRLCFMRKTPLVSGAAIRMEGQ
    ISVFTYQPEEPCYRCLSRLFGDSALT
    CVEAGVMAPLVGVIGSLQALETIKVLTQYGQPLAGKLLLFDAMTMQFREMRLPK
    NPDCDICGPTR

    >gi|307130649|ref|YP_003882665.1| arsenate reductase [Dickeya dadantii 3937]
    MTEITIYHNPACGTSRNTLALIRNSGVEPTIIHYLETPPSRAELIGLIIAMGISPRTLLRQNVEPYTELGLAEDKFSDEQ
    LITFMLAYPILINRPIVVTPLGTRLCRPSEVVLDILPDAQQGAFVKEDGEHIVDKLGKRIKLN

    >gi|307130650|ref|YP_003882666.1| glutathione S-transferase, theta [Dickeya dadantii 3937]
    MSTHDLTLISHPLCPFVQRSAIVLLEKNVPFERVNVDLSAKPDWFLALSPTGKVPLLKVRQANGEDAIIFESMVICEYLN
    ETQDGDSMYADDALVRARQRAWIEFSTSMLGNAWQFLNATDQTIADSKRTVFREQLERIESELSLGPYFSGAEFSMVDAV
    YAPIFRYFSIIDASVSEAIFEGLPRASAWIAALAKRESVKAAVSSDYAELFQNHLRQHSAILAT

    >gi|307130752|ref|YP_003882768.1| glutaredoxin 1, redox coenzyme for ribonucleotide reductase (RNR1a) [Dickeya dadantii 3937]
    MYAVIFGRPGCPYCVRAKELAEKLTEERDDFNYRYVDIHAEGITKADLSKTVGKPVETVPQIFLDEKHIGGCTDFEAYAR
    EHLFQ

    >gi|307130785|ref|YP_003882801.1| thioredoxin reductase, FAD/NAD(P)-binding protein [Dickeya dadantii 3937]
    MSTAKHRKLLILGSGPAGYTAAVYAARANLNPLLITGMEKGGQLTTTTEVENWPGDPDDLTGPLLMERMHAHAAKFNTEI
    VFDHITRVDLQTRPFRLFGDSDEYTCDALIIATGASARYLGLPSEDAFKGKGVSA
    CATCDGFFYRNQKVAVVGGGNTAVE
    EALYLSNIAAEVHLIHRRDSFRAEKILIDRLMAKVSSGNIVLHTNRTLDEVLGDDMGVTGVRLRDAAGHATEQLDVAGVF
    IAIGHSPNTAIFGDQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDALVK

    >gi|307130865|ref|YP_003882881.1| glutaredoxin 2 (Grx2) [Dickeya dadantii 3937]
    MKLFVYEHCPFCVKARMIFGLKQLPVEVCVLSNEDEATPISMVGQKMVPILQKQDGSYMPESLDIVKYIDELDDKPVLTG
    PTNPAIDAWIRRVYEYAPRLLIPRFSRADFEEFATDAGRNYFIHKKEGQIGSFDTHFSQSAALIGQLEGDLQALAPLIVS
    PQACNGTLSLDDINLFALLRSLTIVADVNVPAAIAAYCDTLSQHADIDLLIEQAQ

    >gi|307130932|ref|YP_003882948.1| methionine sulfoxide reductase B [Dickeya dadantii 3937]
    MTKITASPRNLDELTDLQRHVTQLRGTESPYTGKLLHNKRTGVYHCLCCHQPLFYSDHKYDSGCGWPSFDRPVAEDAIRY
    LEDNSHHMQRIEIRCGHCDAHLGHVFPDGPQDTTGERY
    CVNSASLSFIDTENGQQTDG

    >gi|307130988|ref|YP_003883004.1| Electron transport complex protein rnfE [Dickeya dadantii 3937]
    MNQTKELALQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTCTNIAVSALRRWVPGEIRIPIYVLLIASVV
    TIVQMLINAYAYGLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNTVMLSALDGLFMGLGATSALFVLGAIREILGNGTLFDG
    ADLLLGSWARVLRVEVVHMDSPFLLMILPPGAFIGLGMMLAAKYLIDEKRKQRRARTVRLSPLGSSTLTE

    >gi|307130992|ref|YP_003883008.1| inner membrane iron-sulfur protein in SoxR-reducing complex [Dickeya dadantii 3937]
    MITIWVAIAALSALALVFGLILGFASRRFQVEEDPVVEQLDAMLPQSQCGQCGYPGCRPYAEAIALNNEQINKCVPGGEP
    LMLKLAERMSVEPQPLDAEAPQKPEPLVAWVDEDNCIGCTKCIQACPVDAIVGTTRAVHTVIRDLCTGCNLCVPPCPTDC
    IELRPLAPTTASWKWNLDAIPVRVIQAENRVIENHV

    >gi|307130993|ref|YP_003883009.1| inner membrane subunit of SoxR-reducing complex [Dickeya dadantii 3937]
    MSEYVLLFVGTILVNNFVLVKFLGLCPFMGVSKKLEAAIGMGFATTFVMTLGSVFSWLVNTYVLLPLNLLYLRTLAFILV
    FAVVVQFTELAVRKTSPALYRLLGIFLPLITTN
    CAVLGVALLSVNQSHNFLQSTIYGFSAAVGFSLVLVLFAALRERLAV
    ADVPAPFRGSSIALVTAGLMSLAFMGFTGLVKL

    >gi|307131068|ref|YP_003883084.1| O-6-alkylguanine-DNA:cysteine-protein methyltransferase [Dickeya dadantii 3937]
    MQTFLFDTLPTPIGELLLIADENYHLRAVEWREYEEKLSQSLNKRYRHDPFVLKACNNPGGLTDALRAYFAGDLHIIETL
    PVAAAGTDFQHQVWQALRTISCGSTTTYGELAARLGQPGAARAVGLANGANPISIVVP
    CHRVIGAQGALTGYAGGIHRKQ
    WLLTHEGYLPQQNLFNTDH

    >gi|307131127|ref|YP_003883143.1| oxidoreductase that catalyzes reoxidation of DsbA protein disulfide isomerase I [Dickeya dadantii 3937]
    MLRFLNRCSRGRGAWLLMAFTALAFELIALYFQYVMMLKPCVLCIYQRTALYGVMAAGLVGAVAPGTLLRYPAIGLWIYS
    AWEGLSLAIKHTNIQLHPSPFVT
    CDFFVSFPSWLPLDKWLPAIFTATGDCAERQWSFLSMEMPQWMIVIFGAYLLVAVLV
    LIAQPFRPKRRDLFGR

    >gi|307131370|ref|YP_003883386.1| lipid hydroperoxide peroxidase [Dickeya dadantii 3937]
    MSTNVHFQGNPVPVAGSFPAAGGKAPAFSLVAKDLSDVALSHYAGKRKVLNIFPSIDTGVCAASVRKFNQLASSLDNTVV
    LCISADLPFAQSRFCGAEGLNNVVVLSTLRGAEFNENYGVAIAEGALKGLTARAVVVLDENDNVLHSELVNEITTEPNYD
    AAIAVLK

    >gi|307131424|ref|YP_003883440.1| monothiol glutaredoxin [Dickeya dadantii 3937]
    MTTTTLEKIQLQIAENPILLYMKGSPKLPSCGFSAQAVQALSACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGE
    LVGGCDIVIEMYQRGELQQLIKETADKYRSQPAEQQ

    >gi|307131461|ref|YP_003883477.1| Fe-S cluster assembly protein [Dickeya dadantii 3937]
    MQTHDVETFSLDEQAWQGLTLTDSAVAHISNLMRRDESVQGIRLAVKQSGCAGFGYVLELVHQPDPSDRLYQREGARLFI
    PLKAMPFLDGTEVDFVQEGINQVFKFNNPKARHACGCGESFGL

    >gi|307131497|ref|YP_003883513.1| hypothetical protein Dda3937_03652 [Dickeya dadantii 3937]
    MPHRLLFNNHYHQQLPGFYTELTPTPLQGARLLYHNATLAQELGLSEDWFDGDNSRIWAGEQLLLGMVPLAQVYSGHQFG
    VWAGQLGDGRGILLGQQQLADGRTQDWHLKGAGLTPYSRMGDGRAVLRSVVREFLASEALHHLGIPTTRALTIVSSDHPV
    RREQEERGAMLLRVADSHVRFGHFEHFYYRREPEKVRQLAEYVIACHWPQWQQETDRYYLWFSDVVERTARLLAHWQAVG
    FAHGVMNTDNMSILGLTIDYGPYGFMDDYQPGYICNHSDHQGRYAFDNQPAVALWNLHRLAQSLSGLMSSDILQRALDRY
    EPALMQRFGELMRAKLGFDTPQTQDNTLLVALLKLMQREPADYTHIFRLLSETERHSSHSPLQDVFIDRPAFDGWFSAYR
    QRLALENVSDAERQRRMKQSNPRYVLRNYLAQQAIEQAEREDVGLLGRLHQALRQPYADQPDMADLAALPPTWGKHLEIS
    CSS

    >gi|307131502|ref|YP_003883518.1| putative glutathione peroxidase [Dickeya dadantii 3937]
    MSNTLYAIPLQTIDGRQASLENWRNNVLLVVNVASQCGLTKQYEALENLYETYRDRGFAVLGFPSNEFAGQEPGSNEEIN
    AFCRGTFGVQFPMFGKINVNGSGRHPLYQALIQAQPEALRPQGSEFYERRVSKGQAPAHPGDILWNFEKFLVNRRSEVIA
    RFSPDMTPDDGAIIKAIEQALAQ

    >gi|307131550|ref|YP_003883566.1| hypothetical protein Dda3937_03559 [Dickeya dadantii 3937]
    MPVLHNRVSNEELRARMLAETEPRTTVSFYKYFQLDDPQAFRDALYIAFSHVKVFGRVYIAREGINAQVSVPASHFEDFR
    RALFGSHPALNGIRLNIALEDDGKSFWVLRMKVRDRIVADGIDDASFDPTRVGQYLKAEDVNRMADDPDTLFVDMRNHYE
    YEVGHFENAIEVPSDTFREQLPMAVDMLAGARDKNIVMY
    CTGGIRCEKASAYMLHHGFRNVYHVEGGIIEYVRQAKANGL
    PLRFIGKNFVFDERMGERVSGDVIAHCHQCGEPCDTHVNCKNQGCHLLFIQCPTCAEKYEGCCSAVCQDEIRLPLEEQRQ
    RRKNREISMKIFNKSKGLLNATLGIPAPEEKK

    >gi|307131807|ref|YP_003883823.1| NADH:ubiquinone oxidoreductase subunit I [Dickeya dadantii 3937]
    MTLKELLIGFGTQVRSICMVGSNAFKKRETKMYPEEPVNPPPRFRGRIVLTRDPDGQERCVACNLCAVACPVGCISLQKA
    EMKDGRWYPEFFRINFSRCIFCGMCEEACPTTAIQLTPDFEMGEFKRQDLVYEKDDLLISGPGKYPEYNFYRMAGMAVDG
    KEKGEAENEAKPIDVKGLLP

    >gi|307131859|ref|YP_003883875.1| Organic hydroperoxide resistance protein [Dickeya dadantii 3937]
    MTIMAVEKVLYRAQASVTGGRDGHAVSDDNHLDLKLTTPRELGGLGGSGTNPEQLFAAGYAACFTGALKLVASKEKVSVP
    ATTVVEGLVGIGPSGGGFGIEVELRITIPGMDKAQAQALVEKAHQV
    CPYSNATRGNIDVTLTVL

    >gi|307132046|ref|YP_003884062.1| Thioredoxin reductase [Dickeya dadantii 3937]
    MALSCKQKTYCMMRLRKYDVNIVLTSDGESLRARRLILSYGVADQIPAVPGFAEGWGSSIVPCPYCDGFEVAGRHWGLVW
    SGPMSHNYVRLYHDWTDTLTVFADGHDIPADIRVDLAHRCIPVIDGRIIEIDYDASHNATIRLDVAPPVAVDILFAHPRN
    KPSARLHESLGLATVDTPQGIALKVDERRETSMPGIYAAGDLANPSMHSVTTAAWQGAMAGISAQQSMLV

    >gi|307132067|ref|YP_003884083.1| 3-mercaptopyruvate sulfurtransferase [Dickeya dadantii 3937]
    MMPDIDAFADALGKLGLNEQQHLVIYDEGNLFSAPRAWWMLRLTGASRISILSGGLAGWKQQGLPLEQGDVSPTAQVFHA
    QTPAAGAIRSLDDVLALCRTGDEQIVDARPAPRFLGEVDEPRPGLRRGHIPGSFNVPWSVLVEGGALKPADELAAIFHQA
    GVDIQRPIVAS
    CGSGVTASVVMLALFVLNAPQVSLYDGSWSEWGARDDVPVVTG

    >gi|307132075|ref|YP_003884091.1| FeS cluster assembly protein [Dickeya dadantii 3937]
    MSISLSDSAAQRVNAFMVNRGKGVGLRLGVRTSGCSGMAYVLEFVDELNTDDVVFEDKGVKVIIDGKSLVYLDGTELDFV
    KEGLNEGFKFNNPNVSSECGCGESFNV

    >gi|307132145|ref|YP_003884161.1| hypothetical protein Dda3937_00501 [Dickeya dadantii 3937]
    MSDDIALPLQFTDAAANKVKLLIADEDNPELKLRVYITGGGCSGFQYGFTFDDQVNDGDMTIEKQGVSLVVDPMSLQYLI
    GGSVDYSEGLEGSRFVVTNPNAKTTCGCGSSFSI

    >gi|307132175|ref|YP_003884191.1| glutaredoxin-like protein [Dickeya dadantii 3937]
    MTISVYSKPDCPQCDATCRTLDNYGVTYRKVDISCDEQAREHVLALGYRQVPVVETNGAHWCGFRPDKLRSLRAVTA

    >gi|307132325|ref|YP_003884341.1| thioredoxin 2 [Dickeya dadantii 3937]
    MNTVCASCHATNRLPEERSHDHQHAKCGRCGQALFSGKVINATEETLDKLLQDDLPVVVDFWAPWCGPCVNFAPVFESVA
    DENGGKIRFIKVNTEAEPGLSARFRIRSIPTIMLFKHGKVVDMLNGAMPKAPFESWLGESL

    >gi|307132401|ref|YP_003884417.1| methionine sulfoxide reductase A [Dickeya dadantii 3937]
    MIANFDKTQPIGQSDALPGRTTPMPVARLHVVNQHSMTHVPDHMEVAIFAMGCFWGVERLFWQQPGVYSTASGYCGGYTP
    NPTYREVCTGKTGHAEAVRVVFDPAVVSYPQLLQLFWENHNPAQGMRQGNDIGTQYRSAIYTLTTEQETAAKESYQRFQQ
    AMRDAGNDHDITTEIQPAGPFYYAEDEHQQYLHKNPDGYCGLGGIGVCLPPQG

    >gi|307132558|ref|YP_003884574.1| lipoamide dehydrogenase, E3 component is part of three enzyme complexes [Dickeya dadantii 3937]
    MSTEIKAQVVVLGAGPAGYSAAFRCADLGLDTVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPQ
    TDIDKIRTWKEKVINQMSGGLAGMAKGRKVKVVNGFGKFTGPNTLVVEGESGSTTVNFDNAIIAAGSRPIQLPFIPHEDP
    RVWDSTDALELKSVPGRLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVFTKRISKKFNLMLETKVTA
    VEAKEDGIYVSMEGKKAPAEPQRYDAVLVAIGRVPNGKLLDAGQAGVEVDDRGFIRVDKQMRTNVPHIYAIGDIVGQPML
    AHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETAVFPWAASGRAVASDCSDGMTKLI
    FDKETHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSITDLPNPKAKKK

    >gi|307132644|ref|YP_003884660.1| 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase 4Fe-4S protein [Dickeya dadantii 3937]
    MKILLANPRGFCAGVDRAISIVERALEVYGAPIYVRHEVVHNRYVVEGLRERGAIFIEQIEDVPDGAILIFSAHGVSQAV
    RAEAKSRELTVFDAT
    CPLVTKVHMEVARASRKGTEAILIGHAGHPEVEGTMGQYNNPNGGMYLVEGPEDVWALQVKDESN
    LCFMTQTTLSVDDTSAVIDALRARFPQIVGPRKDDICYATTNRQEAVRNLAAEASVVLVVGSKNSSNSNRLAELAQRVGK
    PSYLIDSADDIQEGWLKSVACVGVTAGASAPDVLVQQVIKRLQSMGGQIAMEMQGREENIVFEVPKELRMDVREVE

    >gi|307132731|ref|YP_003884747.1| Organic hydroperoxide resistance protein [Dickeya dadantii 3937]
    MMSIEKVLYVAHAQANGGRDGRAVSSDQQLDVKLTTPRELGGAGGEGTNPEQLFAAGYSACFLGALKFVGARDKVSIPAG
    TTINGSVGIGAIPNGFGIEVELKISLPGLDRAVAEELVQKAHIV
    CPYSNATRGNIDVTLTVI

    >gi|307132931|ref|YP_003884947.1| thiosulfate:cyanide sulfurtransferase (rhodanese) [Dickeya dadantii 3937]
    MEQFEAIDIEQAYQRWQQGNVLVDIRDPQSFGAAHVPGSTHLTNETLADFVRGADFEQPVMVMCYHGISSRNAANYLLSL
    GFEAVYSVDGGFDAWQTRFPQDVAAG

    >gi|307133002|ref|YP_003885018.1| thioredoxin 1 [Dickeya dadantii 3937]
    MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEFDGKLTVAKLNIDENPATAPKYGIRGIPTLL
    LFKNGEVAATKVGALSKGQLKEFLNANL

    >gi|307133032|ref|YP_003885048.1| putative transmembrane protein [Dickeya dadantii 3937]
    MTIDMQAFTPLMSLTGGVVIGVAVVMLALFCGRIAGISGILGGLLGRTWQDKGWRLAFVLGMFAAPWLYRLAAPLPEIAI
    ATPMPWLVVSGLLVGFGTRYGSG
    CTSGHGVCGLSRLSLRSLVATLTFMGAAFVTVWVLGMFR

    >gi|307133034|ref|YP_003885050.1| NADH oxidase [Dickeya dadantii 3937]
    MTRIIIIGGVAGGASAAVRARRLSESAEIIMLERGPYVSFANCGLPYHIGGDIPDRSALLLKTPTDFADRFNIDVRVRHE
    VLSIDPAARTLQIADLADNRVYTEHYDKLLLSPGANPIVPPLPGIDLPGVFTLRTITDMDRILAHLQQSDIRQVTVAGGG
    FIGLEVAEALVNRGVSVTLLERDSQVMAPVDPEMAAPLHQVIRRHGVELLLNAGLSAIAPCSDHVSGGNHVSGGDHKLML
    TLADGRQRVTGMLLMAIGVKPETQLAQAAGLRLGARGGIQVNQRMQTSNEHIYAVGDAVETPDWVNAAPTPFPLAGPANR
    QGRIAADNMLGREHHYTRTQGTAICKVFDHTVGSVGINEKTLQRTGTPYQKVYVHAADHAGYYPGASTISLKLLFAPDTG
    AILGAQAVGKAGVDKRIDVIAVAQRAGLTVRDLEDLELTYAPPFNSARDVVNQAGMLASNVLQGDTAICHPEDIINLDPA
    TQCLLDIRGAQELHLHGEYPNALHIPLDTLRRRLQELPADKEILIG
    CQSGLRGHVAYRLLIQRGFHARNLSGGFITYRAF
    VAQ

    >gi|307133061|ref|YP_003885077.1| putative rhodanese-related sulfurtransferase [Dickeya dadantii 3937]
    MQEIMPFISRHPILSVAWIALLVAVIVLTVKSKLSKVKEVARGEAIQLINKEDAVVVDTRNRDDYRRGHIAGAINLLPND
    IKNGSLSELEKHKAQPVIVV
    CANGMASREPAENLFKAGFERVVILKDGLAGWSGENLPLVRGK

    >gi|307133211|ref|YP_003885227.1| alkylhydroperoxidase AhpD domain-containing protein [Dickeya dadantii 3937]
    MTQSTSDMLDTLAEIAPDSPLAQARATRDAATRHAQGSYEALFSHTEDGGLPLALRFFIAEKVSGWHQNTRLQHFYAQRL
    ADFPAPTPGATLDRALEHAERLTHQPVAAQPEQLQALQQAGWTEDDIVTLSQLVAFVSFQSRLLHGYRLLAGHAEDPALS
    APAAVAGRWHTQPQTHSGKTAPDAFTQAELGWEPWIPAKPLAAFTADEQAILARFGHTDSDYFRLLGRNLPVLEQRTLTD
    KGIFYTSGGLPRKDRELAAAVVSKVNGCIY
    CASVHARKASQLSKQDDAVQRLLDVPPGGDLAAGQDARWQTIITFAARLS
    TTPSQTNAQDLARLREQGLDTLEILDLIQSTAFFAWANRLMLTLGEPFWPPR

    >gi|307133237|ref|YP_003885253.1| glutathione oxidoreductase [Dickeya dadantii 3937]
    MTRHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKYLGGTCVNVGCVPKKVMWHAAQIAEAIHHYGPDYGFDVTVNQFN
    WDTLLKNRSAYIDRIHQSYNNVLGKNQVEVIQGFARFVDAKTVEVNGERITADHILIATGGRPTRPSIPGAEYGIDSDGF
    FALTALPQRVAVVGAGYIAVEIAGVLNALGSEVHLFVRKHAPLRQFDPLIVDTLVEVMNTEGPALHTESIPRAVVKNADG
    SLTLQLESGHEQTVDCLIWAIGREPANDKINLDAAGVALNSKGYIVVDKFQNTTVPGIYAVGDNTGAVELTPVAVAAGRR
    LSERLFNNKPDEHLDYSNIPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPEE
    KIVGVHGIGFGMDEILQGFAVAVKMGATKKDFDDTVAIHPTAAEEFVTMR