Alicyclobacillus acidocaldarius DSM 446 uid59199

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|258510255|ref|YP_003183689.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MQFQRVGEWLYSDIVRLRDEWAASLEAQDVMDMGELMSLIDHPDVVVVDVRPRDEYEYDHIPGALSIPIDELESKISELP
    RDKRIVVY
    CRGHYCLYAPEAVQLLRRHGFDVVRLDEGVREWNRLAHAT

    >gi|258510282|ref|YP_003183716.1| Peroxiredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MTIYDFEVEKADGTTMSMREYQGKVLLIVNTASKCGFTPQYEGLQKLYELYRDRGFEVLAFPCNQFGNQEPGSNEEIQTF
    CSTTYRVTFPVFAKVDVNGPNAHPLFEYLKKQAKGALGSEAIKWNFTKFLVDRDGRVVKRYAPQTSPESIREDIEACLVH
    ASRGQ

    >gi|258510299|ref|YP_003183733.1| heavy metal translocating P-type ATPase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSETRELTLPIEGMTCAACAARIEKNLAKLPGVQQVNVNLASERARVVLTPDTPWTEVVSRIEKTGYSVPVREVDLRITG
    MT
    CAACAARIEKVVGRLEAVKEVHVNLASEKARVAYVPGVIDVEDIIRAVEKAGYGAALASEVEAEEEARKRRAYRRDLA
    TFFLSALLTLPLVVQMFVMLVGGRAFLPNWLAWLLATPVQFYVGWRFYKGAYHALRGGAANMDVLVALGTTVAYVFSAVL
    TVEGRQDVYFDSSATVVTLIFMGKLLEARAKARSSAAISSLAKLGAKVAHVLRDGEETDVPVEALAVGDLVRVRPGERVP
    ADGVVVEGWTSVDESFLTGEPLPVTKRPGDEVVGASLNQTNAFVMRVTKVGRDTALAQVIRLVERAQGSKAPVQRLADRI
    SGIFVPAVLGVALVTFLVWGALGHWSHGLFAAIAVLVIACPCSLGLATPTAIMVGTGLGAERGILVKGGEHLETAHRVDT
    VVFDKTGTLTMGKPAVTEIWAAEGVAEGDVLRLAAALEAQSEHPLGRAVVEAAKARGVEVPAAMDVAAVPGRGIEGVVEG
    ARVRVGSPSFVSSAAPGLPEKVRRKLAGPGRTVVVVAQENRLLGAIAMADEVKPDAHAAVDALRAMGMDVWMMTGDAEET
    ARAVAARLGIEHVMAEVLPGDKAAKVEALRKSGRVVAMVGDGLNDAPALAAADVGMAVGTGADVALEVADVALMRGDVWA
    VVDALRLAKATMRKIRQNLFWALVYNVLGIPLAALGVLSPIIAGAAMALSSVSVVSNSLLLRRTRMGANASAA

    >gi|258510362|ref|YP_003183796.1| hypothetical protein Aaci_0348 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MFTPFPGDRPEALGTLPHEALVFVHTPLCGTCQLARRMLEVVDAAHTNRLPLYDLDANLAPEAMQSWKIESVPALLYVKN
    GEIAHVQYRFGDVVDLADAIRQFLER

    >gi|258510397|ref|YP_003183831.1| beta-lactamase domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MYLRRFYDEGLAHASYLVGCQETGEACVIDPARDVEPYLLTAKREGLRIVAALETHIHADFVSGAREMADRAGAAICVSD
    EGPPEWKSEYVKAYPHRLLKDGDELHFGNVRIVVMHTPGHTPEHVSYLLYDGKTSPDVPMALFSGDFVFVGDVGRPDLLE
    RVAGESGSSEALARQMFRSLRKFEALPDHVQVLPAHGAGSACGKALGAVPSSTVGYEKLVNWALQHKDEDAFVQALLAGQ
    PEAPIYFARMKLVNKVGPRLLAELGAPERVDLPPERVRAWREGGVVLDVRPADAFAKRHLAGSLNIPWNKSFVTWAGWLL
    PADRPIHLLAADAIAPDVIRALRSIGIDDVVDWTDPAAVDRAAPDDVASYANVSPDEVRGALAQQGLWLLDVRNVDEWAG
    GHLPQAHHIPLSKLAAHIHDVPRDGSVCVY
    CRTGGRSAIAASLLRAHGVGDVRNMVGGYEAWRGKGFPVEA

    >gi|258510462|ref|YP_003183896.1| methylated-DNA/protein-cysteinemethyltransferase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MAAGWARLESPPVQDEARACASPEALAVAERAVEELTLYFAGRLQTFTVPLVLRGTPFQMAVWESLRAIPFGARVSYRDI
    AMAIGRPRAVRAVGQANRANPLPVFIP
    CHRVVGADGRLVGYAGDAVDLKSWLLDHELRVLQAQAVV

    >gi|258510468|ref|YP_003183902.1| dihydrolipoamide dehydrogenase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MVVGDIVEEVEVLVIGAGPGGYVAAIRAAQLGKSVTIVDKAELGGVCLNRGCIPSKALISAAHHYEAAKESPFPGIETTA
    TFDFKKVQEWKQSVVKKMTSGVQQLLKGNKVNVIHGEAFFTKPNEVRVMQENGSQRLQFQHCILATGSRPIELKNLPLGK
    RVIDSTGALSLDHVPKRLVVVGGGYIGIELGQTFAKFGSQVTIIEGLDSILALFDKQMVRLVEKNLKKYNVQIETNALAQ
    GVEETEDGVKLTYKDKDGNEKTIEADYVLVTVGRRPNTDEIGLQDAGIELTDKGLVKVDQQCRTTNPNVFAIGDIVPGPA
    LAHKASYEGKVAAEVIAGKPSIVDYRCIPSVVFSDPEMASVGLTEEEAKKEYGQVAVGRFPYAANGRATALNATDGFIKL
    VANKENGVLVGAQVVGVEASNIIAELGLAIEMSATLEDIALTIHAHPTLGEMVMEAAEVGLGEPIHIIKG

    >gi|258510844|ref|YP_003184278.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MALTFMQMVQKAKENVPGLSAAEAKKRIEEDPNTLVIDVQDAADAGACGLIPSSVNISLGMLPIRADLELPKELRDERLA
    DRNRPVITT
    CGAGGQAALAAYVLKLMGFTNVAYIEGGTAAWKEAGYEVVH

    >gi|258510853|ref|YP_003184287.1| thioredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MATMTLTDANFQQAIQGDKPVLVDFWAAWCGPCRMMAPVLEEFAEAHADKVTVAKLNVDENPETTSQFGIMSIPTLILFK
    GGRPVKQLIGYQPKEQLEAQLADVLQ

    >gi|258510854|ref|YP_003184288.1| peptide methionine sulfoxide reductase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MTSEAQQDAGLERATFAGGCFWCMVKPFDTWPGVVSVVSGYTGGHVPNPTYEQVCSGTTGHVEAVQITYDPRQITYQQLL
    DIFWRQIDPTDPGGQFYDRGPSYKTAIFYHTEEQRRLAEASKAALEASGRFQKPIVTEIRPAGPFYPAEEYHQDFYRKEP
    LHYERYRRASGRDAFIAAHWGRE

    >gi|258510880|ref|YP_003184314.1| Thioredoxin domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MEEIRTSERYREAVQSGRVVVEFYATWCPDCRRIEPYLGEWEEKYREQFTMVRVNRDEVPDLAEELQILGIPTFLVYDQG
    REVKRLFSRDAKSKEQVEQFLDQAYA

    >gi|258510882|ref|YP_003184316.1| thioredoxin reductase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MEHRRLIILGTGPAGYTAAIYAARANLEPLVFEGDQAGGQLTMTTEVENFPGFPDGVMGPELMEAMKKQAEKFGAEFRSG
    IATGVDLSQRPFKVVIDKEHEYTADALIVATGASAKLLGIEGESEMIGRGVST
    CATCDGFFFRNKRVIVVGGGDSAMEEA
    TFLTKFASEVTIVHRREEFRASKIMQERAKANPKIRFVMNVQSKRVLSDGNKVTGLEVVDNRTGETKVLEADGVFVAIGH
    KPNTDFLRGQLELDEIGYIITKGNTSETSVEGVFACGDVMDSRYRQAITAAGSGCKAAMDAEKFLEGQAAHDWSVSLNA

    >gi|258510947|ref|YP_003184381.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MKALLMQPDDLAARLGAEELAVFDCRFQLSDPEAGERAYREAHIPGAYYLHLDRDLSSPKGEHGGRHPLPDWNRFAARLS
    ACGVRPHSTVVVYDAGEGMAARAWWLMRHIGLADVRILDGGWKRWTREKRPVTPVVPESRPGGVEVRLREGETVDVEEVR
    RGLREGSLVLVDARSPERYRGDVEPIDPKAGHIPGAFNHPWERGLKEDGTWRSPEEQRARFGDLAKCGKPIAVY
    CGSGVT
    ACSTLFALELAGIPAKLYPGSWSDWVSYPENPVATGDEPGAWAP

    >gi|258511021|ref|YP_003184455.1| arsenate reductase and related [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MYHLYGYRRCSTCRNAQAFLERLGADVSFHDIVEHPPDVSTLRTWLEAVRGDIQSLVNTRGEVYRRRGLKEVSWPVDTWL
    EEMHRDGKLIRRPVLVTPSGRVIVGFDESAYRDAVTEEQAP

    >gi|258511033|ref|YP_003184467.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MALEVGVKAPEFSAESDSGEIVKLSDLRGKVVVLYFYPKDDTPGCTQEACAFRDLKSRFEEAGAVIYGVSRDDIRSHAKF
    RDKHGLNFPLLSDPDGQICQAYDVLKEKNMYGRKTIGIERTTYVIDRDGAIAAVFPKVKVDGHAEEVLAKVREVAG

    >gi|258511034|ref|YP_003184468.1| iron-sulfur cluster assembly accessory protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MITLTEQAAERVRTLLESQSSGEDALRIYTKPGGCTGFTYGLALDNEKPGDVVTVQHGVKLVVDPESLELIDGSEIDYVD
    DLTGQGFKINNPNATQMCGCGSSFRTATRAGQPGSCN

    >gi|258511099|ref|YP_003184533.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MKKPLKWLWVGTGAALLIAVVGTVTLKQNSLVASSIASSANAAPGVSSVAVAPQTGYRMPPFKLQEYPDNQTIDTEKQIG
    KPIFINFWTSW
    CIYCKLETPYIVQAYKQYGDKVVFLSVNVTAQDSMADMEQFVKQYGITWPVALDTKGTVTNEYGVIGLP
    TSFFVNRQGVIVATNVGAISKENLMAELERISK

    >gi|258511103|ref|YP_003184537.1| heavy metal translocating P-type ATPase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSEAKEIMLPIEGMTCAACAARIEKNVAKLPGVKEVNVNLASERARVVLDSDTPWSEVVSKIEKTGYSVPVREVDLHITG
    MT
    CAACAARIEKVVGRLEAVKSVHVNLASEKARVSYVPGVIDEADIIQAVEKAGYGAILASEAAETEEKERKLRAYHRDL
    AKFGFSVLMTVPLVVQMFVMLVGGRPFLPNWLSWLLATPVQFYVGWRFYKGAYHALRGGAANMDVLVALGTSVAYVYSTV
    LTLLGRSDVYFDSSATVVTLIFMGKLLEARAKAKSSAAIESLAKLGAKVAHVLREGVETDVAVEELRVGDLVRVRPGEKV
    PTDGVVVEGTTSVDESFLTGESMPVSKHLGDEVVGASINQTSAFVMRVTKVGRDTALAQVIRLVDQAQGSKAPVQRLADK
    ISGIFVPVVLGAALVTLLVWGMLGHWSHGLLAAIAVLVIACPCSLGLATPTAIMVGTGLGAESGILVKGGEHLELAHRVN
    TVVFDKTGTLTTGKPVVTDVWSADGVEQDDVLKVAAALEAQSEHPLGRAVVAYAKEHGVEIPSASEVQSVPGYGIRGMVK
    GARTRVGNRTWFVDANVTIPDDVLAAFESAGKTAVLVAQDERLLGAIAIADTLKSDVQGTVKELQTMGIEVWMITGDGAR
    TAEAIAKLAGITNVMAGVLPAEKAAKVESLRHAGRVVAMVGDGINDAPALAAADIGIAMGTGTDVALEVADIVLMHGQTH
    GVVDALRLSKATMRKIRQNLFWAFFYNVLGIPLAALGVLSPIIAGAAMAFSSVSVVSNSLLLRRLQIGKEVHAA

    >gi|258511104|ref|YP_003184538.1| Heavy metal transport/detoxification protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MTTATIIVKGMTCSGCVNSVTKALKNVEGVQEASVDLEGQKATVTFDETKTNLATLKEAIEDAGYDTE

    >gi|258511230|ref|YP_003184664.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSMSWIWIIVVVAIVGLWIWRSLPAKGVRPISADELKDLLRDKKSGAQLVDVREPSEFRGGHIQGFKNIPLGELPNRSAE
    LDKDKPVVVM
    CRSGARSARAAKWLARHGFRDVRNLTGGIMAWNAAKRRSS

    >gi|258511231|ref|YP_003184665.1| thioredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MATLTLSEASFTALLRDAAKPVLVDFWAPWCAPCRLMAPVVEAVARQFEDELIVGKLNVDDHPRVAQAYGVMSIPTLIGF
    REGIPVMRLQGLAPKHAVLQALESVWNDGRDGE

    >gi|258511826|ref|YP_003185260.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MPMSYEVMLFYKFTPIEDPDELARSQRAMCEELGLLGRILVAEEGLNGTLSGEASACQAYRDRMRQDPRFADMVFKVDPA
    EGHVFPRLSVKRKLEIVHFGAEGAPKPWEKTGRRLSPREWYEMLGRDDVVVIDGRNDYEYEIGHFEGAVRPDVSTFREFP
    SWVERHKDEWRGKKVLTY
    CTGGIRCEKLSGYLMEQGIDEVYQLDGGIITYGKDPEVRGRKFLGKCYVFDDRVAVRINQTE
    EDTVIAHCSICGAPCDRYINCGYLDCHRRFLCCEACEREMHGFCSRSCEAEAVKRDRVDARVKPLLATAFGGAG

    >gi|258512137|ref|YP_003185571.1| protein of unknown function DUF395 YeeE/YedE [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MASSELRILDLEARTRARQDLEARTRARQPEQAQRAWTAAALIVFVLGFLYLWNSVSPTHAILFLVTGVLGVALYHAHFG
    FTTSFRHLIVSGRTVGLRAQMIMFALANVLFLPLLIRGHAFDHAIKASVYPVGLSVLVGSFLFGIGMQLGDG
    CASGTLYH
    TGGGDARGILTLVGFIVGSFVGSVHYAWWMNTPSIGKISLIQSLGPVGGLAVNFAIMAFIFAIALWLERRRNSDVEPLFN
    HQPWNVSRVVKGPWSWVAGGVVLAVGNFVVLALSGKPWGITSAFALWAAKLSALVGYPVQSLPYWQTPQNAAALHHSVLQ
    NLETTDDIAIMLGALLAASLAGALPKRYLRPMPWQMIIGVLAGGILMGYGARIAFG
    CNIGAYFSGVASFSLHGWEWFLGA
    LLGSLLGVRLRPVCRLQNR

    >gi|258512206|ref|YP_003185640.1| Peroxiredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSMSEVNTLPRLNEPAPDFEANTTHGKIKLSDLRGKWVVLFSHPADFTPVCSTEFGAFARRYEEFEKRNVQLIGLSIDSV
    QSHLAWVHDLEKAFGLKIPFPVIADLDMKVANLYGMIHPAANNTSTVRTVFFIDDKGILRAMIYYPMNVGRNISEILRVI
    DALQTADKNGVSCPADWQPGDPVVVPAPATLDAIESEEEAAAKGLEYKTWYLRMKKI

    >gi|258512250|ref|YP_003185684.1| methionine-R-sulfoxide reductase [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSESQRKWTKEELRKRLTPLQYAVTQENATEPPFRNEYWNHHEEGLYVDIVSGQPLFSSRDKFDSGCGWPSFTKPIAQDA
    VVERLDLSHGMIRTEVRSRDADAHLGHVFPDGPIDKGGLRY
    CINSAALRFIPKQDLEKEGYGEYLKLFEDGED

    >gi|258512335|ref|YP_003185769.1| hypothetical protein Aaci_2373 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MQVSERAAQALFRLAREELAPAEFIRIDRAYQCGGPRFQVVIDDVSTPLDSVIRVSGTDGDVEVTVGQALVKLLEGVVLD
    YSEDGFVFGETAPVGC

    >gi|258512441|ref|YP_003185875.1| UBA/THIF-type NAD/FAD binding protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MTDFDFKDRYSRQIRFRHIGETGQARISKSRVAVVGLGALGTASAAQLARAGVGYLRLIDRDVVEPSNLQRQLLYTEKDA
    RNATPKAIAARDALAAANSGITIEAVVDDLDASNAEQLLADVDVVIDGSDNFEVRYLINEVAVKHNIPWAYAGAVEAHGT
    SAFLRPGRTPCLVCLLGYGARVGHDT
    CDTVGVISPIVQWMASYQVAEVLKYLAGREDALSNAILQADVWHTDVRLIRMGG
    PKPDCPCCGRREFVALSAGRRALSVTFCGRQTIQVRPQEDVALSLPALAERLRPLGTVRASDALLRFETEGVALTVFPNG
    RALVHGTDDPARARSLYAQYIGM

    >gi|258512478|ref|YP_003185912.1| alkyl hydroperoxide reductase, F subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MVLDDEIREQLKQYLELMEGDVVIRVAPGSDDASRDMMELVNELKSMSPKIHVEEADLPRRPSFSVNRPGEDTGIVFAGA
    PLGHEFTSLVLALLQVSGRPPKVDESVIRKIQSLEGTYEFETYVSLS
    CHNCPDVVQALNLMSVLNPNIRHTMIDGAVFKS
    EVEEKNVMAVPTVYLNGEFFESGRMSVEEILAKLGSQADVSELNARDPYDVLVIGGGPAGASAAIYAARKGIRTGIVVDR
    FGGQVNDTLGIENFISVKYTEGPKFAAQLEEHVRHYNIDIIKSQRAKQLRKGDLIEVDLESGATLKSKTVIIATGARWRN
    LGVPGEKELQTKGVAY
    CPHCDGPLFQGKRVAVIGGGNSGIEAAIDLAGLASHVTVLEFLPQLKADEILQKRLFSLPNVTV
    LTNVETKEILGTERVTGIRYADRATGEEHQLELEGVFVQIGLVPNTEWLGDFVEKTRFGEIVVDSRGQTSVEGVFAAGDC
    TNVPYKQIIISMGSGATAALGAFDYLIRH

    >gi|258512479|ref|YP_003185913.1| peroxiredoxin [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSLVGKKIQPFKAMAYRNGEFIEVTDQDLLGKWSILCFYPADFSFVCPTELEDLQEHYDELKKLGVEVYSVSTDTHFVHK
    AWHDVSPSIQKITYTMISDATHEISRNFDVLIEDQGVAERATFLIDPDGVIQAIEITADGIGRDASTLIPKVKAAQYVRN
    HPGEVCPAKWKEGEKTLKPSLDLVGKI

    >gi|258512497|ref|YP_003185931.1| glutaredoxin-like domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MLSSRDQAAIRERLADLKQPVVIKFFEASLGCPTCPEIRSLLRQVTELSDQLTLEVHNLYIDEEEAKKYGVDRAPTIVLT
    DGSRKDYGVRFYGTPSGYEFATLLDDIRMMASGDSGLSAGTRSRLAELKEPVDLKVFVTPT
    CPYCPAAVRLAHRFAFESP
    LVTASMIEATEFPEWATRFNVYGVPKTVINDSEAYALEGAVPEDVLLEQVLATQA

    >gi|258512556|ref|YP_003185990.1| Redoxin domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MENRCGRRGMHMRSGAWRFLATILALSFGLTGCGFQSSQLALAHAGSRDSAVTRNGTSGAAHRSANDVASMTGGQVLVPG
    ALAPDVLLTAESSGKRVWLSAYLGKKPVVLNAWASW
    CPPCHEETPQFVSMYRTYGSEVQFLGVNLTSLDSVPAAEAFVRR
    YQIPYPVLFDTQGDFDRAYSVIAEPMTYVISKAGKVVSIHVGALSASELRAAVEQALASR

    >gi|258512601|ref|YP_003186035.1| SirA family protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSSTGQTQAYTVDKLIDCKGLSCPMPMVRTKKAIDEMEAGQVLEVLATDPGSVADIRSWATRTGHQYLGTVEKDGVFRHY
    IRKAAPDEAKPEKKYPHVASNEELAERVSKGDAVVIDVREPMEYAFGHIPGAILVPLGSLEARIDELKSYEGKDIYVV
    CR
    TGNRSDMACQILADHGFTRVKNVVPGMAEWNGPVEQSEVEE

    >gi|258512602|ref|YP_003186036.1| DsrE family protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSKKVAIIASNGGLETAYKVLNIAMAGVATDAEVAIFFTFEGLNIIHKNSAQLLKFKPENEPFAENFKKHNVPSIQEMLQ
    MAKESGVRLIA
    CQMTVDVMGLKPEDFIDGVEFAGAVNFLDFAYDADVTVTF

    >gi|258512603|ref|YP_003186037.1| Rhodanese domain protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MSQVRGMLAQDLEERLKRGEKLQIIDVREPEEVAAGMIPGAKNIPLSQLQERFREIDPHQETVMVCRSGNRSERACQFLM
    AQGYSNLWNLMGGMLGWRGPVQ

    >gi|258512616|ref|YP_003186050.1| copper ion binding protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MATTTLRVKGMTCDGCVRSVTRALTAVEGVSKVDVSLEKGEAVVTHADSTPVSAIRAAVEEAGYDVE

    >gi|257792982|ref|YP_003186381.1| Methyltransferase type 11 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MRKNVNANCCSAEPEPLTPAKRVIKDFYDTVAVGSGPYPASTDRFSPAAPTEKILEYVKRTNCRRILDVGCGMGTTLLRM
    AQEHVSGVQFIGVDFSEKMIERARTSSLSLHDDLRKKIGFFVANAESLPYMEGQFDFVFSECVLNLIPEREKAIAEVMRV
    LAPGGMFVYTDFVAFSPISNSIRDNLNLVSG
    CRAGSKTLSENIRLLEETGFVKIECIDFTSDKNKRYADLMNESEQIRRE
    FEEFRNLYPDAAAFLDERVGYYLILGCKPI

    >gi|257793122|ref|YP_003186520.1| hypothetical protein Aaci_3135 [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446]
    MRFKPWMKYTITGLCGVVIGINVGVWIGAPRQVTVEMPGATQAPSSNPTVATPEPANSITDPAKPAWEGLQQASASFLQT
    IFRTPVLNAQGKSVPMPTDKPILFSAPW
    CPFCKETEELLIKNHLMNRLTIVGVALNGGEPSEGIPARTVTNAAQAQEAFK
    LDWAHYGIRYPTDGILYAMPGTPIDQAVQSYPTFLIPHDGKWYVEIGYNSSVSFWKAVLG