Desulfurivibrio alkaliphilus AHT2 uid49487

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297568034|ref|YP_003689378.1| NADH:ubiquinone oxidoreductase, subunit D [Desulfurivibrio alkaliphilus AHT2]
    MAEETRGQLFFKAIFERNPITVLVLGICSALAVTGNMATALVMSICLTLVTAIASTTISLLRENIPNTVRIGIQITIIAT
    LVILVDQVLKAYFYDLSRQLSIYVGLIITN
    CIVMGRAEGFAMSNPPDKAFLDGLGNGLGYSFILMSVAFFRELFGAGTLF
    GVTVLPLVTRDGWYQGNGMMLLPASAFFLVALLIWLLREIYPSQREKE

    >gi|297568035|ref|YP_003689379.1| NADH:ubiquinone oxidoreductase, subunit E [Desulfurivibrio alkaliphilus AHT2]
    MFGHYFEIFFTALFVENLVLTFFLGMCTFLAISRQVKTAFGLGLAVVIIQAITVPLNNLIYNLVLQPGALGWLGLADIDL
    TFLGLLVYIGVIAATVQILEMFLDRYVPALYNTLGIFLPLLTVN
    CAILGASLFMVERDYALGESVAYGLGAGGGFLIAVV
    LLAGIREKLEYADPPAGLRGLGVTFIAAGLMAMAFMGIAGIAF

    >gi|297568063|ref|YP_003689407.1| thioredoxin reductase [Desulfurivibrio alkaliphilus AHT2]
    MGIEKTNMSCPKPSSYPNSGDFHLHDLIIIGGGPGGLTAGIYAQRAALDTVLLEKGVPGGQMNNTDMVENWPGTESIGGA
    ELATAMADHVSSYGLEIQQQEVRQIEPCLGYHLVHLADGRSLAAYALIIAAGGSPRKLEVPGEDENYGKGVSY
    CAVCDGF
    FFRNKTVVVVGGGDTALEESLYLAKIAGQVHLVHRREAFRGSMILQKRVQKEDNIRLHLNAVVTAIMADGQGVTGVALED
    TQNGDRSELACDGVFVFIGFVPDNKLVPAGTKMNADGYVITDDKCETNLPGIFVVGDLREKYVKQIITAAADGCIAAQAA
    ARHVENRKGENK

    >gi|297568106|ref|YP_003689450.1| methionine-R-sulfoxide reductase [Desulfurivibrio alkaliphilus AHT2]
    MQLLFIVLLISLVFVSTLALAGGRTATAPGRAILAGGCFWCLEKPFAQQAGVLAVTAGYTGGQSPDPTYEDYAAGGHLEA
    VEIIFDPQVISYRQLLDIFWRQIDPTDPDGQFADRGRGYSTAIFYHDEEQRRQAEESKRELARQGIFSRPLVTAILPAGP
    FYPAEEYHQAYYRKNPRHYQAYRIGSGREGFLARIWGRERETNEKDNLRDRLTPLQYHVTQEDGTEPAFNNKYWDNKREG
    IYVDIVSGEPLFSSKDKYDSGTGWPSFSRPLVPENIVEHHDRRLFQVRTEVRSRRGDSHLGHVFPDGPPPTGLRY
    CINSA
    ALRFVPKDELAAQGYAEFSDDL

    >gi|297568133|ref|YP_003689477.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MPEQDYDCIIIGAGPGGLQAAIHLARFNRRVILIDQGGGRTRHALHLENYLGLIAGSGKALVDTGIKQIQSFGVTFRHDQ
    VSSVQRDHDFFVVGTGKGADYRAPYLILSTGGAENLPRIMGMNRFFGRSIFT
    CVDCDGYHTTGKKLVILGRSLQTVRLAL
    AMKQMFTPNITLVMPAGRLPDDHAELLAEDEIRFIEGEAEEFLGDGELTGVKLTDGRQLSCQVVMLSYSYILNDSFLTEL
    SLQREADGKKLATDHNCETSTKNLFALGALRAGNAQAIIAAGQGAMVGIEINQRLLEL

    >gi|297568134|ref|YP_003689478.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MKSVKLTIMAMAMAMFWGLLTLVPGAMAAEVSVAKLHAVMSDAPAQGFWQIRADELHEWIKQERTDFVVVDVRPNPAEFA
    AGHIPGAIQIPVQGILSPESLAKLPKDKKLILI
    CVTGQTQNLPVVPLRALGYDAYTMSFGYSAWIHDYHGAHTMQQAIEN
    AAPGKFPLFK

    >gi|297568155|ref|YP_003689499.1| protein of unknown function UPF0061 [Desulfurivibrio alkaliphilus AHT2]
    MASPTVSFEHSYAHELPGLYTPWQGQQWPKPQLVLLNERLAQALGLDPAALTSVEGVAMLSGHAMPDTARPLAMAYAGHQ
    FGGFSAQLGDGRAILVGEVIDPQGKRWDLHLKGSGQTPFARGGDGRAVLGPVLREYMISEAMAALGVPTTRALAACTTGE
    RILRQRGLEPGAVLARVAASHLRVGTFQFLAARGDNQLLQRLADYAISRHDPDLTEAPHRYLKLLARVSARQAQTVAHWM
    GIGFVHGVMNTDNTTISGETIDYGPCAFMERYDPQTCFSSIDHQGRYAYGNQPAIIFWNLARLAETLLPLINTDEDRAIE
    GALQVIKEAQTFYRAAWLQVFTRKLGLNRPDAALIEEMHQLWQGQGVDFTSFFRALPAALGGDEAPLRALFDDDAAVGDW
    LAGYRALASNATPELVARNNPVYIPRNQLVEEALQAASFQDDMEPFRRLLALVQAPFTHVDSAEAYARPAPHDAPQIVTY
    CGT

    >gi|297568167|ref|YP_003689511.1| heavy metal translocating P-type ATPase [Desulfurivibrio alkaliphilus AHT2]
    MAGVGALNDSRCHHCQDPLPADGGFRGERDGEEYRFCCRGCLGAWLIITGAGLEDYYRKRSWQDAGGMADVFAVEYDDQL
    LARYVRQGEEGAELAFLVEGIR
    CATCVWLIEKIVGGLEGVCTVRANYGSHRVFVVYDPDRLTPAKLFSAVARLGYRPRVL
    TRDNLHRAAEAESRDLLLRFGTAFFLAMQLMGYSFALYAGYFQGMSALTRDVMQWLAALVTTPVVFYSGWPFLIGAWRSL
    RSNLPNMDLLVALGVLAAYFYSLYATVVGREVYFETAAMIVTLILLGRLFEHHARRRAAAGVDRLLHLTPDTALRLDDQG
    QQVVVDSAELRPGELILVRPGERFPVDGMIVDGHSEVDEAVVSGESRPLARGPGEPVLGGSFNLTGALRVEVAKTTAESF
    VARMALLVEEAQSRQAPVQRLVDRLAAAFVPLVLGLSLTALLFWLWQGLGLGPAMLIAIAVLVVACPCALGLATPTAVLV
    AAGKAAGRGILYRGGDVLEASAKITHVAFDKTGTLTTGRPRVVAVRPHISAAIDEASGGASRAEEIANRLLALAAAVESG
    SSHPLAEAIVAEAESRGLLNGPVGAQPAGLPATDAVGEISAVAGRGMIAAGPAGKVVVGNRDFLLQQGIALPPRQAGRAL
    PEHLRGQDSAVGEALTEVHLAEAGRYLGVILLQDTLRSDAPALVAELRARGLQVLMLSGDNQGVAARVATEAGIEPDKVY
    SAVDPAGKKAIIEELQQGGARVLMVGDGINDAPALAAARVGCALAGGTDIAVGSAGLVLTRDRLAELAPALAMARHTMGI
    IRENLFWAFSYNMVTLPLAVAGLLAPVYAAAAMAASSVLVVANSLRLAR

    >gi|297568193|ref|YP_003689537.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MRYKFFTILLATSICLLLAATAGARAWISDLSTEELKQRMDEPRRIVVVDTRTEQEYRQGHISGAINISSQASNQFQDIA
    RLLPDDKEVPLVFY
    CRGFD

    >gi|297568281|ref|YP_003689625.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MSKKILIIGGVAAGPKTACRVKRLLPDAEVTIIDQDSLISYGGCGIPYYVSGDVSDEKELRNTSFHLTRDESFFARAKGV
    TVSTRTRAVAVNRQEKKVLVEKLADGSREELAYDQLVLATGSSPNRLPIAGADLERVFTISDLHQAIAIKELIAKGQVGK
    AVIIGGGAIGIEMAEAFVDLWGLEAAILEFMPQLLPRLVDWEFAGMLEQHLQEKGVEVFTGEGATAIEGEDGRVRRVVTP
    QRTLEADLVVMAVGVRARSELAREGGLLVDPQGNIVVNDRLQTSDPNIYAAGDCIAVKNRLTGKAGIAPMGSLANKEGRI
    VADNLAGIPTRYQGWVGSFTLKAFERCIGATGLTLESALAEGFDAAAVTTAQSDRAHFFPTQAVIPLRMVFDRQNRQLLG
    VQGFGPMGDAVLARIDAAAALLQQGATIDDVSQVEMAYAPPFATALDALNATANVADNLASGRLRCVDNAVFLAWMDDFA
    SRPDWVALDIRHPNEASVLVEKFGADKWLSIPYIEVRERFQELPTDKMMIIICDAGTRSSEIQIVLDSVGLDNNLVLGGG
    FNLIRRLGVSWLG

    >gi|297568294|ref|YP_003689638.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MSERIIDVLIIGSGPAGLQAAVHAVRKKAEVVVLGKVERSAIYQAHVENYLCVPGVTDGSELMATALEQAQKFGAEVIAE
    DVLNIEQDGELYKVKIESGRQFMARTLIFATGNARKKLKVKGEKELSGKGVSY
    CVDCDANFYRNAKVAVVGNESAAVDGA
    ITLTRYASEVHLVARKLEASPELRAELSQSPVQLHEGQWVKEIQGEQAVAGLVLENDTTLEVEGVFIELGAKGAMDLAAT
    MGVAMDPETFSFIATNKKQETNMAGIYAAGDIAGPPWQMAKAVGEGCVAGWEAANFAAKQKRADAA

    >gi|297568398|ref|YP_003689742.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MMKPRLLTSALAMLLLLFAAGCAATSGQAVPPSAAGHTQAVEQDPKLRITTQEVMELFAQEYGDAPLIEETLKKNTSFLL
    IDTRPPVRFNEGTVPGSINIPTPRFAQDIPKLPKDRTLIFYCGGLA
    CPFTGEAAVVAQEHGFTDIRAWYEGEPFWTKAGN
    YRITDTPHVQRLVEASDRENFVLIDSRPPRVHQAEHIPGSISIPWVLFEQKKGMLPADKDLPLIFY
    CGGHHCDLSHKSAV
    AALEMGYTKVFVYSAGVPDWKKADLPLWGYEAAGVEMAEVDPDALPETITAEEFVAAVQAGTVALIDVRSEREFAEGSIP
    GAINIPDGKFYEDLDAAVAKLPNDRRVIII
    CATGARSGGVFFMVSDIMLDEPELYSNPHGVQYLNQGLEYAPDGTFTVK

    >gi|297568436|ref|YP_003689780.1| DSBA oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MSFRTIASLTAIIACALLLLGGPALAGVSWQAGVAITPEEKPLDVAYSLDGSRIYILVEGGKVLIYDEQGELTGTIPVDP
    EMDRISAVGLQRAGIPEKIVVTGSASGVVQELSLRFALQINTEGAPFLGRADAPVEIVEFSDFQ
    CPHCARVKPLIEQIML
    QFPDQVKVVFKHFPLSFHEYAKPAALATMAAQNQGKFWEFHDKLFAAQSEISPQRIRAIARELELDMERFNRDLQSRELH
    SRLEQDIQDGQQAGVRGTPTIFVNGMLLEQRSPENLRQMVEEALAR

    >gi|297568462|ref|YP_003689806.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MNWKRLFSRTPSLSPAEARQYIEKHPAADFQLLDVRQPKEYEAEHLPGAKLIPIKELPDRQAELDPDRPVLVYCAVGGRS
    RAAAQYLNGQGFKEVYNMAGGIKAWQGGKAAGPLDAGLELLPATAEYDEAAALAYAMEDGLQRFYLKLAAGSEEAELATT
    YRHLAGLEDFHKKRLAREYREQTGQTLAPAEADEQGEQGELMESGQAPSVFEAATPAEIMEQAMGLEFQAQDLYLRLAEQ
    SRVAASREFFLAMAAEEKEHLAFLAKELEGLKE

    >gi|297568535|ref|YP_003689879.1| Heavy metal transport/detoxification protein [Desulfurivibrio alkaliphilus AHT2]
    MASIKIKGMTCAHCVASVTKALSSINGIEDVHVSLSENQADFSMTKEVPRATIKAAIEKIGFEVDE

    >gi|297568541|ref|YP_003689885.1| hypothetical protein DaAHT2_0560 [Desulfurivibrio alkaliphilus AHT2]
    MVNLIKIGNHVKKEKKMKVEITYCSKCNYLPRASGLEAEIKQNFPQATVELSAGSNGIYDIKVDGRQIFSKHQSGRFPDN
    QEIIALLK

    >gi|297568656|ref|YP_003690000.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MSKFDYDLGVIGGGAAGLTVASGAAQLGVKTLLVEKEEALGGDCLHYGCVPSKTLLKSAHVYQQMKEGARYGLPAITPPP
    VDFAAVAARIREVIAVIQQHDSVERFSRLGAEIRFGPARFRDEHAVEIDGQTASARAWVIATGSSPQIPAIPGLDRTPHL
    TNREIFYLDHLPDSMLILGAGPIAVEMAQAFSRLGSKVTVVQRSNQILSREDPDLAALVQRELEREGVEFLLKTAVRRVA
    DGGDRREVVVADAAGREQTIAAEALLVALGRSPNTDGLGLEQIDVPFDPRGIKVDRRLRAGHKHIYAAGDVIGGYQFTHV
    AGYEGGIALSNAVFRLPRKTDYTWVPHCTYTKPELAGLGHNEKSASAAGLNYRVLSEEFAANDRARAEGETGGRLKLLLD
    RRDRPLGVTIAGPGAGDILSQWVAIMNGKVGLARIAAAIHPYPTLSEINKKAAGSLLAPKIFSPRVRKILKLLFGYRG

    >gi|297568659|ref|YP_003690003.1| Arsenite methyltransferase [Desulfurivibrio alkaliphilus AHT2]
    MLDEWRRLTCDSRAIYVNSEKPDWVVVNNRADGLLQALQAGGSSGSLAEALCAAGREGGLDQQELATNLVTAGRLLARLG
    EQVPPYPGRGELLREGENPALKECWFHLTNNCNLACRHCLFASRPGLAAESLPAELLRRGLAEAREMGCRLFYFTGGEPF
    TYPDFTAILTGLLADPDHHAVVLTNGLLLVNHLAELQKLPPGRLHLQLSLDGLAEQHDQLRGRGSFTGLVEALQLLRRHG
    LAATLAVAVNRINVEQLPAMVDFAAEQGVGNLHLIWHFVRGIGSREQFVAPAEILPRLLAAQERAEERGVLIDNVETLRG
    QVFSSPGTRYDLANTAWESLTVGPDGHVYPSPALMGVKELDCGPLSDGLARIWQQSPVLRQIRATSLQDSEAYRQNPLKL
    LIGGGDLDHSYLAGGAPVGHDPYLELYNGLALWLIARQADSYPVPSPAVAREPAVLLAMGEVRHDCPDGGAAVSFTHCNC
    VISLADEQGRGHGPVREFYAAAARSAQDDIVNPLAPEQGLATYIPEESRRKSYGCGSPVHDAAPQPGQVLVDLGSGSGVE
    CFIAARAVGPSGRVFGIDMTDEMLALAEKSKATVVRELGVDNVAFKKGLLEAIPLPDDCADLVISNCVINLSPDKRRVFH
    EIWRILKPGGRLVVSDIVTDEPVPVAIKNNTRFRGE
    CLGGAMHQEELLAMLHSCGFAGSRLLKRFPYRQEGDTRFYSLTF
    AADKPVAPQNLEVIYRGPFAAVQTAAGVLLRQGQRLQTVLNEAERRDEAILVLDEAGAVTNLPMSGGCCPPASPEDPASK
    EAPAGAASAPLEKTLPLFTPGSGNSAGGPGAAAGSCCPSSAAPAGAGTATVRHQAGCLVCGEELRYSRQERDQACHYCGV
    VSKTNAVCRQHHYVCDDCHQRDGLSVIRAICSETSEQDMLALLAKIRHSPAIPMHGPEHHALVPGVILATYRNRGGELSR
    EAILTGIARGSQIPGGACGFWGNCGAAVGAGIAFSILLDATPLSPKPRRQAQEISARILSAVASVTGARCCRREAFIVLR
    EAAAISRELLPVSLLAEADFTCDQAVANPQCIRRQCPLLPL

    >gi|297568801|ref|YP_003690145.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfurivibrio alkaliphilus AHT2]
    MGKAKEKKSGAVLVVGGGVAGVQAALDLTELGYYVYLVEKGAAIGGAMAQLDKTFPTNDCSICILAPKLVEAGRSPNIEI
    LSNTDFLALSGKPGAFTAKLQVRPRYIDADKCTACGMCTQYCPRHLVDGYNEGLAVTRPIHIDYPQAVPATYFIDPKACL
    HLQHGTCKICVPVCQTKAIDFDQQPEELSLQVGAVVMAPGFGRVPDSVLEKYSYGKHPDVVTSLEFERLLCASGPFEGEL
    LRLSDRKHPKKLAFIQCVGSRDLGCDNGYCSSVCCMYAIKEAMVAKEHEPELEITIYYMDLRTQGKGFDAARARAESMGI
    KFVRARVADVMPWERQLKLTYATMDGSHFFEAYDMVVLSVGLDSPADAEKLADIADLKLNDYKFCQTDTFTPLLTSREGV
    VVAGAFQGPKDIPESVTQASAAAGIVSALTKAQRGKGFVVKTYPEEQQLADDGEVRIGVFVCHCGVNISSVVDVNNVDQY
    VEGMDGVVYHAQSLYACSQDAQEVLKQKIKEHDLNRVVIAACSPRTHEPLFQETLKDAGLNRCLIEMVNIRDQCSWVHAN
    EPEAATDKSRDLVRMGIAKARHIKPLPEQTVPVTKKALVLGGGLAGMTAALNLAEQGFPTTLVEKEKELGGHLRDSFYTL
    QGDEPAKVLADLVGRIKKEKNIEVLTNSELAQVGGYVGNYSSVVKSGGGKSAKESTIDHGVIVLATGGREHRPEKVLDSP
    VKYSAKVVTQSELERRLAGKAKNRAPDSVVMIQCAGSRGDDLGYCSKNCCNEAVKNALKIKELNPESQVVVLYRDLRTYG
    YAEDAYRRARELGVLFIPYSLAGDKPKITAGGRGAPKVTFYDPILRDEVSLSPDLLVLSTGIVAEGSIELSRLLKVPVNE
    DQFFLEAHVKLRPVELPVSGVYVCGLAHAPKPYDEIVAQAQAAAAKAAIPLYKGLVTVEPTVSTVDKDGCIGCGLCESLC
    PYQAIRIYKDDNNKRKAETITASCKGCGICASHCPVFAISMGGFTDEQISAQIKAFGDN

    >gi|297568849|ref|YP_003690193.1| UBA/THIF-type NAD/FAD binding protein [Desulfurivibrio alkaliphilus AHT2]
    MDYSAEQLERYSRHIILQEVGVEGQEKIAAARVLIVGAGGLGSPAALYLAAAGIGTIGIVDGDVVDLSNLQRQIAHHTKD
    VGREKVLSAQEKMVAINPGVKVQTHRMLLKADNIREVIRDYDFVLDGTDNFPTKFLVNDACVMENIPFSHGGILRFDGQT
    MTVLPGKSSCYRCTFRQPPPPDAVPT
    CSQAGVLGAIAGMLGTIQAAETLKYFIGTGELLTDTLLSFNALNMTFRRVPLRR
    QENCPLCGSNPTITELVDYEQAACAI

    >gi|297568904|ref|YP_003690248.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfurivibrio alkaliphilus AHT2]
    MMVMQPGLKSAKQPVASCCRLLFVLLLGFLLLLAACGKSERRLQLGDPAPDFTATDQHGNTIRLAELAGGPVVLRFWSVD
    CKYCRADTPIFNDYYRRYKDQGLMVIYISLNEDQEMVRRFIADLEIEFPVIIDHGGRIAEQYRVRLDPQAVFINPEHKLA
    TAVLGGVGEEEMARLLGGYLQ

    >gi|297569225|ref|YP_003690569.1| protein of unknown function DUF395 YeeE/YedE [Desulfurivibrio alkaliphilus AHT2]
    MAKQKWYQPYLLGGLAGLLLTASVGITGSFFGTSTTFPRLSTWIADKVGIDLSHLAFYQAGNGSLTGAAFPDWQLLFVIG
    IGLGAFIMSRLNGSFKLESLPPMWAARFGDRLGLRIVHSLFGGALVMIGARIAGG
    CPSGHGVSGVSQLGLSSMLALAMFF
    LGGIITARILYQGGK

    >gi|297569235|ref|YP_003690579.1| HesB/YadR/YfhF-family protein [Desulfurivibrio alkaliphilus AHT2]
    MLEITELASKKLKAYLEDNSIDSPVRVALMQGGCAGPSLGLALDEPKENDTTHTQDGVKYLIDNGLSQQCGAVKIDFIDA
    GARSGFSITPANPLGGGGCGSSCSTAGGSCGC

    >gi|297569440|ref|YP_003690784.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Desulfurivibrio alkaliphilus AHT2]
    MTDERSAPSGAVLVVGGGISGLTAALEAAEVGQDVFLVEKNPYLGGRVAQLNQYFPKLCPPSCGLEINYQRIKNNRKIRV
    HTMTEVKSVSGGPGNYQVTLSVKPRYINSNCTCCNACVDACQDEVDNPFNFGMDKVKAIRKPHEHAFPARYVLDKDACSS
    ASLDAIVAACKYDAVELDMQEREITVDVASIVWATGWNPYDPVNMENLKFNSSPAIISNMMMERLASVGGPTGGKILRPG
    DNAEPASFAFVQCAGSRDENHLEYCSYICCMASMKQINYIRAQYPEAPITVFYIDLRTPGKYEKFREKLMADENITWIKG
    KVADIVAEDDGSVTVIAEDAVSGNKAQAKVDLAVLATGMQPAIGEQAKALGLTTDDNNFIVSQEEGMISAGCAKKASDVV
    TCAQSATAAAMKAIQASRR

    >gi|297569580|ref|YP_003690924.1| DsrE family protein [Desulfurivibrio alkaliphilus AHT2]
    MSWLFVISSNDPETVFNAARLANASLKQGKEVNMFMLGRGVEYEQISSEQFDISGQLAEFDNLGGNFLVCGTCIKSRGLA
    GSASCPLGMMTDLYQMVAESEKVLTF

    >gi|297569582|ref|YP_003690926.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MKTITTVTKSRGGRWLATGLVSLPFFVLLVLLCAGSAGAGGSVPPGANPHLLVTPLEVWENREHWLIIDLRDRESYLEGH
    VPGAIHLGDRGHKMLREDRYILFYGDQDIDPKQGKLIEHLEPRPVAELEQVFAAAGVTREHTVILYSDLEDTLPGYTFVP
    FVILEYLGHEDVRVMDGGIENWWAHRLPLGQGENRLPPSDFRARLQPQVIAHEAEVLRLARFNPSYLQDIGVNPHQFELP
    QLVDVRVDVEHSGAQPAPPGHFLYDSVIRTGRIPHTIANVPHWQQFADFESLRLKPIAELDAMYGDLDRHRRTIVY
    CYIA
    NRASMSYFVLRLLGFSDPAVYHDSWIIWGNNPRLPLVRDRGVEVARTPLAGGY

    >gi|297569606|ref|YP_003690950.1| thioredoxin [Desulfurivibrio alkaliphilus AHT2]
    MASDKLLEISDADFDAQVLKNSLPVLVDFWAPWCGPCKAIGPVIEQLAEEYAGKVAIAKMNVDDSPSTPGKYGIRAIPTL
    IMFKNGEVVDQITGAVGKPQLAALIDKAL

    >gi|297569646|ref|YP_003690990.1| methylated-DNA/protein-cysteine methyltransferase [Desulfurivibrio alkaliphilus AHT2]
    MADIFFASLCCRHALLTCWLLLTPAGAVHVSFSAGDHQRAMAKLLTAAPKTIIPPATGTNLGDRSPAFYRRLPPTHPAIR
    AGAEQTRSEILAYLDGRTTDLVAPALSPFLLAGTPFQQRVWARLSLIPYGETCTYGEIGTALGNRHLARAVGAACGANPC
    PLLIP
    CHRVVAVNGPGGFSGGGLAIKKKLLALEGTVAKERP

    >gi|297570037|ref|YP_003691381.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfurivibrio alkaliphilus AHT2]
    MSYEHDVDCCCGAIQVGQEVPDFELETYEPAKGDFGKFSLSEQKKLGKWTVLVFYPADFTFVCSTELADLADEYENLKAA
    GAEVVTVSTDTVFTHLAWKREEKFLENARYPMGADRTGQVSRMFGVYNEETGLDLRGTFIISPAGELVASEINFYNVGRN
    AKELLRKLQASVHVANNPDEACPARWEQGGKTLTPGPQMVGKVYDALK

    >gi|297570084|ref|YP_003691428.1| heavy metal translocating P-type ATPase [Desulfurivibrio alkaliphilus AHT2]
    MKEAKTATDRLELKISGMSCASCVARIEKVLARQEGVASARVNLAAEKGYVDYDQGRITPEELMAAVDSLGFTAAPAEQD
    SAAVDRERQEREQALRRLKLDFSLAAVLTTLVLYGSLPEMVPMAWHDWAVGVVPAWLGNPYTLLLITTPVQFFSGWRFYR
    GAWASLSHGTSDMNVLVAMGTSSAWFYSAAMTVAPDFLTGLGFPYQLYYDVATVITTLILLGRLLEARAKGKTSEAMRKL
    MGLKAKTARVVRPAEQAEAETIVDIPIEEVQVGEIILVRPGEKIPVDGEIIEGRSSIDESMLTGESLPVSKESGDQVIGA
    TINKSGGFKMRATKVGKDTMLAQIIRLVEAAQGSKAPVQKLVDRIAAWFVPAVIITATVSALFWWAYGPEPSLIFALTVF
    IAVLIIACPCALGLATPTAIMVGTGKGAENGILIKGAESLELAHKLDTVVLDKTGTITAGTPAVTDIFTLTGMLDENQLL
    ALVAAVEQASEHPLGEAIVREAVERDLELAPVSDFTAVPGHGLQAAVAGRRLLVGNARLLAREGVALEERWQKQAQELAA
    QGKTPILVAVDDQPAGLLAVADPVKESSAAAIAAMRKLGLTVVMLTGDARHTAEAIAAKVGIDRVMAEVLPEDKESAVKD
    LQHEGRLVAMVGDGINDAPALARADVGIAIGTGTDVAMEAGDVTLISGDLNGVPTAIRLSRATMRMIRQNLFWAFFYNIV
    LIPVAAGVLYPFWGIILNPMLAAAAMAFSSISVVLNTLRLRWFH

    >gi|297570276|ref|YP_003691620.1| Redoxin domain protein [Desulfurivibrio alkaliphilus AHT2]
    MSRHLAPLPLLLFCLFALVLLTLPAVTGCSRSDGPVTSMPTFSLASAQDGRTIHSRDFAGKTLVVTFFATWCPPCRQEVP
    TLIALQNKYGDGDFSVLGISVDQGDTRTVRNFMNELGINYPVVMSDADTPRNFGDVFGIPTTFLIDRNGEIIQRFDGYVD
    IRILERELQSIL

    >gi|297570352|ref|YP_003691696.1| protein of unknown function DUF395 YeeE/YedE [Desulfurivibrio alkaliphilus AHT2]
    MSEGSVLGQQAKELYKILCQDKWNPYTTGIIIAFLSVVIAAWYTSWGATGAVQNWGDWALYGVGVNESAPGNIFLHSGSI
    IGIGFIAGAFISACLGGNFAFRIPPRIEMLKAVIAGSLMGIGAILGGG
    CNVGGFYNALGNLSAHGFAMFFGLIIGAILAL
    KYTYWEMENVSWGQGGAKTFNVPPALQIVLGIGALAALIWGAYAYAGSEEYFWGMGAWQPLGVLGGVLLLAAALGYVFQR
    GRWCMIQGFREPHMTGDCKMAKAVALSIVLLVIGIAVLKYQGIVSADHYLRGVFGWGGVLGGVIFGFGAVLAGG
    CGTGAL
    WRVGEGQIKLWIVVPFFGLGAALTSKFIHGPRDIEGIIAWYQAGTPLPFSEGMLGSFTYLPNTWLGWGGSLAVIFGAMAA
    WWIAVTWNEKTQKGVLEM

    >gi|297570356|ref|YP_003691700.1| redox-active disulfide protein 2 [Desulfurivibrio alkaliphilus AHT2]
    MESPLQRSLKVGRAVIGLLGLDVALGKALADQDHPREQILERLYRQVAEQNYIPPGREELYHQALAQEYDRLQRGEQRQD
    GTLQIRILGPG
    CVSCNRLGTMVLEVMSELGIAADILQIQDPDEIGRFGMPRTPALVINDQLLCAGRQPAKAKLEEWLREA
    ADQQNSSNRQ

    >gi|297570382|ref|YP_003691726.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MASKYLNHGKPTRLYALLGLLAGALLLLTGCGGTDYDAKAASNNNPNVMIDADTLNNWVEGGYGTDSKGYDRMVILDVDS
    AAGYEAGHIPGAYHLDTGNDLRAERSNGVSYTPSQVPTATQMDNLIQRTGIDERTVIVLVGNGNMMNVGRAYFNFRYWGF
    PRERLRVLNGTKTATYQDAGGYALAENSPPAPRSSNYSVTDLQANINLRASLEEMISVAENGADSTVILDARSEGEYEGE
    DLRGGVAFGGRVRGAQLQEWTTLLDPNNPTAMLGKNELLAIMEEAGAGPGTTAYTY
    CQTSWRAAVNFLALDAVLRWPAKI
    YDGAWVQWGMMARNDMNYGGALMPDSPWRTDTTARSEAINYENRIVEPLANADSFAPRANLINETDKNTCDTNPPAPNDR
    PVEVMLSIADLADWQANGAPTANGDPYDYDNFVVLHVGAAAAYEEGHIPGAFLLNTAADLSATRNDGIADTVSQVPTITQ
    MNDLIQRTGIDEDTIIVLTTGPGNPNMMHLGRAYFNFRYWGFPRERLRVLDGNSGHFAEETGTALATEAPAEAASDYSVC
    ELPQDTAKDRFRASLQEMMAVTDGSGTPLGAVPAAFTIIDARSAAEYNGDPGTTWVSNDIARTYVAFEGHIEGAGHQDWV
    TLLDENGRLLPLNELETAMNDLGADENTTTYSY
    CRTSWRAGVTFLALDAALNWPAKIYDGAWIEWGQMARNESLYDGSLN
    PASPWRTDKADYSGQITYNKTDETNYLGANSYAPFANRINQEDASISGAPCCVETDPGAFDPIPDGIAPTAPGYR

    >gi|297570386|ref|YP_003691730.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MQRLRNKVAQLGVVLLAAFLLTACGMAGKTATPDTGPRHVEQDPQLRITTAEVMDLFDKVYGDRALVKATLDTNDQFLMV
    DTRPKGRYQEGHIPGAIHMTPGEVAANIDKLPRDRQIIFY
    CGGLHCPLSTQAAKIAMEHGLTNIKVYYEGDPGWKAAGNY
    LISETPYIYHLMTAEDANFILVDTRPTNVHRQSFIPGSLSIPINQWDLKKSLLPRDLNTRLIFYCGGYG
    CPHSDRAARRA
    AQLGYRDLFVYLAGEPAWKEAGLPLWGNEPSGVVALEPKELPKVAPGTLPRSINAAEFNKMMAEKGGEIVILDVRSADEY
    AAGHLPGAINLPDDKFHANYEQLVSKVPTDKQIVIH
    CVTGIRAEGVYHALATRGNYANPKGVQFLNATISISADGKFDIR


    >gi|297570518|ref|YP_003691862.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MRFKNQNMKRSRLLSAICLTITLLLAAIPLYAAEFPGRSQYPAAQVISSDDLHRLFKADKAVLVDVRSVIEYSVIHPVGA
    VHINLSSLSFERETQELAAKHPGKQLAFYCNGVT
    CMRSYEASIRASESGVANTLAYDAGIPDWAVKFPADTLLLGQPITD
    PGKQLISDEAFAARNISFTEFRLAAAVANSMVIDVRDHVQRDRNLPDLSGVRHIPLDNFIPNFIERKANQDKKLLIFDQV
    GRQTLWLQYYLEANGYRDYAFLQGGAVAVLGTQEYQR

    >gi|297570522|ref|YP_003691866.1| Rhodanese domain protein [Desulfurivibrio alkaliphilus AHT2]
    MGKSFFAIACAVLLIASQPVWADENPILVKQGEMFAEAREVIKQITVHDVRRMIDEGEAFTLVDVRDPEELAAGVIAYDG
    LVTISRGKLELLAPDKLDMNERIVVV
    CQTGIRGILAAHTLVKLGYTNVSNIQCGIEGWAFSDYPIRNSLGTFVMK

    >gi|297570548|ref|YP_003691892.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Desulfurivibrio alkaliphilus AHT2]
    MAEKQYDLVVIGAGSGMTVVQYAAASLGWKCALVEKGPLGGTCLNRGCIPSKRLLHSADIAETVRQSARFGVKARIDQID
    FAAIVRNANEYVDRQAAAMERAMKDQDAVGYYKGEGAFLSPHELRVGDERITARRFVVAAGCRPLIPTIDGLDEVDFWTS
    DQALRPPAQPRTMIILGGGYIAVELAHFYGSMGTEVTIVQRSPRLLSREDEEIAEVLTEIFADRYRVLTGTEVNRVSQAG
    DGRKKVTVTSNGKTFDLEADTLLVATGLQPNSDILKLENTEMEMDQQGYIKTDQHLATTQKDAWALGDIIGQAPFKHAAN
    QEALVLARNLAGGEKFAMDYSAVPRAIFCSPQIASVGLTEQEARARQLKYEVRKFSFTDTAMGDAMGEDRGFIKYLLLPE
    KGRIVGCHIIGAQASILIHEVIVAMASGAGVNALLSAIHIHPSLSEVVQWGL

    >gi|297570560|ref|YP_003691904.1| protein of unknown function DUF395 YeeE/YedE [Desulfurivibrio alkaliphilus AHT2]
    MITGSLVLIIITGLLLGLAAGFVMHRSDYCVAGMFRDAFIFGRFKGLQILLLQVAVTMLLFELARQAGLLPLYPFPILAP
    PALVNFLGGIIFGLGMVLAGG
    CVFGTLYKMGAGSVVSAVAFLGLILGSGLYALVHPWWQQLAQATALAPGRITVPQLFNL
    DPLLPLIIFWLPTIFLLWRWGRQGALQRPAVVAGYLQPWRAAIILALIGLASYLLHGMPMGVTTSFTKFAAMGAAVVAPD
    WVAGQTLFQAVSLDVIHPDSGARLTGGPGPQPDLLFAIQVPLALGVVLGSTLSALLLREFAVRLRVPPLQLLSALAGGIL
    MGLAARMTPACNVWHLMGGLPIMAMQSILFLLGLFPGTWLGVKLFRLLVR

    >gi|297570583|ref|YP_003691927.1| HesB/YadR/YfhF-family protein [Desulfurivibrio alkaliphilus AHT2]
    MIEVTAVAADKIKEYMAANKVDSPIRIMAQNGCAGPSLNLVLDQAGDNDQLVQQHDLTLLADREMLAATGKITIDYREAS
    SGCGCGGGGFTVSSEKPLSGGGCGSSCNTGSCGC

    >gi|297570585|ref|YP_003691929.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Desulfurivibrio alkaliphilus AHT2]
    MNAPLAGKNKDSVAPAKPVGAVLVVGGGVAGVQTALDLTPLGYKVYLLEKSSAIGGVMARLDKTFPTNDCSLCILAPKLV
    EAGRDPNIEIITKAELIGLDGDAGAFTARIRRRPRYIDEEKCTGCGQCAQYCLKLLGDDYNENLSRTSAIRIEYPQAVPT
    TYHIDDSVCLRLKHNTCGLCTAVCQARAIDFSQQEEILELAVGSVVLAPGFGRVDEEVMRRYGWGQFDDVLTAFEHERLM
    CASGPTGGEIVRPSDERHPRKIAFLQCIGSRDETCGNNYCSSVCCMYAIKQATLAREHEPEAEITLFYMDIRTHGKGFDA
    ARERAVKENNFRVIYARPPKVEDLFDGKLLLTWSDESGHHNYEKFDLVVLSQGLEALPDAQALATAAGIDLNHYQFAATD
    HYAPLATSRPGVYVIGAFQGPKDIPDSVTQAGGAAALCAGQLAPARGSATISASFPAETEVAGEEPRVGVFVCHCGINIG
    GVVKVPSVAEYAATLPHVVYATDNLYSCSQDAQGQLVAAIHEHKLNRLVVAACTPRTHEPLFQATMREAGLNRSLFEMAN
    IRDQCSWVHMHEPEAATAKAKDAVRMAVAKAALLTPLAEQQLPVTPSALVVGGGLAGLTAALAIAEQGFAVTLVERSSRL
    GGQALKLTADRHGNDTRPTVAELAHRVRKHKLIKVYTGSEVSAVSGYIGSYSSTLNTRNGTVVINHGVVVLATGGRPYQP
    DQYLHGRSSRVLTQMELEGKLTAKTLPRTWNRMVMIQCAGSRGEDLSYCSRVCCGQALKNALRLKKRRPEMQITVFYRDM
    RAYGFMEDDYRRARELGVNFIRYQPDNPPRLEKARGVEGPLQVSAFDPLLNEELQLAADLVVLAAGIVPEDPVVLAGMLK
    TPVTAERFLLEAHVKLQPVDLPVDGAYVCGLIHAPKGMDETIAQAQAAAGRACQPLAKGTITPAPIVSRVETEKCIGCGV
    CETFCPYKAIRLHKVEKGRKAETVTASCKGCGVCAARCPTLAIDMGRFTFDGIMAQIKAFGQEEGENNV