Dichelobacter nodosus VCS1703A uid57643

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|146329357|ref|YP_001209017.1| glutathione S-transferase [Dichelobacter nodosus VCS1703A]
    MLKLYYLAGACSLVPHVALEWTKAPYEAEVMTHAKLKSPAYLALNPQGAVPLLQDGDWVLAQNSAILHYLDALYPQAHLF
    GSGDIKSQAKARQWLAFANTDVHKVFSMLFHPAAIAAEHDAQTEVRARATEKALSLLEPVNRVLSEQPYLTGELTIADVY
    FYVILRWARALKLDTAAFSALADFYQRVEDDAGVKNVLRQEGL

    >gi|146329403|ref|YP_001209073.1| alkyl hydroperoxide reductase C22 subunit [Dichelobacter nodosus VCS1703A]
    MPIINRSIPEFKVDAFHNGEFKTITHEDVKGKWAVFCFYPADFTFVCPTELEDLAKHYDEFKALGAEVYSISCDSHFVHK
    AWHDTSDAIGKIKYPMLGDTTGLLARSFDVMIEADGMAYRGTFLINPEGIIKAAEIQDDNIGRSAKDMLRKLKAAKYVAE
    HDGEVCPAAWEEGQETLKPSLDLVGKI

    >gi|146329450|ref|YP_001209074.1| alkyl hydroperoxide reductase, F subunit [Dichelobacter nodosus VCS1703A]
    MIDQSLLDAVKQYAQSLSKDVTFVMQTGTHSKRDELKTFLEEISSVSEKIHVIERDFSGARNAISFTLEVDNQATGIYFS
    GIPGGHEFSSLILALLQAGGAALKLDNSIQNFIRTIDEPLHFETFVSLS
    CHNCPEVVQALNQFVLLNPLIHSEMIDGGLF
    QEEIEKRNIQGVPAVFLNGQSFINGKIDTAKIIEKLLEKYPHFAQKMAAEEQLPLQDVTVIGGGPAGSAAAIYAARKGLK
    VTLIADRIGGQVKDTVSIENLIGTKETTGSKLALQLQEHIQANAIIVKENISVKSVETHEGSHVVILQTGERIQTKTLIV
    ASGAKWRELGVPGEKENLGKGVAY
    CPHCDGPFFKGKHVAVIGGGNSGIEAAIDLSGIVRKVSVFEFADTLKADKVLVDSA
    QSRDNIEIFTGVMTQSIAAENGKVTAIHYQERASGAEKTLALDGVFVQIGLIPNTAFLGDAVKRTRFGEIEINGRCETST
    AGIFAAGDCTNVPYKQIIIAMGEGAKAALSAFDYLIRQK

    >gi|146328887|ref|YP_001209327.1| redox-active disulfide protein family [Dichelobacter nodosus VCS1703A]
    MAKYVVAHFMEIVMHLCLKILRLIRMKIQILGTGCSKCVKTHEIVKKAVAQLGIDATIEKVEDVMEIMKYNAISTPAVAV
    NGEVKIKGRIPSEQEIVDLLK

    >gi|146329132|ref|YP_001209332.1| thiol:disulfide interchange protein DsbD [Dichelobacter nodosus VCS1703A]
    MAYLSRFCCLWVFFWITTISAQTALPFKDVFKPIISAEQSADNHILTIRIDVPAGYYLYRDKIQPELAAFPQARVQYGAS
    AQIHDPYFGRVDIFDQAHPAVIQIQNPDELTPFSLHAQGCQENVICYPPETWKIDPQALAVDTDIAEAFPFFKKNTAVGA
    FNPITLPQNHVILKNTEENQSVSSETARVKSPSEQATAPKTVAQRLHDRYWFYLPWLILLGISLSGTACVYPMIPIVTSF
    VVGKNASFARGQLLITAYVLAMASTMALLGAVFGLFQINLQVVLQKPLVAAIASAIFLLLSLSLFDVLTLSAPQRMQHWV
    DRFSQKQTRGSFLGAIVLGALSVLVVSPCATPVLTALLLYTTQTTPFKGALALFCLGLGMGLPLFLFASVFRRFMPKAGN
    WMLIIKRLLALMMLAIAVWLFARILPTAYQWGLWALYLLIISTLLTAQSENASFMRLLGAKVFFALAIAATVQCVDNMDA
    RFDEEKTGAVFQKVTTLAAIETEIKTSKQPVILDFYADW
    CASCRHWERTIWQNPQFTSSLSAYRLLKVDMSESNADYQRI
    LNHFSLIGPPAVLFFPAGGTIDEAIYTVIGTTNAETFARALNQFADKK

    >gi|146329418|ref|YP_001209422.1| thiol:disulfide interchange protein DsbA [Dichelobacter nodosus VCS1703A]
    MFKRFSLFAWLLLLSFTASAQLKFTEGTDYRVLKEPVATVDAPTVMEFFWFACGHCYHIQPEVEKWLKDGKPENVVFEQI
    PAQIGNPIWDLPARAFYVMQALKLDAADDYFAAIHKGKQRDLIGSEKGIKKYFIAKGFSEDAVEKAWTSFDVEQKLKRAK
    QIFERSGLEGVPAFIVNGKYVVEINDDIEKMFELINNLSQRKD

    >gi|146328958|ref|YP_001209460.1| electron transport complex protein, E subunit [Dichelobacter nodosus VCS1703A]
    MNPELKKLMKYGLWHNNPALVQILGLCPLLAISQNVVSALGLGLATVFVLMLSNVLVSLSRQFVRPEIRLPIFVLLIASA
    VSVVELIIQAFAFSLYQALGIYLPLIVTN
    CIMIGRAEAYAVKNHWKNALADGFFMGAGFLWTITLLGALREFLAHGTLFS
    HMEILFGDGARAWQITLYEGDAHIILAALPAGAFFCYALLIAGKNSIDEWLKK

    >gi|146329226|ref|YP_001209465.1| electron transport complex protein, A subunit [Dichelobacter nodosus VCS1703A]
    MINDKHSNCPAHRFFIEAFVHYISIIFATTLVNNFVLSQFLGLCPFMGVSRKIDGAIGMGFATAFVLTLSACATYLIDNY
    ILIPYHLTFLRTIIFIVTIAALVGLTELFIAKTSPLLHRLLGIYLPLITTN
    CAVLGVALLNSHRHHHLLESACYGFGAAL
    GFTFVLVIFAALRERLQTADIPRPFRGPPIALITAGILALAFMGFGGWTA

    >gi|146328680|ref|YP_001209467.1| alkyl hydroperoxide reductase/thiol specific antioxidant family protein [Dichelobacter nodosus VCS1703A]
    MNITFPELPTTDGGSFSRDDLLGAWTVLYFYPKDATPGCTLEAQAFRDNFARFEACGARIYGVSRDKMASHEKFKEKQCL
    PFPLISDESELLCAAFDVIKPKSMFGKQFLGVERSTFLINPKGELAHSWRRVKVRGHVEEVLQTLQKLQKDCAE

    >gi|146329722|ref|YP_001209575.1| thiol:disulfide interchange protein DsbB [Dichelobacter nodosus VCS1703A]
    MTDAQKRMTLAVCGLGSWGLILFSWLVLEKMLYLNPCHLCMMQRLAFLLIGLAFLLDAAFFPQSVWGSWLMKFLKYASIF
    LGIGLAARHLYIQSLPLEKAPK
    CGLDFWATLEHKGYLEGLWQSMQGTGSCAAKDTFLGLTIPTWSMMGFLVLLVIAVICE
    NNKPLFRIK

    >gi|146328748|ref|YP_001209642.1| thioredoxin I [Dichelobacter nodosus VCS1703A]
    MSKPFAVNEADFQSQVLDANVPVLVDFWAEWCGPCRALAPVLEEFAAEQAGKLAVAKVNVDDNGDIAAQFGIRSIPTLIL
    FKNGQQVDRIVGLASKAQLSNFVAPHLG

    >gi|146329697|ref|YP_001209693.1| methionine sulfoxide reductase MsrA-B [Dichelobacter nodosus VCS1703A]
    MRKIYLAGGDSRSVAAYFHALTGAVSVVCGYANSALPAPSYQQVCSGKTGAVKAVALTYQPHILSLSAVFLHFFRLLEPI
    LFQYQPHHQRHGIYSVFSEERDLARAAVTALQKRHLNPITIEIAALDNFFAAENAPLSTLEPPRQANEPFSAEERQLLYA
    FWQKPKLAELKKILSEEEFAITQEQSTEAPFSHCYDQLFAAGIYVDLLSGEPLFCSNDKYDAGCGWPSFSQPLTEEALTY
    HADFKGGQKRIEVRSAVSDNHLGHVFFDEPSPSGKRY
    CINGTSLRFIPWSKMDAAGYGDLKIKVKK

    >gi|146328983|ref|YP_001209701.1| hypothetical protein DNO_0801 [Dichelobacter nodosus VCS1703A]
    MARLTVHTQETAPAGAKPYLEKIHEMMGMVPNVFGVFANAPVALQCYQELNQINAKTQFSPVEIEVIQITTAAYNQCQFC
    LAAHSVMAKQKLAFDDDFLTALQTGNPVDHKKYAALQAFTRAILENKGNVSDQELANFFAAGYTQQHVLEVFVGVSLATL
    TNYVNNLAHPEINPEWTEFAANLPETDPSAPKAYYL

    >gi|146328889|ref|YP_001209707.1| Na(+)-translocating NADH-quinone reductase subunit E [Dichelobacter nodosus VCS1703A]
    MEHYLSLLIKSIFIENMALSFFLGMCTFLAVSKKISTAIGLGTAVIVVQTLTVPLNNLLYVYLLKDNAILWQHLGVNVDI
    SFLGLIAYIGVIAAVVQILEMFLDKYVPALYSALGIFLPLITVN
    CAILAGSLFMVERNYTFQESMVYGVGSGVGWALAIA
    VMAGVREKMRYADVPKGLEGLGITFITAGLMAIGFMSFSGIQL

    >gi|146329803|ref|YP_001209708.1| NADH:ubiquinone oxidoreductase, Na(+)- translocating, D subunit [Dichelobacter nodosus VCS1703A]
    MSDKKYHYWNILFDPVLMNNPIGLQVLGICSALAVTGSMKTAFLMSIGLTFVTAFSNLFVSMIRHNIPSSIRIIAQMAVA
    ASLVIVVDQLLKAFAFELSKQLSVYVGLILTN
    CIVMGRLEAFAMSNPPLPSFLDGIGNGLGYSAMLLVVGTIREILGSGT
    WFGLPVLKTIDQGGWYQPNGLMVLPPSAFFVIGLLIWALRTYKPEQNEAREYLEAQAAKPLFYESNPDQVGDK

    >gi|146329729|ref|YP_001209816.1| protein disulfide isomerase [Dichelobacter nodosus VCS1703A]
    MQQRIGFILISALLMVGFTRPSIDEVIYQDEQEKTQFPAPVQQETLPDLSLIKRLIGDRDTIEAVVSTPIDDLFQVTAGA
    QVYYLSRDGRYMLQGDLLDLKQYKNLTETQRDQARLAVINRLNLSDLIIYPAVGQTRYTVTVFSDVD
    CPYCQMLFEQIDD
    FLKLGIELRFAAFPRTGIDSRSYYKSVSVWCAPDRKTTLLRAGRGLKHEKYSCESPVKESYDIGVKAGITGTPSFVFSDG
    FLISGFVSPENLMTMLQTHFSNK

    >gi|146328960|ref|YP_001209983.1| thioredoxin reductase [Dichelobacter nodosus VCS1703A]
    MIHHRLIILGAGPAGYTAAIYAARAGLEPALITGLEPGGQLMTTTHVDNWPSAFEGILGSELMTNMCQHAQRFQTQIIYD
    HVTEVNLQHRPFTLKTEKETYSCDALIIATGARAKYLGLPSETQYLGYGVSA
    CATCDGFFYRNKPVMVIGGGNTALEEAL
    YLSNIASSVTLVHRRDAFRAEKIMVDRLMEKVNAGKIVVKYSAQLQEVLGDDNGVTGAIIRFNNGQIEQLAVDGIFIAIG
    HQPNTELFKNQLATDAHHYLSVHSGSNGNATQTSIDGVFAAGDVADPVYRQAITSAASGCMAALDAERYLATLKN

    >gi|146329877|ref|YP_001209984.1| dihydrolipoamide dehydrogenase [Dichelobacter nodosus VCS1703A]
    MANKQALTIPDIGDFADVDVIEVLVKVGDKIAVDQSLVVLESDKASMEVPASIAGTITSLTVKVGDKVSEGSVIGEIEVA
    NGASAAKTEEKPAEKTAEKPAAAATPAEKTAVPDDAVDLVVIGAGPGGYSAAFRAADLGLKVTLIERYATLGGV
    CLNVGC
    IPSKALLHVAEIMEEAEWAKKAGVTFAKPSVDLDALRTHKEGVIKKLTTGLAGMAKARKVTVIQGVAQFTGSHSIHIKTV
    DGEQNLNFKNCIIAAGSESVKLPFMPTDPRVIDSTGALQLQDIPERLLVIGGGIIGLEMATVYHALGSKIDIVEMMDGLM
    AGADKDLVKVWQRRNPDLFEHIYLNTKTVAAEAKDDGIHVTFAGDKAPKEAQRYDRVLMAVGRRPNGKTLNVEACGVTVD
    ERGFIPVDKQMRTNQAHIFAIGDIVGQPMLAHKAVHEAHVAAENAAGHQAFFDARVIPGVAYTSPEVAWVGVTESQAAKE
    NIAVEKAVFPWAASGRAIANGCDEGFVKLIVDKASQRVIGGAIVGPNAGDMIGEIALAIEMNAVPADIALTIHPHPTLGE
    TIGLAAEVFEGSCTDLPPQKKR

    >gi|146329847|ref|YP_001209993.1| OsmC-like family protein [Dichelobacter nodosus VCS1703A]
    MLTTFKAVAEKQSKGLSVMTRARNFTITMDEPPALGGTDTGMNPVEAVLCALGACQTIVVAAFAQSQNFHYESFRVELEG
    DLDPDGFMGLADVRNGFQEIRFRMHFKTQESQEKTEQFAHFVEKTCPVGDCLANGVKLVLSAVIRE

    >gi|146328941|ref|YP_001210108.1| rhodanese-like domain-containing protein [Dichelobacter nodosus VCS1703A]
    MTLTQFIQANWFLVFLLTIVIIAIIICEILQRKKSGKAVSNLLATQLINDGAILIDTRTVEEFKRGHIANAKNVPMDKFQ
    EYLQNNPINQQDIFVLY
    CATGLSARKQAQLLIEQGAQHVYFLDAGMMGWREENLPIV

    >gi|146329660|ref|YP_001210172.1| glutaredoxin-related protein [Dichelobacter nodosus VCS1703A]
    MDTLERIKQQIASMPVLIYMKGTPDMPMCGFSAKAVQCLKDLETSFAYVNVLQDPEIRATLPKYANWPTFPQLWVNQQLI
    GGCDIIVEMYENGELEKLLENVVWPESME

    >gi|146329119|ref|YP_001210183.1| thiol:disulfide interchange protein DsbC [Dichelobacter nodosus VCS1703A]
    MKKIITMLSLVLTTFAIADDAVIEKKLAKLNVHNMHISAAPIAGLRTIVSDEGVFYASEDGNYFLQGTLIKIDDNGKMRD
    LSNVALLDKLKAVEEKMIVFPAKEEKYVVTVFTDIS
    CYYCRKFHHEIKDYNDQGITIRYLAFPREGVDSEIAQQMEAVWQ
    SEDRNRAFTDAINDSIPKGVPTDTIKKHYVLGNQFGIHGTPAILLTNGEMMPGYVAAKDLRKILETRL

    >gi|146329789|ref|YP_001209257.1| UDP-galactopyranose mutase [Dichelobacter nodosus VCS1703A]
    MNHYLIVGAGFSGAVLARKLAEAGHCVDLIEQRAHLGGNCHSARDVQTQIMVHVYGPHIFHTDDESVWQFVQRFGQWRAF
    THRVKTTVGGKVYTLPINLHTINQFFQKALRPEEAQAFIAQKAERNITEPRSFEEQALYFVGRELYDAFFKGYTEKQWGC
    SPRALPASILKRLPLRFHYDDNYFAHRFQAMPESGYTAVIANMLDHASIQVQCNTAFEHAMKEQYDHVFYTGTLDGYFDY
    ALGRLAYRTLDFERFEAAGDYQGCAVMNYGDRDIPFTRITEHKHFAPWETHDQTICYREYSRDCGENDTPYYPIRLLAEQ
    KMLQRYVARAQQETKISFLGRLGTYRYLDMDVTIREALDAAEIALRLAAEQQPIPVFFRAM