Desulfovibrio vulgaris Hildenborough uid57645

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|46578451|ref|YP_009259.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio vulgaris str. Hildenborough]
    MFKRLLATLLIVLTLVPVAGAADNRDELKETLRTLLRDNPDLVLEVLREHSETVLEIAQQGANQRRRKVLVAQWKTDLED
    PKKVNLADRPVRGEANAPVTVVAYSDFT
    CPYCQQAAGTVEMLLANYKGKVRYVFKQMPLETHENARTASNYYVAASLQDP
    AKAWKLYEAVFADRDRLVTEGEPFLKKVAQEAGLDMQRLATDIKGRKVKALIEEDMAEARKLGVQGTPYFLVNDLVVRGA
    LPLDLFSDAVDMALEKAGAKK

    >gi|46578699|ref|YP_009507.1| AhpF family protein/thioredoxin reductase [Desulfovibrio vulgaris str. Hildenborough]
    MLVYAPRGPAPRPAPLHRKGRMFMAYAPQTGRGTVAALPPLCRHRRRKASTKRIRPFTRCARCLLHAMGMAMSSHRSTGV
    FTMSGLFKKKETAAQAADTQTQTPTPEAHEWLIPEEGRDQLQKVFAGLPGDVTIEVYTGGDPKNLFDDYARRFVADLALL
    APRIKPAFHGLDSDMARKRGVTLSPTLLFNPEEYRIRFTGAPLGEEARAFIEAIFLVSARTSGLSQAAKTILAQLDGARS
    PRVFSSPG
    CPYCPAQCANAIKCAIERPDLVSAECVNADEFPDLSARYGVGSVPHTQFDESYKGIGLMPEERFVVELVALK
    DAERWLNEHAAKGGAHGAGTGQGAGSDAGVEVTETDLLVLGAGPAGLSAAIYAERSGLATVVLDKGIVGGQVTVTPVVEN
    YPGFADIAGIKLVEVLSSHARQYATIRENEGVDDIKLGRRIEVHTPRNVFLARAVLFATGAQWRKLDVPGEDRFYGKGVS
    Y
    CASCDGFVYRGRKVAVVGGGNTALTDALHLRNLGVEVTVIHRRDTFRAEKALQDSLTREGIPVIWNAVVEEVMGDTEVR
    GVRLRDTKTGETRDVPFDGVFVAIGHVPNSEQAADLGVDLEPDGSIKVDRHMRTNIPRVYAAGDVIGGVRQIVTAVGSGA
    TAALSAFEDLQQPRWKKDKSA

    >gi|46578775|ref|YP_009583.1| HesB-like domain-containing protein [Desulfovibrio vulgaris str. Hildenborough]
    MINVSETALKELEAYFTDHEREPIRVYLAPGGCSGPRLALALDKPGDDDLTADVAGFTFCINKALFEKVGKVSIDMGGMG
    FSIATEIPLPAPAGGGCSGCGSSSSCCG

    >gi|46578793|ref|YP_009601.1| thioredoxin reductase [Desulfovibrio vulgaris str. Hildenborough]
    MSHAFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELAQRMQEQVNNLGVTVEEA
    VCIDSMDLTGPEKRVEADGEVYTAKAVIVATGRKPVPLEAAGECEQVHF
    CAICDGAPYIGKRVLVVGGGNSGFDESLALL
    DQGIAELTLVERMDRFFAAQKAQDLLAARPNATLMRSTEVVSVDYDETLRSVTLRDVATGEVFTREFDGIFVFMGQKPGT
    EVFRGQFDMDAQGYIVTDENMATSLSGVYAAGDVRQKKYRQLTTAMADGTMAALEAERFIHSAPA

    >gi|46578794|ref|YP_009602.1| thioredoxin, putative [Desulfovibrio vulgaris str. Hildenborough]
    MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIR
    DGKVAKVFSGIMNPRELQALYASI

    >gi|46578990|ref|YP_009798.1| methionine sulfoxide reductase B [Desulfovibrio vulgaris str. Hildenborough]
    MKPSREELKKRLTPLQYDVTQEEGTEPPFRNEYWDEKREGLYVDIVSGEPLFSSRDKYDSGTGWPSFTRPVDPQGIVERV
    DRKLFTTRTEVRSRNGDSHLGHVFPDGPQPTGLRY
    CINSAALRFVPVEDLEQQGYGHLLHLFQ

    >gi|46579138|ref|YP_009946.1| hypothetical protein DVU0725 [Desulfovibrio vulgaris str. Hildenborough]
    MTDPRTPLQTTGPNRLATAPSPYLRQHAHNPVDWHPWGEAALALARERDVPLFVSVGYSTCHWCHVMAHESFEDAEVSQA
    LNEGFVCVKVDREERPDIDALYMNACQMLTGTGGWPLTIFALPDGTPFFAATYLPKRSRGGRAGLLDLIPRVRDIYATRR
    ADVEASAADIAKAMRERAAELLQSPPDGRTPAAGTLRAAFNDLVANFDTAHGGFGGAPKFPSPHLLLFLLRHGRRTGDSR
    SQDMALATLRGMLRGGLWDRLGGGIHRYSTDARWLLPHFEKMLHDQAMFMLATAETWLATREDDMREAALATADYILRDM
    ALSGGGLAAAEDADSLTPEGKRREGAFYTFTFDEVREAAGDNADLAVRLFGITGEGNIADESTGRREGHNVLHLPLGDDA
    ATTLGIDAEELAFRHDDILAGLRSLRATRRRPHRDDKLLTDWNGLAIAALARCGHVFDAPHLTDAAASLADAVLTLQHTP
    DGGLLHSRFEGTGSTPGFLDDYAFVIWGLLELYTATNQPQWLEEAIRLQHAQDDRFLDPVDGGYWHTPADAPRTAALRLK
    EARDGALPSGNAAALLNLLRLARLLGDASYEEKAHGLIRAFASQVRHNPLGAAMFLCGVDFALTGGRLVIIAGEAQAPDT
    EAMLDAVRRSYSPNTVMHLRDGNTAERLAMLAPFTSHLAPIDGKTTAWLCQDNACSAPIQDPAALAERLAGARPL

    >gi|46579204|ref|YP_010012.1| methylated DNA-protein cysteine methyltransferase DNA binding subunit [Desulfovibrio vulgaris str. Hildenborough]
    MVDVLVAAPLRLELHWEQGVLAETVLGWAGEGEKPVLLTEEARSVQACLVRYVAGEDVEWPSLPLAWDRVTPFRRRVLQA
    LVADVPAGAVTTYGDLAARAGSPDAARAVGGAMANNPWPLLIP
    CHRVLGGGGRLGGFSGAGLPMKRWLLDHEGCADKGAR
    C

    >gi|304569687|ref|YP_010035.2| bacterioferritin comigratory protein, putative [Desulfovibrio vulgaris str. Hildenborough]
    MQMRPIDLTDRPAPPFSLDDAQGTQRTLASWLGTWLVLYFYPRANTPGCTREGVEFTSVLPDFTALGATVVGISPDTPKT
    LCNFAAKHSLGVTLLSDRDRSVAEHYGVLQMKRLYGKESLGIVRTTLLVDPEGVVRHVWSPVKLEGHAEDVLSTLADLVQ
    R

    >gi|46579261|ref|YP_010069.1| heterodisulfide reductase, putative [Desulfovibrio vulgaris str. Hildenborough]
    MSNSILVVGGGFSGLTAAIEAAEVGYEVFIVEKSPFLGGRVAQLNKYFPKLCPPSCGLEIQFQRIKKNPNIKFFTQAQVT
    AVKGEKGNYTVSVRIEPRHTVPNSADLSMLAGALEGEVENEFELGLAKRKPLYLSTPFAFPNRYVLDKNALSQADQLKVG
    ASAFCDLNEGPREIELSVGSIVLATGWKPYDVTNLSNLGAGKIANCVSNMQLERLAAACGPTKGAITRPGDGKSPRKIAF
    VQCAGSRDQNHLNFCSYICCMASLKQALYVREQYPDAEVTVYYIDLRTPGRYDKFMRKVRADEKINLVKGKVAGVEEDTA
    TGDVIVEVEDAVKGEKRKVRYDMVVLATGMQPSLAGQKLPFDVPVDEDGFIVGGEEKGIFAAGCAQKPLDVMRSAQSGTS
    AALKAIQTVRGR

    >gi|46579296|ref|YP_010104.1| glutaredoxin, putative [Desulfovibrio vulgaris str. Hildenborough]
    MSGCSVKLFALSTCVHCKNTRRFLEDHKVDVDCIYVDTLQGEERKQVVEEVKKHNPKLSFPTVVCANGKVIVGYREDELK
    EALSL

    >gi|46579412|ref|YP_010220.1| thio:disulfide interchange protein, putative [Desulfovibrio vulgaris str. Hildenborough]
    MRHQTRVSNIAISCVLAAFLLLLPGLVPVLVPWATLDGGALSAHAAEPVTFSTELAHDRETAGGIIVLWIDPAPEYHAYA
    HEPGVDTRPTVVSVHDRSGTPLDLPVLYMPGEPLDDPFTPGRIVNAYGPKTPVFVKVPALLAGGDVIVRTSLLLCSDRNC
    QPVRHDIVVTLPGEGAFAALPDAASRPWRGKLAQAVPGRPVAGAVAPGMTGTPSAGAVGDGAAIGMGGVTPTPRDAAPGT
    GGSLPFPSSTGVDTTATAGNVARGEEEQAQKAVSGIVSVSPEGTSSGVAVSRSVSGAAQESPAWSFAPRYFAPELEVSGL
    GKALLLGLLAGLILNVMPCVLPVISLKLSGFIATSGAPGDEGVRRRAFREHNLFFAAGILVWFVVLAGILAVAGLAWGQL
    FQRPGVLFGLTLVVFTLGLSMFGVFSLPVLDLKAGTTGSPRAQAFMTGVVATLLATPCSGPLLGGVLGWAFRQPSSVLAL
    VFAFVGLGMASPYLLMAARPGLVRFFPRPGAWTGVMEQVVGFFLMATSVYLLTILPAALLLPMLVTLLVAAFAAWLWGTW
    AGPGASSVQRIAVRCVAVALVGMTVAWALSPPADEARWEPFEATAFRDMLGRQPVIVDFTADW
    CPNCKLLERTTLNAANM
    ARWQKAYGARLVRVDLTRDDPVAQALLHSLGSSSIPVVALFPTGLLRNAPLVLRDLFTADQMDEALERAFGPAGQPLQP

    >gi|46579450|ref|YP_010258.1| mercuric reductase, putative [Desulfovibrio vulgaris str. Hildenborough]
    MDYDADLLVIGGGAAGLTVAAGAARLGARVVLADRGPTLGGDCLHHGCVPSKTLIASARARRTMRDAPRFGLPEVALPPV
    DFKAVAAHIAGVQSVIQKHDSVERFSGLGVEVRFGDAVFVDEHTVAVEGRRISARRIVVATGSSPQIPAFPGLADTPYLT
    NRDIFTLETLPASLIVLGGGPIAVEMAQAFARLGSRVVLVQRGGHILSREDADMAAVVHEALEQDGVRIMTGATVEVARR
    QDAGVVVTVRVGDEHVDVHGERLLVALGRTPNVEGLHLGNAGVVFSERGVPVDARMRTSQSHILAAGDVTGAWQFTHAAG
    YEGSVVVANAVLRLPRKAKYDRMPWCTFTDPELASVGLNEREAHRQGIGVDVHTESFSSNDRALAEGTACGLLKLVLARG
    TQRVLGVQIAGPHAGELINGWCMALGGGVRLTTLAGGVMPYPTLGEISRRVAGNIVSEALFSDKVRNVLCTLFRYRGKGC


    >gi|46579639|ref|YP_010447.1| thiol peroxidase [Desulfovibrio vulgaris str. Hildenborough]
    MTTERTGIITFKGNGLTLLGTPAGVGDKAPSFNVLANDLSPRTLGDYKGKVVIISAVPSLDTGVCDMETRRFNQEAANLG
    EDVKILTVSCDLPFAQARWCGAAGVQAVETLSDHKDLSFGMAYGVVIKELRLLTRAVFVVDRNGTITHAQIVPEVTTEPD
    YAGAIAAAKKAI

    >gi|46579743|ref|YP_010551.1| selenide, water dikinase, selenocysteine-containing [Desulfovibrio vulgaris str. Hildenborough]
    MTVDRLTSRSRAAGCAAKIAPGDLERILATLPRDPREGERVVVGTRDNEDAAIVRVPGGKAIVQTLDFFTPIVDDPYLFG
    QIAAANALSDVYAMGGEPWCALNIVCFPVKELPEDILADILRGGADKVREAGAVLVGGHSIEDESIKYGLSVTGIIDPDC
    YATNTGLRPGDVLLLTKPLGSGVLATAVKAGWDGFEAHEQELGRWGAMLNRAGGRVIRELGLAAATDVTGFGLGGHLLEM
    ANASNMSVHVDVSTLPLMPAVLDLVATGLLPAGSHANRHFCSGNVSVHPEVDSLLVDIVFDAQTSGGLILAVPPHLVDDA
    CSILRAEDAPFWRIGHVEEMGEGVPRLVLQP

    >gi|46579793|ref|YP_010601.1| HesB family selenoprotein [Desulfovibrio vulgaris str. Hildenborough]
    MFELTDNARKELEAYFADKQKTPIRVYLAPGGCSGPRLALALDEPNESDNVFKEGDFTFCVNSDLLSQIESVRIDLTYMG
    FQVEPGKPLAGGGGSCGGCGSSSSCCS

    >gi|46579834|ref|YP_010642.1| 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase [Desulfovibrio vulgaris str. Hildenborough]
    MTYDVVILGAGPGGSRAALEAAAAGLRVAIVDKGSFGGTCLNWGCIPTKLLLGGTAAHPLLEVQKKLKTAQGTIDFDLTA
    LQARKTRFINGTRQALEKQLRQAGIEVITGTARLAGPGHVEVVDGEGTRELAARNVIVATGSVPASFPGLAPDGEAVLDS
    TALLDVTEVPDSLIIVGGGAIGLEMGDFFSRLGTAITIVEGLDRLAPTEDPEIGQTLGKLLKREGWAIHTGRRVASLSTV
    EGKAQLRFEDGTELVADKALMAVGRRPATAGLGLETAGATLLGAGWVETNDHLLAAPGLYAIGDVNGRTLLAHAADHQAR
    FVISHIASGSASSASGYPAPVMPSCIYGHTEVMRAGATVAELVASGHDVHVSTSQLIANPIAQAYGTTGGFIRVLWVEGQ
    VRGISAVGHGVSHLVTLATVIVSQRWRWEDVHGIIFAHPTLDEALEAALLAPSQKV

    >gi|46579868|ref|YP_010676.1| thioredoxin reductase, putative [Desulfovibrio vulgaris str. Hildenborough]
    METRPLVIIGAGPAGLSAAVYTARAGIPTLVFGSAPKVAGDYDIDNYFGFDETITGRELIERGRRQAERFGAVLRDDRIL
    GLHHGDDGGFRITTEAGETAACAIILATGVSRVRPGISNIADYEGKGVSY
    CVSCDGFFYRGLRVKVLGEGVFAANQALEL
    LHYTPHVSICTQGKAASITPEFMTRLDEAGIAVDDRKIASLEGTPALSVLRYEDGSTEEAQGLFIAMGEASSLDFAYTLG
    VERNGVFLGADSDQRTNIPGVFAAGDCTGGFLQIAVAVGEGAKAARAAISYIKEECPFATSRRNTTTES

    >gi|46579945|ref|YP_010753.1| hypothetical protein DVU1534 [Desulfovibrio vulgaris str. Hildenborough]
    MSDSGRWNPYVAGGLSGLVMVGSVALSNAYFGASTTFVRMAGMIEKAFAPEHVAGLAYFTKEAPIVDWQWMFVVGILLGA
    FVAAMLSGTYRVQAVPDMWRERFGTSAGLRGVAAFVGGFLALFGARLAGG
    CPSGHGLSGVAQLAGSGLVSLVCFFVGGLI
    VARLLYGGRR

    >gi|46579997|ref|YP_010805.1| thioredoxin family protein [Desulfovibrio vulgaris str. Hildenborough]
    MKFRSALFTVLCLIVLTLPAFAAPREIGSGDLLKLVGESRGKVVVVNFFASWCPPCLEEIPGLIRLRGHYKPSQVEFIGV
    SVDESRDQLVALMGKTPFNYPVFLAREELSRFFGISSIPRLLVYDKAGKLVIDNVGLVEADELAKAIDTLLGGGK

    >gi|46580247|ref|YP_011055.1| thioredoxin-disulfide reductase [Desulfovibrio vulgaris str. Hildenborough]
    MQQFDAIVIGGGPAGMTAALYLARSGVSVAMVERLSPGGQVLMTSEIENYPGFPKGIQGWELADLFAAHLEGYAITRFND
    EVREIVPAPADNRVRVGDDWISGRTLILCSGARYKRLGLPDEERLTGKGVSY
    CALCDGNFFRGQVVGVVGGGNSALEESL
    YLSKLVKKLHLIHRRDDFRAAKCYQDKVCIMPDIDVVRSSVVEAIHGDDRLTGVTVRNVKTGETSFLELDGLFIFIGFEP
    VGGFLPGGIERDEQGFVITDGEMRTNLPGIFAAGDIRSKMCRQVTTAVGDGATAANAAFVYLEQLDA

    >gi|46580248|ref|YP_011056.1| thioredoxin [Desulfovibrio vulgaris str. Hildenborough]
    MAAQITDATFEASVLKSAIPVLIDFWAPWCGPCRAMGPVIDELAAEYEGKVLIVKMNVDDNPATPSKYGIRAIPTLILFK
    NGEVVEQVTGAVSKSSIKDMIAQKALG

    >gi|46580382|ref|YP_011190.1| rhodanese-like domain-containing protein [Desulfovibrio vulgaris str. Hildenborough]
    MRWRQFLTPVISLSPEQARNLVAESGTNLTILDVRQPAEYAEGHIPGAMLMPLADLADGMRQLPAENPLLVYCAIGGRSR
    IAAQLLAGNGFSKVMNLSGGFKAWNGATGFGSYDSGLELFPQTLGLEQAIVTAWGLENALEAFYATQMGQAVQGDVADVF
    GTLAKMESSHKRRLQRQYADIVDAPIDGTGVEAAMARNLVEGGLTTEEYLARAKVDTNDVMEVLQFAMMLEAQAMDLYAR
    AARRADDVETRAFLDAMTREEKSHLAQLATLLDRHLEGESHA

    >gi|46580393|ref|YP_011201.1| peptide methionine sulfoxide reductase MsrA [Desulfovibrio vulgaris str. Hildenborough]
    MTAIETLLLTGLLLATALLPPALAHAAQPAPPPPAGMQVAVFAGGCFWCMEKPFDAVEGVLETTSGYTGGTVESPTYEQV
    SNGGTGHAEALRVVYDPAKVSYTALLDTFWHNVDPFDAGGQFCDRGSQYRSAIFPQDASQRADAESSLKALEERFGRPVA
    TRIEPAGAFWPAEEYHQDYYKKNPLRYSFYRSNCGRDRKLKEVWGSPK

    >gi|46580395|ref|YP_011203.1| hypothetical protein DVU1986 [Desulfovibrio vulgaris str. Hildenborough]
    MTLAHRTGSILLATLMALLLCNATPSHAESPDALFINMTTDDAHRANMGIGFGYNQLQRGHPLTVFLNDRGVMLAAKANS
    AAFEQQQKTLAAVIAKGGTVYV
    CPTCMKHYGLAEADLMPGAKVSNPDLTEKALFSNDARTLSW

    >gi|46580652|ref|YP_011460.1| anti-oxidant AhpCTSA family protein [Desulfovibrio vulgaris str. Hildenborough]
    MGVLVGKKAPFFEGGKTFSAVLGNGEVVDDFDFAKVTEGKYAVVFFYPLDFTFVCPSELIAFDHRLEAFRQRNVEVIGVS
    IDSQFTHAAWRNTPVDKGGIGPVGYPLVADIQHELARAYDVESEGGVAFRGSFLIDRAGVVQHQVVNNLPLGRDIDEMLR
    VVDALQFTEKHGEVCPAGWNKGKKGMKPTADGVASYLAESAANL

    >gi|46580729|ref|YP_011537.1| copper-translocating P-type ATPase [Desulfovibrio vulgaris str. Hildenborough]
    MDSQTDSVRHRSRMPVRGMTCAVCAGRIEKMVGRMEGVETVAVNLATEVMDVTWDDRTDLDAIVRQVSALGFEAMPPDAA
    PAGGGNDLRFAVSGMT
    CAVCAGRIEKVVGTMDGVGAVSVNLAAETAQVTPLPGVDAGSLAASVVERISGLGFGATLQEQA
    ADAASSASLWERQRHDADARLARMKARLVPEFGFTVPLLLLSMGHMMGLPLPGFLHPAHSPLTFAVAQLLLTLPVMWSGR
    DFYRIGFGNLRRLSPNMDSLVALGTGAAFIYSLWNTVEIALGVDVAHRVMDLYYESAAVLITLVSLGKYFEMRSRARTSE
    AIKSLMDLAPETALRLVSADGGPAVGHEAGDGTNVAVQEVPVAEVRAGDLLQVRPGARIPVDGTVVSGTSSVDESMLTGE
    SLPVSKTGGDSVAGGTINRLGTFVMRAERVGADTVLARIIRLVEEAQGSKAPIANIADRVSLYFVPTVMALAVLAGVGWY
    TVGDADFTFALRIFVAVMVIACPCAMGLATPTSIMVGTGRGAQLGILVKSGAALETAGRVDTVVFDKTGTLTEGKPRLVH
    VSAVEDGPWQTDVSASGGDGTQGGASGMRLTQPLAPDVAEDTPRRMVLRLAASLEAVSEHPLAEAILAGAAEAGIAPWPV
    EAFEAVPGRGVRGRVRTDAGESGVLLGNHAFMAEAGVAGLDAHGLREMLDALADAGVTPLLLAAAGEMRGIVGVADPLRA
    EARGVLERLRQCGVRAVMLTGDNRRTAEAIARQAGMDEVVAEVMPDAKEREVSRLQGEGRVVAMVGDGINDAPALARADV
    GIAMGTGIDVAVEAGDIVLLRGGLTSVPVAMQLSRATMRNIRQNLFWAFGYNVLGIPVAAGLLYAFGGPTLSPMLAGAAM
    ALSSVSVVGNALRLRLFTPERGGTC

    >gi|46580807|ref|YP_011615.1| heterodisulfide reductase, A subunit [Desulfovibrio vulgaris str. Hildenborough]
    MRIGVFVCHCGSNIGGTVDVPGVADVARAYPDVVFASDTMYACSEPGQAAIVDAIREHALDGVVVASCTPRMHEPTFRRT
    VERAGLNRYMFEMANIREHVSWIGKDREANSNKAAELVRMAVEKLRLNAPLYPKSFDVTKRVLVIGGGVAGIQAALDCAD
    GGVEVVLVERESTIGGKMAKLDKTFPTVDCSS
    CILGPKMVDVAQHPNIRLYAHAEVESISGYVGNFTVNIRRKATYVDWD
    LCTGCGLCMEKCPSRKSPDAFNEHVGVTTAINIPFPQAIPKKAIIDPTACRQFVKGKCGVCAKMCPTGAIRYDMEDEIVV
    EDVGAIVTATGYDLFDHTRYAEYGGGRYPDVITSLQYERLLSASGPTGGHVRRPSDGREPKTVVFIQCVGSRDRSVDRPY
    CSGFCCMYTAKQAVLTKDHIPDSRSYVFYMDIRAPGKMYEEFTRRAMEEYGVQYVRGRVSMIVPQGDTYLVRGVDTLMGE
    QVEVPADLVVLAVGAESSRGAPQLAEKLRISYDNYGFFMESHCKLRPVETNTAGVYLAGSCQGPKDIPSSVAQGSAAASK
    VLGLFARGKLESDPQISQVDVRRCIGCGKCITTCPYGAIEWMELRGETKARVIETVCQGCGICTVTCPQGAIQLQHFTDN
    QILAEVNALCLS

    >gi|46581156|ref|YP_011964.1| rhodanese-like domain-containing protein [Desulfovibrio vulgaris str. Hildenborough]
    MNLKKLLAPLLMLTALGLTACDNPFQGLSEKDLEAKSVKLARETVKGGYKLLTVDETKKMMDGDKTVLVIDTMPYEDSYK
    KNHIPGAVQFLFPIPDMNDWNMAETGDKSQQDFEALLGPDKNRPLVFY
    CGFVKCTRSHNGAVWAQKLGYTNVYRMPGGIV
    AWKEAKFPVDTVK

    >gi|46581199|ref|YP_012007.1| electron transport complex RsxE subunit [Desulfovibrio vulgaris str. Hildenborough]
    MQQIIKEFTKGLWQELPPFRLVLGLCPTLAVTKTASNGLGMGLAVIFVLALSNMIISMVRNIIPKKVRIACFIAISASLV
    VAVELLMQAYAYPLYQQLGIFVPLIVVN
    CIILGRAEAFAAKNPVSLSLADGLGIGLGFTLSLVFLGGIRELFGTGMLFGT
    QVMWQGYQPFGIMVEAPGAFICLGLTLAAMNVINTWQARRKGLEAPENPQSGCAACRACAGIK

    >gi|46581200|ref|YP_012008.1| electron transport complex protein RnfA, putative [Desulfovibrio vulgaris str. Hildenborough]
    MDVFEIFISAIFVNNIVLAQYLGNCPYLGCSREKGVALGMGAAVVFVIIMATLCTWLIQYHVLVPFDLAYLQTIVFILVI
    AGLVQFVEMFLKKMVPPLYAALGIFLPLITTN
    CAVMGVTILVQREEYDLMTSLTYGLASSLGFVLALLLMAGIRERLDTA
    RVPKAMIGTPIALIMAGLMSLAFMAFKGMTS

    >gi|46581201|ref|YP_012009.1| ferredoxin [Desulfovibrio vulgaris str. Hildenborough]
    MVTLSVITLLGLGLVTASVLAVASRVFYVEEDPRVEAVLEVLPGANCGGCGYAGCEGYATAVVNDPDIPANRCCAGGELT
    SIAVGELTGKTVAASEPQRSFRRCDKVSGKVLSRYAYQGVPS
    CAAAALLFDGSDSCSYSCLGLGDCVEVCPFDALHIENG
    LTHVDLAKCTGCGVCINACPRNTLELIPVRARVAVMCSTKEKLKAVMEVCEVGCINCGKCVKACPAHAISQETGRIEIDQ
    KKCLSYGPDCNEACVTACPRNIMRHMCPVYLAQETVDSAPPPVSEQPGIQQGDNA

    >gi|46581440|ref|YP_012248.1| rhodanese-like domain-containing protein [Desulfovibrio vulgaris str. Hildenborough]
    MKAGYETMTPEELRRLTATHDEADYEIVDVREPAEYRQGHLPGAKHIPVGEVEARLDELVPGRTHIFYCRSGARSRAALT
    FAVESGLTLGPLYDLAGGILAWDGHTVPDEPRLATFAHVSDMRSLLLRAIDMEKAVHGLYTRVRAASGRPVVCELMDRLV
    GVEVAHARVIYRELRKWWAAADGELPPFETLFETLEGRVLEGGRSVDELEPWIRSASTGDCHEVADLALELEFAAYDLYR
    TLADEAVQGSGLGEDAARVFLDLASQEKAHARMIVAAMARFGEEGADATA

    >gi|46581479|ref|YP_012287.1| hypothetical protein DVU3076 [Desulfovibrio vulgaris str. Hildenborough]
    MNDTIASSFRAIALLCLFLLASQSVAGHATPLEAGAPFPDITLQGQFTSPQKAMLGLEGDGPFRLSDVKARHVLIEVFSM
    Y
    CPHCQREAPDMNRLSARIADMQPIGELALLGLGAGNTQTEVDLFRETYSVPFPLAIDPDLEMHKTLGEPGTPHFFLVSL
    RDRGKPVVLLSRTGRMSGVDDFIRELRTLCGSD

    >gi|46581480|ref|YP_012288.1| AhpC/TSA family protein [Desulfovibrio vulgaris str. Hildenborough]
    MLPRTAATGHTLHECLPDSRRLLPANSPCPPRRQGVHHMTTGVLWVVLFACLAACAPARNGQATSSVTAATATRQTTVQG
    GAQAALQNAPVIRPGDEAPDFDLPAVDGTRLRLASFRGHKAVVLSFVPAAFTPV
    CSSQWAGYGMLKPRFEALGAIVVGIA
    ADNVPSLAAWTREMGTDAAGHPSPLWFPVVSDFWPHGAVTMRYGLLRPEGIAERALVLIDKAGVVRLVEVSDIDKRPPLD
    NLFKALERLAAGN

    >gi|46581614|ref|YP_012422.1| pyridine nucleotide-disulfide oxidoreductase [Desulfovibrio vulgaris str. Hildenborough]
    MPKHVVVIGAVALGPKAACRFKRLDPEAHVTMIDQASRISYGGCGIPYYVSGEVSNIESLQATPYNVVRDPEFFRINKDV
    EALVETRAHAIDRAAHTVEIENLRTGERRTLKYDKLVLALGSKANRPPVEGMDLAGVTPVTNLDEAEFVQHAISAGEVSK
    AVIVGGGFIGLEMAVSLADMWGIDTTVVELADQIMPGFTSKSLSQMLRHDLEKNDVVVHTGEKVVRLEGENGKVARVITD
    KRTLDADLVILAAGVSPNTQLARDAGLELDPRGAIIVDTRMRTSDPDIFAGGDCVTIPNLVTGKPGFFPLGSMANRQGRV
    IGTNLADGDATFPGAVGSWAVKLFEGSASGAGLTVEGALREGYDAVNVHVEQFDRAHFYPEKTIMTLQLVVDRPTRRVLG
    IQGFSTLGDALTARINAVATMLASKPTVEDISNAEVVYSPPFASAMDIVNVAGNVADNVLAGRCRLVGTEEFVQLWEGRK
    DADICFVDTRLAANAVPLVEKYGDEWINIPEEELAARIDEIPRDKTVMLVCNTGLRSFESQLILDRLGLTNTKSVAGGMV
    AIHKIGGDI

    >gi|46581683|ref|YP_012491.1| ADP-ribosylglycohydrolase family protein [Desulfovibrio vulgaris str. Hildenborough]
    MTRIEAAILASFVADSLALGAHWEYDQQHILQEYGRMTEMRAPGRRGYHAGKALGDLSHYGDQTMLLFRSVSALGRFDLA
    DFARRWVEEMSHYKGYMDKATLGALENFRAGRPPSATGAITNDFAGASRIAPLLAVHAAAPDVLVEAARAQTLMTHGAPV
    IGDGAAFFARTALYLLDGAGMEDALRKAASEPYGALPAQDWVEFALMAGGTDTSAAIARFGQS
    CGMQGAFCGVVHMAVRH
    EHEPETGLVENVMGGGDSCARGLMLGMLMGARHGGEWLPRRWLDALRVTGEVRDWFESR

    >gi|46580730|ref|YP_011538.1| mercuric transport protein periplasmic component [Desulfovibrio vulgaris str. Hildenborough]
    MPTLNVQGMSCNHCKMSVTKALSDIPGVKDVDVSLEKAQASWTETASVDIEKVKDAIRRIGFDVA