Desulfovibrio vulgaris DP4 uid58679

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|120601159|ref|YP_965559.1| ADP-ribosylation/crystallin J1 [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTRIEAAILASFVADSLALGAHWEYDQQHILQEYGRMTEMRAPGRRGYHAGKALGDLSHYGDQTMLLFRSVSALGRFDLA
    DFARRWVEEMSHYKGYMDKATLGALENFRAGRPPSATGAITNDFAGASRIAPLLAVHAAAPDVLVEAARAQTLMTHGAPV
    IGDGAAFFARTALYLLDGAGMEDALRKAASEPYGALPAQDWVEFALMAGGTDTSAAIARFGQS
    CGMQGAFCGVVHMAVRH
    EHEPETGLVENVMGGGDSCARGLMLGMLMGARHGGEWLPRRWLDALRVTGEVRDWFESR

    >gi|120601227|ref|YP_965627.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MPKHVVVIGAVALGPKAACRFKRLDPEAHVTMIDQASRISYGGCGIPYYVSGEVSNIESLQATPYNVVRDPEFFRINKDV
    EALVETRAHAIDRAAHTVEIENLRTGERRTLKYDKLVLALGSKANRPPVEGMDLAGVTPVTNLDEAEFVQHAISAGEVSK
    AVIVGGGFIGLEMAVSLADMWGIDTTVVELADQIMPGFTSKSLSQMLRHDLEKNDVVVHTGEKVVRLEGENGKVARVITD
    KRTLDADLVILAAGVSPNTQLARDAGLELDPRGAIIVDTRMRTSDPDIFAGGDCVTIPNLVTGKPGFFPLGSMANRQGRV
    IGTNLADGDATFPGAVGSWAVKLFEGSASGAGLTVEGALREGYDAVNVHVEQFDRAHFYPEKTIMTLQLVVDRPTRRVLG
    IQGFSTLGDALTARINAVATMLASKPTVEDISNAEVVYSPPFASAMDIVNVAGNVADNVLAGRCRLVGTEEFVQLWEGRK
    DADICFVDTRLAANAVPLVEKYGDEWINIPEEELAARIDEIPRDKTVMLVCNTGLRSFESQLILDRLGLTNTKSVAGGMV
    AIHKIGGDI

    >gi|120601350|ref|YP_965750.1| redoxin domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MNREASSLTHTLPPAAGGARSGRRVPPASMKGGMLPRTAATGHTRHECLPDSRRLLPANSPCPPRRQGVHHMTTGVLWVV
    LFACLAACAPARNGQATSSVTAATATRQTTVQGGAQAALQNAPVIRPGDEAPDFDLPAVDGTRLRLASFRGHKAVVLSFV
    PAAFTPV
    CSSQWAGYGMLKPRFEALGAVVVGIAADNVPSLAAWTREMGTDAAGHPSPLWFPVVSDFWPHGAVTMRYGLLR
    PEGIAERALVLIDKAGVVRLVEVSDIDKRPPLDNLFKALERLAAGN

    >gi|120601351|ref|YP_965751.1| redoxin domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MNDTIASSFRAIALLCLFLLASQSVAGHATPLEAGAPFPDITLQGQFTSPQKAMLGLEGDGPFRLSDVKARHVLIEVFSM
    Y
    CPHCQREAPDMNRLSARIADMQPRGELALLGLGAGNTQTEVDLFRETYGVPFPLAIDPDLEMHKALGEPGTPHFFLVSL
    RDRGKPVVLLSRTGRMSGVDDFIRELRTLCGSD

    >gi|120601387|ref|YP_965787.1| rhodanese domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MKAGYETMTPEELRRLTATHDEADYEIVDVREPAEYRQGHLPGAKHIPVGEVEARLDELVPGRTHIFYCRSGARSRAALT
    FAVESGLTLGPLYDLAGGILAWDGHTVPDEPRLATFAHVSDMRSLLLRAIDMEKAVHGLYTRVRAASGRPVVCELMDRLV
    GVEVAHARVIYRELRKWWAAADGELPPFETLFETLEGRVLEGGRSVDELEPWIRSASTGDCHEVADLALELEFAAYDLYR
    TLADEAVQGSGLGEDAARVFLDLASQEKAHARMIVAAMARFGEEGADATA

    >gi|120601567|ref|YP_965967.1| ferredoxin [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MVTLSVITLLGLGLVTASVLAVASRVFYVEEDPRVEAVLEVLPGANCGGCGYAGCEGYATAVVNDPDIPANRCCAGGELT
    SIAVGELTGKTVAASEPQRSFRRCDKVSGKVLSRYAYQGVPS
    CAAAALLFDGSDSCSYSCLGLGDCVEVCPFDALHIENG
    LTHVDLAKCTGCGVCINACPRNTLELIPVRARVAVMCSTKEKLKAVMEVCEVGCINCGKCVKACPAHAISQETGRIEIDQ
    KKCLSYGPDCNEACVTACPRNIMRHMCPVYLAQETVDSAPPPVSEQPGIQQGDNA

    >gi|120601568|ref|YP_965968.1| electron transport complex, RnfABCDGE type, A subunit [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MDVFEIFISAIFVNNIVLAQYLGNCPYLGCSREKGVALGMGAAVVFVIIMATLCTWLIQYHVLVPFDLAYLQTIVFILVI
    AGLVQFVEMFLKKMVPPLYAALGIFLPLITTN
    CAVMGVTILVQREEYDLMTSLTYGLASSLGFVLALLLMAGIRERLDTA
    RVPKAMIGTPIALIMAGLMSLAFMAFKGMTS

    >gi|120601569|ref|YP_965969.1| SoxR-reducing system protein RsxE [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MQQIIKEFTKGLWQELPPFRLVLGLCPTLAVTKTASNGLGMGLAVIFVLALSNMIISMVRNIIPKKVRIACFIAISASLV
    VAVELLMQAYAYPLYQQLGIFVPLIVVN
    CIILGRAEAFAAKNPVSLSLADGLGIGLGFTLSLVFLGGIRELFGTGMLFGT
    QVMWQGYQPFGIMVEAPGAFICLGLTLAAMNVINTWQARRKGLEAPENPQSGCAACRACAGIK

    >gi|120601605|ref|YP_966005.1| rhodanese domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MNLKKLLAPLLMLTALGLTACDNPFQGLSEKDLEAKSVKLARETVKGGYKLLTVDETKKMMDGDKTVLVIDTMPYEDSYK
    KNHIPGAVQFLFPIPDMNDWNMAETGDKSQQDFEALLGPDKNRPLVFY
    CGFVKCTRSHNGAVWAQKLGYTNVYRMPGGIV
    AWKEAKYPVDTVK

    >gi|120601876|ref|YP_966276.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MRIGVFVCHCGSNIGGTVDVPGVADVARAYPDVVFASDTMYACSEPGQAAIVDAIREHALDGVVVASCTPRMHEPTFRRT
    VERAGLNRYMFEMANIREHVSWIGKDREANSNKAAELVRMAVEKLRLNAPLYPKSFDVTKRVLVIGGGVAGIQAALDCAD
    GGVEVVLVERESTIGGKMAKLDKTFPTVDCSS
    CILGPKMVDVAQHPNIRLYAHAEVESISGYVGNFTVNIRRKATYVDWD
    LCTGCGLCMEKCPSRKSPDAFNEHVGVTTAINIPFPQAIPKKAIIDPTACRQFVKGKCGVCAKMCPTGAIRYDMEDEIVV
    EDVGAIVTATGYDLFDHTRYAEYGGGRYPDVITSLQYERLLSASGPTGGHVRRPSDGREPKTVVFIQCVGSRDRSVDRPY
    CSGFCCMYTAKQAVLTKDHIPDSRSYVFYMDIRAPGKMYEEFTRRAMEEYGVQYVRGRVSMIVPQGDTYLVRGVDTLMGE
    QVEVPADLVVLAVGAESSRGAPQLAEKLRISYDNYGFFMESHCKLRPVETNTAGVYLAGSCQGPKDIPSSVAQGSAAASK
    VLGLFARGKLESDPQISQVDVRRCIGCGKCITTCPYGAIEWMELRGETKARVIETVCQGCGICTVTCPQGAIQLQHFTDN
    QILAEVNALCLS

    >gi|120601932|ref|YP_966332.1| DsrE family protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MRKFLFVLSRGPEDPTRAVRCFQFAKIAAEKGHEVTVFLVDDAVYFANLGMAERVKCPTGDELLPYLKVLQEKGKILVCK
    PCAATRMIGEDDLPGGFAISTGVTLIDLAEDAKVFSF

    >gi|120601982|ref|YP_966382.1| heavy metal translocating P-type ATPase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MDSRTDSVRHRSRMPVRGMTCAVCAGRIEKMVGRMEGVETVAVNLATEVMDVTWDDRTDLDAIVRQVSALGFEAMPPDAA
    PAGGGNDLRFAVSGMT
    CAVCAGRIEKVVGTMDGVGAVSVNLAAETAQVTPLPGVDAGSLAASVVERISGLGFGATLQEQA
    ADAASSASLWERQRHDADARLARMKARLVPEFGFTVPLLLLSMGHMMGLPLPGFLHPAHSPLTFAVAQLLLTLPVMWSGR
    DFYRIGFGNLRRLSPNMDSLVALGTGAAFIYSLWNTVEIALGVDVAHRVMDLYYESAAVLITLVSLGKYFEMRSRARTSE
    AIKSLMDLAPETALRLVSADGGPAVGHETGDGTNVAVQEVPVSEVRAGDLLQVRPGARIPVDGMVVSGTSSVDESMLTGE
    SLPVSKTGGDNVAGGTINRLGTFVMRAERVGADTVLARIIRLVEEAQGSKAPIANIADRVSLYFVPTVMALAVLAGVGWY
    TVGDADFTFALRIFVAVMVIACPCAMGLATPTSIMVGTGRGAQLGILVKSGAALETAGRVDTVVFDKTGTLTEGKPRLVH
    VSAVEDGPWQTDVSASGGDGTQGGASGMRLTQPLAPDVAEDTPRRMVLRLAASLEAVSEHPLAEAILAGAAEAGIAPWPV
    EAFEAVPGRGVRGRVRTDAGESGVLLGNHAFMAEAGVAGLDAHGLREMLDALADAGVTPLLLAAAGEMRGIVGVADPLRA
    EARGVLERLRQCGVRAVMLTGDNRRTAEAIARQAGMDEVVAEVMPDAKEREVSRLQGEGRVVAMVGDGINDAPALARADV
    GIAMGTGIDVAVEAGDIVLLRGGLTSVPVAMELSRATMRNIRQNLFWAFGYNVLGIPVAAGLLYAFGGPTLSPMLAGAAM
    ALSSVSVVGNALRLRLFTPERGGTC

    >gi|120602042|ref|YP_966442.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MGVLVGKKAPFFEGGKTFSAVLGNGEVVDDFDFAKVTEGKYAVVFFYPLDFTFVCPSELIAFDHRLEAFRQRNVEVIGVS
    IDSQFTHAAWRNTPVDKGGIGPVGYPLVADIQHELARAYDVESEGGVAFRGSFLIDRAGVVQHQVVNNLPLGRDIDEMLR
    VVDALQFTEKHGEVCPAGWNKGKKGMKPTADGVASYLAESAANL

    >gi|120602233|ref|YP_966633.1| hypothetical protein Dvul_1186 [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTLAHRTGSILLATLMALLLCNATPSHAESPDALFINMTTDDAHRANMGIGFGYNQLQRGHPLTVFLNDRGVMLAAKANS
    AAFEQQQKTLAAVIAKGGTVYV
    CPTCMKHYGLAEADLMPGAKVSNPDLTEKALFSNDARTLSW

    >gi|120602235|ref|YP_966635.1| peptide methionine sulfoxide reductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTAIETLLLTGLLLATALLPPALAHAAQPAPPPPAGMQVAVFAGGCFWCMEKPFDAVEGVLETTSGYTGGTVESPTYEQV
    SNGGTGHAEALRVVYDPAKVSYTALLDTFWHNVDPFDAGGQFCDRGSQYRSAIFPQDASQRADAESSLKALEERFGRPVA
    TRIEPAGAFWPAEEYHQDYYKKNPLRYSFYRSNCGRDRKLKEVWGSPK

    >gi|120602246|ref|YP_966646.1| rhodanese domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MRWRQFLTPVISLSPEQARNLVAESGTNLTILDVRQPAEYAEGHIPGAMLMPLADLADGMRQLPAENPLLVYCAIGGRSR
    IAAQLLAGNGFSKVMNLSGGFKAWNGATGFGSYDSGLELFPQTLGLEQAIVTAWGLENALEAFYATQMGQAVQGDVADVF
    GTLAKMESSHKRRLQRQYADIVDAPIDGTGVEAAMARNLVEGGLTTEEYLARAKVDTNDVMEVLQFAMMLEAQAMDLYAR
    AARRADDVETRAFLDAMTREEKSHLAQLATLLDRHLEGESHA

    >gi|120602368|ref|YP_966768.1| thioredoxin [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MAAQITDATFEASVLKSAIPVLIDFWAPWCGPCRAMGPVIDELAAEYEGKVLIVKMNVDDNPATPSKYGIRAIPTLILFK
    NGEVVEQVTGAVSKSSIKDMIAQKALG

    >gi|120602369|ref|YP_966769.1| thioredoxin reductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MQQFDAIVIGGGPAGMTAALYLARSGVSVAMVERLSPGGQVLMTSEIENYPGFPKGIQGWELADLFAAHLEGYAITRFND
    EVREIVPAPADNRVRVGDDWISGRTLILCSGARYKRLGLPDEERLTGKGVSY
    CALCDGNFFRGQVVGVVGGGNSALEESL
    YLSKLVKKLHLIHRRDDFRAAKCYQDKVCIMPDIDVVRSSVVEAIHGDDRLTGVTVRNVKTGETSFLELDGLFIFIGFEP
    VGGFLPGGIERDEQGFVITDGEMRTNLPGIFAAGDIRSKMCRQVTTAVGDGATAANAAFVYLEQLDA

    >gi|120602591|ref|YP_966991.1| redoxin domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MKFRSALFTVLCLIVLTLPAFATPREIGSGDLLKLVGESRGKVVVVNFFASWCPPCLEEIPGLIRLRGHYKPSQVEFIGV
    SVDESRDQLVALMGKTPFNYPVFLAREELSRFFGISSIPRLLVYDKAGKLVIDNVGLVEADELAKAIDTLLGGGK

    >gi|120602641|ref|YP_967041.1| protein of unknown function DUF395, YeeE/YedE [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSDSGRWNPYVAGGLSGLVMVGSVALSNAYFGASTTFVRMAGMIEKAFAPEHVAGLAYFTKEAPIVDWQWMFVVGILLGA
    FVAAMLSGSYRVQAVPDMWRERFGTSAGLRGVAAFVGGFLALFGARLAGG
    CPSGHGLSGVAQLAGSGLVSLVCFFVGGLI
    VARLLYGGRR

    >gi|120602666|ref|YP_967066.1| thioredoxin-disulfide reductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    METRPLVIIGAGPAGLSAAVYTARAGIPTLVFGSAPKVAGDYDIDNYFGFDETITGRELIERGRRQAERFGAVLRDDRIL
    GLHHGDDGGFRITTEAGETAACAIILATGVSRVRPGISNIADYEGKGVSY
    CVSCDGFFYRGLRVKVLGEGVFAANQALEL
    LHYTPHVSICTQGKAASITPEFMTRLDEAGIAVDDRKIASLEGTPALSVLRYEDGSTEEAQGLFIAMGEASSLDFAYTLG
    VERNGVFLGADSDQRTNIPGVFAAGDCTGGFLQIAVAVGEGAKAARAAISYIKEECPFATSRRNTTTES

    >gi|120602697|ref|YP_967097.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTYDVVILGAGPGGSRAALEAAAAGLRVAIVDKGSFGGTCLNWGCIPTKLLLGGTAAHPLLEVQKKLKTAQGTIDFDLTA
    LQARKTRFINGTRQALEKQLRQAGIEVITGTARLAGPGHVEVVDGEGTRELAARNVIVATGSVPASFPGLAPDGEAVLDS
    TALLDVTEVPDSLIIVGGGAIGLEMGDFFSRLGTAITIVEGLDRLAPTEDPEIGQTLGKLLKREGWAIHTGRRVASLSTV
    EGKAQLRFEDGTELVADKALMAVGRRPATAGLGLETAGATLLGAGWVETNDHLLAAPGLYAIGDVNGRTLLAHAADHQAR
    FVISHIASGSASSASGYPAPVMPSCIYGHTEVMRAGATVAELVASGHDVHVSTSQLIANPIAQAYGTTGGFIRVLWVEGQ
    VRGISAVGHGVSHLVTLATVIVSQRWRREDVHGIIFAHPTLDEALEAALLAPSQKV

    >gi|120602732|ref|YP_967132.1| HesB/YadR/YfhF-family protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MFELTDNARKELEAYFADKQKTPIRVYLAPGGCSGPRLALALDEPNESDNVFKEGDFTFCVNSDLLSQIESVRIDLTYMG
    FQVEPGKPLAGGGGSCGGCGSSSSCCS

    >gi|120602780|ref|YP_967180.1| selenide, water dikinase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTVDRLTSRSRAAGCAAKIAPGDLERILATLPRDPREGERVVVGTRDNEDAAIVRVPGGKAIVQTLDFFTPIVDDPYLFG
    QIAAANALSDVYAMGGEPWCALNIVCFPVKELPEEILADILRGGADKVREAGAVLVGGHSIEDESIKYGLSVTGIIDPDC
    YATNTGLRPGDVLLLTKPLGSGVLATAVKAGWDGFEAHEQELGRWGAMLNRAGGRVIRELGLAAATDVTGFGLGGHLLEM
    ANASNMSVHVDVSTLPLMPAVLDLVATGLLPAGSHANRHFCSGNVSVHPEVDSLLVDIVFDAQTSGGLILAVPPHLVDDA
    CSILRAEDAPFWRIGHVEEMGEGVSRLVLQP

    >gi|120602876|ref|YP_967276.1| redoxin domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTTERTGIITFKGNGLTLLGTPAGVGDKAPSFNVLANDLSPRTLGDYKGKVVIISAVPSLDTGVCDMETRRFNQEAANLG
    EDVKILTVSCDLPFAQARWCGAAGVQAVETLSDHKDLSFGMAYGVVIKELRLLTRAVFVVDRNGTITHAQIVPEVTTEPD
    YAGAIAAAKKAI

    >gi|120602999|ref|YP_967399.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MDYDADLLIIGGGAAGLTVAAGAARLGARVVLADRGPTLGGDCLHHGCVPSKTLIASARARRTMRDAPRFGLPEVALPPV
    DFKAVAAHIAGVQSVIQKHDSVERFSGLGVEVRFGDAVFVDEHTVAVEGRRISARRIVVATGSSPQIPAFPGLADTPYLT
    NRDIFTLETLPASLIVLGGGPIAVEMAQAFARLGSQVVLVQRGGHILSREDADMAAVVHEALEQDGVRIMTGATVEVVRR
    QDAGVVVTVRVGDEHVDVHGERLLVALGRTPNVEGLHLGNAGVVFSERGVPVDARMRTSQSHILAAGDVTGEWQFTHAAG
    YEGSVVVANAVLRLPRKAKYDRMPWCTFTDPELASVGLNEREAHRQGIGVDVHTESFSSNDRALAEGTACGLLKLVLARG
    TQRVLGVQIAGPHAGELINGWCMALGGGVRLTTLAGGVMPYPTLGEISRRVAGNIVSEALFSDKVRNVLCTLFRYRGKGC


    >gi|120603033|ref|YP_967433.1| cytochrome c biogenesis protein, transmembrane region [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MLVPWATLDGGALSAHAAEPVTFSTEQAHDRETAGGIIVLWIDPAPEYHAYAHEPGVDTRPTVVSVHDRSGTPLDLPVLY
    MPGEPLDDPFTPGRIVNAYGPKTPVFVKVPALLAGGDVIVRTSLLLCSDRNCQPVRHDIAVTLPGEGAFAALPDAASRPW
    RGKLAQAVPGRPVAGAVAPGMTGTPNAGAAGDGAAIGMGVAPTPRDVAPGTGGSLPFPPSTGVDTTATAGNVARGEEEQA
    QKAVSGIVSVSPGGTSSGVAVSRSVSGAAQESPSWSFAPRYFAPELEVSGLGKALLLGLLAGLILNVMPCVLPVISLKLS
    GFIATSGAPGDEGVRRRAFREHNLFFAAGILVWFVVLAGILAVAGLAWGQLFQRPGVLFGLTLVVFTLGLSMFGVFSLPV
    LDLKAGTTGSPRVQAFMTGVVATLLATPCSGPLLGGVLGWAFRQPSSVLALVFAFVGLGMASPYLLMAARPGLVRFFPRP
    GAWTGVMEQVVGFFLMATSVYLLTILPAALLLPMLVTLLVAAFAAWLWGTWAGPGASSVQRIAVRCVAVALVGMTVAWAL
    SPPADEARWEPFEATAFRGMLGRQPVIVDFTADW
    CPNCKLLERTTLNAANMARWQKAYGARLVRVDLTRDDPVAQALLHS
    LGSSSIPVVALFPKGLLRNAPLVLRDLFTADQMDEALERAFGPAGQPLQP

    >gi|120603144|ref|YP_967544.1| glutaredoxin [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSGCSVKLFALSTCVHCKNTRRFLEDHKVDVDCIYVDTLQGEERKQVVEEVKKHNPKLSFPTVVCANGKVIVGYREDELK
    EALSL

    >gi|120603178|ref|YP_967578.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSNSILVVGGGFSGLTAAIEAAEVGYEVFIVEKSPFLGGRVAQLNKYFPKLCPPSCGLEIQFQRIKKNPNIKFFTQAQVT
    AVKGEKGNYTVSVRIEPRHTVPNSADLSMLAGALEGEVENEFELGLAKRKPLYLSTPFAFPNRYVLDKNALSQADQLKVG
    ASAFCDLNEGPREIELSVGSIVLATGWKPYDVTNLSNLGAGKIANCVSNMQLERLAAACGPTKGAITRPGDGKSPRKIAF
    VQCAGSRDQNHLNFCSYICCMASLKQALYVREQYPDAEVTVYYIDLRTPGRYDKFMRKVRADEKISLVKGKVAGVEEDTA
    TGDVIVEVEDAVKGEKRKVRYDMVVLATGMQPSLAGQKLPFDVPVDEDGFIVGGEEKGIFAAGCAQKPLDVMRSAQSGTS
    AALKAIQTVRGR

    >gi|120603206|ref|YP_967606.1| redoxin domain-containing protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MQMRPIDLTDRPAPPFSLDDAQGTQRTLASWLGTWLVLYFYPRANTPGCTREGVEFTSVLPDFTALGATVVGISPDTPKT
    LCNFAAKHSLGVTLLSDRDRSVAEHYGVLQMKRLYGKESLGIVRTTLLVDPEGVVRHVWSPVKLEGHAEDVLSTLADLVQ
    R

    >gi|120603225|ref|YP_967625.1| methylated-DNA--protein-cysteine methyltransferase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MVDVLVAAPLRLELHWEQGVLAETVLGWAGEGEKPVLLTEEARSVQACLVRYVAGEDVEWPSLPLAWDRVTPFRRRVLQA
    LVADVPAGAVTTYGDLAARAGSPDAARAVGGAMANNPWPLLIP
    CHRVLGGGGRLGGFSGAGLPMKRWLLDHEGCADKGAR
    C

    >gi|120603287|ref|YP_967687.1| hypothetical protein Dvul_2244 [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MTDPRTPLQTTGPNRLATAPSPYLRQHAHNPVDWHPWGEAALALARERDVPLFVSVGYSTCHWCHVMAHESFEDAEVAQA
    LNEGFVCVKVDREERPDIDALYMNACQMLTGTGGWPLTIFALPDGTPFFAATYLPKRSRGGRAGLLDLIPRVRDIYATRR
    ADVEASAADIAKAMRERAAELLQSPPDGRTPAAGTLRAAFNDLVANFDTAHGGFGGAPKFPSPHLLLFLLRHGRRTGDSR
    SQDMALATLRGMLRGGLWDRLGGGIHRYSTDARWLLPHFEKMLHDQAMFMLATAETWLATREDDMREAALATADYILRDM
    ALSGGGLAAAEDADSLTPEGKRREGAFYTFTFDEVREAAGDNADLAVRLFGITGEGNIADESTGRREGHNVLHLPLGDDA
    ATTLGIDADELAFRHDDILAGLRSLRATRRRPHRDDKLLTDWNGLAIAALARCGHVFDAPHLTDAAASLADAVLTLQHTP
    DGGLLHSRFEGTGSTPGFLDDYAFVIWGLLELYTATNQPQWLEEAIRLQHAQDDRFLDPVDGGYWHTPADAPRTAALRLK
    EARDGALPSGNAAALLNLLRLARLLGDASYEEKAHGLIRAFASQVRHNPLGAAMFLCGVDFALTGGRLVIIAGEAQAPDT
    EAMLDAVRRSYSPNTVMHLRDGNTAERLAMLAPFTSHLAPIDGKTTAWLCQDNACSAPIQDPAALAERLAGARPL

    >gi|120603419|ref|YP_967819.1| methionine sulfoxide reductase B [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MAPRRMTRLWLYGLVAGFVALAVSMFPVGHGPAVTTGHTQEASPMKPSREELKKRLTPLQYDVTQKEGTEPPFRNEYWDE
    KREGLYVDIVSGEPLFSSRDKYDSGTGWPSFTRPVDPQGIVERVDRKLFTTRTEVRSRNGDSHLGHVFPDGPQPTGLRY
    C
    INSAALRFVPVEDLEQQGYGHLLHLFR

    >gi|120603598|ref|YP_967998.1| glutaredoxin [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSAIRDITTEAGMAHFEGLSDAIVFFHKNLCPHCKNMEKVLDKFGARAPQVAISSVDSEARPELMKELGFERVPTLVFIR
    DGKVAKVFSGIMNPRELQALYASI

    >gi|120603599|ref|YP_967999.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSHAFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELAQRMQEQVNNLGVTVEEA
    VCIDSMDLTGPEKRVEADGEVYTAKAVIVATGRKPVPLEAAGECEQVHF
    CAICDGAPYIGKRVLVVGGGNSGFDESLALL
    DQGIAELTLVERMDRFFAAQKAQDLLAARPNATLMRSTEVVSVDYDETLRSVTLRDVATGEVFTREFDGIFVFMGQKPGT
    EVFRGQFDMDAQGYIVTDENMATSLSGVYAAGDVRQKKYRQLTTAMADGTMAALEAERFIHSAPA

    >gi|120603664|ref|YP_968064.1| HesB/YadR/YfhF-family protein [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MINVSETALKELEAYFTDHEREPIRVYLAPGGCSGPRLALALDKPGDDDLTADVAGFTFCINKALFEKVGKVSIDMGGMG
    FSIATEIPLPAPAGGGCSGCGSSSSCCG

    >gi|120603735|ref|YP_968135.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MSGLFKKKETAAQTADTQTQTPTSEAHEWLIPEEGRDQLQKVFAGLPGDVTIEVYTGGDPKNLFDDYARRFVADLALLAP
    RIKPAFHGLDSDMARKRGVTLSPTLLFNPEEYRIRFTGAPLGEEARAFIEAIFLVSARTSGLSQAAKTILAQLDGARSPR
    VFSSPG
    CPYCPAQCANAIKCAIERSDLVSAECVNADEFPDLSARYGVGSVPHTQFDESYKGIGLMPEERFVVELVALKDA
    ERWLNEHASKGGAHGAGTGQGTGSDAGVEVTETDLVVLGAGPAGLSAAIYAERSGLATVVLDKGIVGGQVTVTPVVENYP
    GFADIAGIKLVEVLSSHARQYATIRENENVDDIKLGRRIEVHTPRNVFLARAVLFATGAQWRKLDVPGEDRFYGKGVSY
    C
    ASCDGFVYRGRKVAVVGGGSTALTDALHLRNLGVEVTVIHRRDTFRAEKALQDSLTREGIPVIWNAVVEEVMGDTEVRGV
    RLRDTKTGETRDVPFDGVFVAIGHVPNSEQAADLGVDLEPDGSIKVDRHMRTNIPRVYAAGDVIGGVRQIVTAVGSGATA
    ALSAFEDLQQPRWKKDKSA

    >gi|120603965|ref|YP_968365.1| DSBA oxidoreductase [Desulfovibrio vulgaris subsp. vulgaris DP4]
    MASAPVPPLASEWLRLYRDRTKPSGGSMFKRLLATLLIVLTLVPVAGAADNRDELKETLRTLLRDNPDLVLEVLREHSET
    VLEIAQQGANQRRRKALVAQWKTDLEDPKKVNLADRPVRGEANAPVTVVAYSDFT
    CPYCQQAAGTVEMLLANYKGKVRYV
    FKQMPLETHENARTASNYYVAASLQDPAKAWKLYEAVFADRDRLVTEGEPFLKKVAQEAGLDMQRLATDIKGRKVKALIE
    EDMAEARKLGVQGTPYFLVNDLVVRGALPLDLFSDAVDMALEKAGAKK