Desulfovibrio vulgaris Miyazaki F uid59089

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218885215|ref|YP_002434536.1| selenide, water dikinase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSRIRLVDSVKAAGCAAKVAPGDLERILAGLPRDPSVEDRVIVGTRHNEDAAVVRLPGGQSIVQTLDFFTPIVNDPYHFG
    RIAAANALSDVYAMGGEPWCAMNIVCFPVKRLPESILADILRGGSDALREAGAALVGGHSVEDDELKYGLSVTGLIDPEI
    IASNAGLRPGDHLLLTKPLGTGILATAVKANWPGCDAHEEELFRWASRLNKGAGRVIRELRLKAATDVTGFGLGGHCLEM
    AGASGVTVALDTAALPVLPGVTELAGMGLVPEGSHANRAHCHKHVHVAPGVSPVLVDVAFDAQTSGGMLLAVSPDQMDAA
    TTLLAETGDPAYPVGEVLKPLPGGVRLLLR

    >gi|218885266|ref|YP_002434587.1| HesB-like domain-containing protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MFEITENARKELDAYFADKQKNPIRVYLAPGGCSGPRLALALDEPNDTDKVFEEGGYTFCVNAELLTMAESIRIDISYMG
    FSVESGKPLGGGSSCGGCGSAGSCGS

    >gi|218885282|ref|YP_002434603.1| protein of unknown function DUF395 YeeE/YedE [Desulfovibrio vulgaris str. 'Miyazaki F']
    MNAQDMENPGRKPWSPYVGGALSGLLVVASVWVTGKYFGASTTFVRSAGFVERVLAPEHMAALDYFVKEAPKVDWQWMFV
    AGIFVGALLASLASGTFRWQAVPPGWAERFGPSRLRRGVAAFCGGVLAMFGARLADG
    CPSGHGLSGSLQLAASGFVALAC
    FFAGGLVTAYILYRGR

    >gi|218885325|ref|YP_002434646.1| Peroxiredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSCPTQQEYPALATVGRPVKPFTLETYDPTEGSFGQISLEKLQQDRKWTVLVFYPADFTFVCPTELADLAERHAALKDMG
    VEVISVSTDTKFAHLAWRNSERLLENVRYQMAADPTGAVSRYFGVYDEGAGIALRGTFIINPEGTLVGSEVNFYNVGRNA
    AELVRKMQANKHLRDHPAEACPARWEPGARTLTPSEKLVGKVYEDLIP

    >gi|218885328|ref|YP_002434649.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MTPSTRYDMIILGGGPGGSRAAFDAAARGLSVALVDRDGLGGTCLNRGCIPTKLLLGATAALPLLETQKKLKGADGHIAF
    DLPALQQRKDRYVKGTRQALEKRLKAAGIAVYAGEGRVTGERQGDADGELAVVAAQADGTTQETRLGWGTLIVATGSTPA
    SFPGLAADGAAVLDSTALLDVTEAPESLIVVGGGAIGLEMADFFSRFGTRITIVEGMGRLAPTEDAEVGDTLRKVYAREG
    WTIHNGRKVASLATVDGHAVLRFEDGEELTASKALLAVGRRPASVGIGLEALGTTLRGPGWMQTDEWLRAAPHVYAIGDV
    NGRTLLAHAADHQARYAVRHACGDTAAPYDAGVMPACIYGHLEAMRVGPTAEELKNAGFSPRVSRSMLIANPIAQAYGTT
    QGFIKIVWVDGRIRGVTAVGHGVSHLVTLAAVLAGGSGTATGWTAHDAGNVIFAHPTLDEALEAAIEAPQELA

    >gi|218885364|ref|YP_002434685.1| Thioredoxin-disulfide reductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSETTSASANSPLVIIGSGPAGLSAAIYTARAGIPTLVLGSAPKVAGDYDIDNYFGFDETISGRDLIERGRRQAERFGAQ
    LREERVLAVHHGDAGGFHVKTDKGAYDACAVVLATGVARVRPGIDNLGDYEGKGVSY
    CVSCDGFFYRGKQVLVLGEGIFA
    ANQALELTQYTPNVSICTQGKEPVLTPDFRQRLADAGIAIDTRKIARLAGDNGLEGAVFTDGTEAVADGLFVAMGEASSL
    DFAYSLGVERRGVFLVADSEQCTNIPGIFAAGDCTGGFLQIGVAVGEGAKAARSAIAFAKEQCGLKKRSEEDGVKKAG

    >gi|218885428|ref|YP_002434749.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MRIGVFVCHCGSNIGGTVDVPGVAEVARAYPDVVFSSDTMYACSEPGQAAIVDAIREHALDGVVVASCTPRMHEPTFRRT
    VERAGLNRYMFEMANIREHVSWIGKDREANSNKAAELVRMAVEKLRLNAPLYPKSFDVTKRVLVIGGGVAGIQAALDCAD
    GGIEVVLVERESTIGGKMAKLDKTFPTVDCSS
    CILGPKMVDVSQHPNIRLYAHAEVEKIGGYVGNFKVDVRRKATYVDWE
    LCTGCGLCMEKCPSRKSPDAFNEHVGVTTSINIPFPQAIPKKAIIDPTSCRQFVKGKCGVCAKVCPTGAIRYDMEDQVVT
    EEVGAIITATGYDLFDYTKYAEYGGGRYPDVITSLQYERLLSASGPTGGHVKRPSDGKEPKTVVFIQCVGSRDRSVDRPY
    CSGFCCMYTAKQAVLTKDHIPDSRSYVFYMDIRANGKMYEEFTRRAMEEYGVQYVRGRVSMIVPQGDTYLVRGVDTLLGE
    QVEVPADLVVLAVGAESSHGAPQLAEKLRISYDNYGFFMESHCKLRPVETNTAGVYLAGACQGPKDIPSSVGQGSAAAAK
    VLGLFSRGRLESDPQISQVDVRRCVGCGKCITTCPYGAIEWMELRGEMKARVIETVCQGCGICTVTCPQGAIQLQHFTDN
    QILAEVNALCLS

    >gi|218885505|ref|YP_002434826.1| Thioredoxin-disulfide reductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MKTYDAIVIGGGPAGMTAALYLLRSGVSVAFVEKLSPGGQVLMTAEIENYPGFPKGIQGWELADLFAAHLERYPHDKYND
    AVTAFEPAPGANRVRVGDEWIVGKTVVVCSGARYKKLGLPDEDRLIGKGISY
    CALCDGNFFRGQKVGVVGGGNSALEESL
    YLAKLVANLHLIHRRDEFRGCKCYQEKVQSAPNIDIEFSSVVRKLHGDTGLTGITLADVKTGEERFLPLDGLFIFIGFEP
    VGDFLPDGIDKDPQGFIITDTEMRTSLPGVFAAGDIRSKACRQVTTAVGDGATAATAAFTYLEQLDA

    >gi|218885506|ref|YP_002434827.1| thioredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
    MAVQITDANFEANVLKSSIPVLIDFWAPWCGPCRAMGPVIDELAAEYDGKVLIAKMNVDENPATPSKYGIRAIPTLILFK
    GGEVVEQITGAVSKSSIKDMIAQKALG

    >gi|218885579|ref|YP_002434900.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris str. 'Miyazaki F']
    MKRLTSLMLLPLLLVALCGVAAAAPAVEEMGSGELLRRVTAARGKVVIVNFFASWCPPCLEEIPGLINVRARYSEDKVAL
    YGISLDENPRQLAAFMSRTPFNYPVWKGKEELQRFFNVSSIPQLLVYDRQGKLVANHVGLVEADELGKFVDTLLGGN

    >gi|218885743|ref|YP_002435064.1| Methyltransferase type 11 [Desulfovibrio vulgaris str. 'Miyazaki F']
    MTVPSGLDASAFVPGVAVPSGDAALAGDSAPVAGPRGLWEHSALRGPWEHPALRAVAGATLRPGGVALTWRALELARQLT
    MWPHNARVLDLGCGPGETVALLREGGMAAVGLDISASLLAEALARNGRMPLIRACAGAAPGLPLRTASLDGVFCECVLSV
    LPQQQGVLAELARVLRPGGVLVWTDLYVRLGRAADVWRGKGGCPDGCAESCGDGDESRCSGPQPGVLS
    CRAGAMPRAGME
    AMLRRAGFTVLAFEDHSRLLAELAGRLLFAGADPAELFGCGGAGGGRAGYALLLARRGDAVSREYAP

    >gi|218885970|ref|YP_002435291.1| Redoxin domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MDHTGIITFRGTPLTLTGTPVAKGDKAPGFSALANDLSPRSLADYAGKVLLISAVPSLDTGVCDMETRRFNQEATRLGAD
    VRILTISCDLPFAQARWCGAAGVDALETLSDHRDLSFGSAYGVVIKELRLLTRAIFVVDRSGTVTYTEIVPEVSHEPNYE
    AALAAVRAAL

    >gi|218886000|ref|YP_002435321.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfovibrio vulgaris str. 'Miyazaki F']
    MARTPRHDADLLVIGGGAAGLTAAAGAARFGARVVLAEREPALGGDCLHHGCVPSKTLLATARARHVMRRAALFGLPAPE
    LEPVDFAAVARRIREVQAVIQRHDSPQRFTGLGVDVRFGPARFCDEHTVEIGGRRVSAARILIATGSSPQLPPLPGLDTV
    PFLTNRDIFSLDALPASLLVLGGGPMACEMAQAFARLGSRVTMVLRGPRILPRDDADMAGVVHASLAADGVRVLAGATVK
    MLRAVSAISGRFGKPGEPVGADGNDAAGTGVEAELEVPQGEGRGPLVVRADRLLAALGRTPETAGLDLAAAGVATGRHGG
    ITVDGRMRTSQPHVFAAGDVTGDWQFTHAAGHEAGVVVANAVLRLPRRADHARMPWCTFTDPELASVGCNERMAAERGLP
    VDVHVEPFAANDRALAEGTPEGRLKLVLRKGGNRVLGVQAVGPHAGEVLNEWVAVLGGGVRLSALAGAVHPYPTLGEISA
    RAAGNVVSRVLFSVGARRLLRLLFGYRG

    >gi|218886251|ref|YP_002435572.1| alkylhydroperoxidase like protein, AhpD family [Desulfovibrio vulgaris str. 'Miyazaki F']
    MNDQLRALTAQRKRAHSRLAATGAPVYAAFLDMERAAYADGALPKRHKELIAVGISVVLDCRSCMQWHIEQAAAAGASPA
    EVLEAVEVGIEMGGGPATVSARFALEVMDEVFGARWTDDVKADMATRRRAAVAAGRSASEGGGVA

    >gi|218886272|ref|YP_002435593.1| Rhodanese domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSMKKLVAPLVLLAALGLAGCNNPFAGPSEVDLEAKAVKLARDTVKGGYELLTVAELKKWQDDGKDMLIVDTMPFEDSYK
    KNHIPNAVQFLFPIPDMPEWKMTETGDKSEQDFEKLLGPDKDRPLVFY
    CGFVKCTRSHNGAVWAKKLGYSKVYRLPGGIV
    AWKEAQYPVKSIN

    >gi|218886318|ref|YP_002435639.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris str. 'Miyazaki F']
    MASVFSRRGLWMDGVRGVLPHGEARRRAVPATGPATRFGRLHRGVLLVACLLAFVVASVTMARAGQSAVPQEQPGAGAHD
    AATPWPAGARFPDIALGPAAPSPDMAMPERAPGDREGLPARLSDLRGQVFIVNLYSWF
    CAPCQEEAPALRALHARIASVG
    QGASGSRGELAGRVRLVGIAAGDDWNLVQAFRQRHGLAFPLFADPELALHGQLGNLPVPFTWVLRREADGFRVLFTHAGA
    LSGTPADFLDRVLAAAGPLS

    >gi|218886331|ref|YP_002435652.1| methionine-R-sulfoxide reductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MFATHSTARPTRRSPGARPRLLSRVAARLTRARRHRPGQDPADTAGSLPAHGRIRTREGLPDLLWLLLAVLLFALLAGQP
    GVAAQQPTSASGATVPGMAASDAAPLPTHSPNASPDVAPHTAPDAKHDASGIKGDIPMTTPAPWQRFSKPADKELRARLT
    PLQYEVTQKEGTERAFHNEYWDEKRQGIYVDVVSGEPLFLSSDKYDSGTGWPSFTRPVTPDAVTEHMDRTLWMVRTEVRS
    RIAGSHLGHVFPDGPAPTGQRY
    CMNSAALRFVPQEAMQAEGYGEFLGLLP

    >gi|218886803|ref|YP_002436124.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MANRKASRAVDIAPRSLAEVRTETVECDLLIIGGGNAGCFVATEAKRLDPSLRVVIMEKAEIMRSGACSAGMDALNTYIP
    EGKTPEDLVRWSRAQVGGGPLREDLALSNAEELNEAIDDLERWGLPILRDENGKIRYRGKWDISIHGEQLKPIMAEKAIE
    AGAEVYNRVVGTGLLMDGGRCVGAMGLGVRDGAFYVFRAKSVVVSTGGAGTLYKSYTADSTDSGAQIWMCPYCVGSGYAM
    GFRQGAELSSLEQRWVATRTKDFCGPVDTISVGYKAPIINCKDERVMSRYAHLGGDAAPRFIRANAPMEEWLAGRGPCYC
    DTRNMAPELVQAMMTDYLNERPSFVLFLASRGQDVTKEPIEIYGSDPYIMGGHTMGGFWVDMQRMTTVPGLFAAGETAGG
    NPNKFVGGCAAEGKLAARGAIAYMAAGLEKPDEAAVSAQLESEKARVYAPLLRGKDYDGVTPTEMKERLQRLMDEYAGGS
    SQFYRTNEERLDYALRHIKMLQSQFAYLKAADLHDLMQANETMDRVDVAEAVVHHLKARRETRWAGWQTRSDYPGRDDAN
    FDCFVETRRDPATGEVTAFTRPYEQLVPGDRFKA

    >gi|218886894|ref|YP_002436215.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris str. 'Miyazaki F']
    MPFRHTPEMPRPSKQAAAIARTAPRHWRPGQPHGTVIPLPLLRTLLLAALLALLPACATPTLAEPVPASSPFPDIPLENA
    ATPAQLAALGLSGEGPWKLSDIRPASGGKAQLVLIEIFSMY
    CPHCQREAPHMNRLAELLAASPLKDRITVIGVGAGNTRM
    EVDLFRERYGVAIPLFADPDLAVHEQVGEPGTPHFFLISLKNRAAPATLFSRTGRMASPQAFLDELSAIAKRSN

    >gi|218886895|ref|YP_002436216.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris str. 'Miyazaki F']
    MPRTTASCTGTPSPDRTVLAGRTAQTSSAPGTPSWSTGPTGHTGRLLAAAILALALVGGLAVAVPVQAIGLQDLIYPDAP
    RKPVDSVLKVAVGDTAPDFVLPALPGPYTSASGPDAGTVRLSDFRGKRAVALSFVPAAFTPV
    CSGQWPGYNIAREEFERR
    GAVLLGITTDNLPSLYAWTREMVERAPGNGNDEGRGAKGGSQNGDGAGQSSPPPRKGQAATPRQGEVGGATGGVWFPVLS
    DFWPHGAVAASYGLLRGDGMAERALVIIDRQGIIRHIHVSDVNKRPPLDIILRALDALPAP

    >gi|218886962|ref|YP_002436283.1| Rhodanese domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSPSPRVPIESISPQALRDFMAARPEGSYVLVDVRQPEEYRQEHIPGARLVPVGELARLLATLDPAQDHVFYCRSGGRSA
    AAAVMAAESGRFAAPSLGMGGTGATGGMGGSGATGGMGGTDATGGMGGSAATAGGRILNLTGGMNAWSAGPGQAVANSPR
    IQVFAGVRSMVELLRRALDMEKAAHLLYTRVRAAGPKPAVCALMDRLIGVELAHAKVVYHHLAQRWDADAHADATRGPLP
    PFDALFEALEGRVLEGGMAVSDLEPWLRDAASGDCLDIAELALEVEMNAYDLYRTLADEARRGSGLGGLAERAFLDLATQ
    EKTHARMIIDQIATFSADGEDR

    >gi|218886976|ref|YP_002436297.1| HesB/YadR/YfhF-family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MITLTDRARTELDAYFSDKERSPIRVYLAPGGCSGPRLALALDEPGEEDKVFEPGGYTFCVNGALLEQSGAINIDLGSMG
    FAVTSEVQLGGGGGGCSGCGSSSSCCG

    >gi|218887038|ref|YP_002436359.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSKHVVVIGAVALGPKAACRFKRLEPDAKVTMIDQSPRISYGGCGIPYFVSGEVNNIDALQATPYNVVRDPEFFRINKDV
    DVLTETRAVSIDRAAKTVLVEHLRTGKQQTLSYDKLVLALGSRANRPPVEGLDLAGVTAATNLEEAEFIRNSVAAGTVSN
    AVIVGGGFIGLEMAVALADMWGIGVTVVELTDRLMPGFLSSTLTRMVRHDLEKNGVTVLTGEKVVRLEGEDGAVARVVTD
    KRTIDAELVIMAAGVSPNTAIAKAAGLDTDPRGALIVNDRMQTSDPDIYSGGDCVTIPNLITGKPGFFPLGSMANRQGRV
    VGTNLAGGNATFPGAVGSWVVKLFEISACGAGLTIETALREGFDAINVHVEQFDRAHFYPEKTIMSLELVVEKSTRRVLG
    IQGVSTLGDALTARINAVATLLADKPTIEDISNAEIVYSPPFASAMDILNVAGNVAENILEGRCAVIDPEEFERLWNERA
    SNDTVCFIDTRLIGNSQPLAEKYPGQWNAIPEEEIHDRIAEIPTDRTVVLVCNTGLRAYESQLMLTKLGVTNTVNVQGGM
    VAMHKIGTDI

    >gi|218887040|ref|YP_002436361.1| transcriptional regulator, AraC family [Desulfovibrio vulgaris str. 'Miyazaki F']
    MRGREGKGIFLLGGEQRKIRMEKRTRRAYVAVMDTPTRHIAADPVTAASGTTTAPGTALRPDDPRLALVRAACDTLRQRA
    EPVPLAELAEAAGLSPSHFQRVFTRLVGVSPRAYQQACREQRLRGALERGVPVAEAIYEAGFGSPSRVYEDAHGMLGMTP
    ARYRKGAPGRQLAVAAAQTSLGWLVMAATEDGVCAIDIGDDREALLADLQRRFPGAELHTPSDAVRQWLGTVVAFVEHGG
    AHPALPLDVRGTAFQHAVWSALRELPPGTTLGYAQLAARIGRPSAVRAVAAACARNPVAVVVP
    CHRVLGRDGALTGYRWG
    VDRKAELLRREAARMPIG

    >gi|218887043|ref|YP_002436364.1| UBA/THIF-type NAD/FAD binding protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MPGKANRPSAPHLTVTGLFVYTVAEGVPGNPVHARFWAPVPKEFAVDSSDMLRQALERAAVPGTQPDGRPVRVVPHGAAD
    GAARQAGVLLRQAEIAALELGLVPERYLRNFATLDCAGQARLLRARVALVGLGGLGGHILEGLARMGIGQIRVADHDVFE
    PTNLNRQLLATQAELGAPKADAAVRRVAQVNPAVELDVWRGRLEGQDFARFYAGVDVAIDALGGVAFRPAAESGAAAADV
    PLIAASVAGWTAMVATALPGERGLAGMFFPHGQPAATPAEDVLG
    CQPPALLVAAGLVLSEAVRLALGQPPRLGGSHGRMA
    VVDLTTISLDRLSLQG

    >gi|218887167|ref|YP_002436488.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MKLSVSNSRGKDAADRDWFIPEDGRKQLTQLFAKLPNPVVLDVFTDGDEKNAFNGYTRRFAEDISLLVDKISMHHHALDS
    EEAKRRDVTLSPTLFVGTGEADPKLDYRIRFTGAPLGEEGRALVESIFLVSLRQSGLTETSRRILSELKEPRKPRVFSSP
    G
    CPYCPGQFMHAAKCAIERPGLVEAECVNSDEFPDLSKKYGVGSVPHTQYDDTYKAIGLMPEERFVLELVTLKSADELMR
    EHGMEPGHEGHDHAHGAHGMDPEGLDVVETDMVVLGAGPAGLSAAIYGERSGMKTVVLDKSVVGGQVTVTPVVENYPGFT
    DIAGLKLVEVLSAHARQYATVREGETVHEVKIGKLIEVYTNRAVYLCKALVFATGAQWRKLDAPGEGRFYGRGVSY
    CASC
    DGFMYRGKRVAMIGGGNSALTDALHLKNLGADVTIIHRRDSFRAEKALQDSLEREGIAVIWDTVVEEILGDTVAPVREGD
    GGDGKDAAPGTAPAEPDTGVVRGIRVRNVKTDAVSELPFDGVFVAIGHIPNSEQAAELGVVLEKDGSIKVDRHMRTNIPR
    IYAAGDVTGGVRQIVTAVGSGATAALAAFEDTQNPYWKKKGE

    >gi|218887262|ref|YP_002436583.1| DSBA oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MLRTLFIALLLALTLAATSTVPAPAQAASNEELKAALRDLLKENPELIMQVLRDNSETVLEIAQQGSNVRRKKALIAQWQ
    VDQTQPKKANLEGRPMRGPANAPVTIIAYSDFT
    CPYCQQAAGTMELLLANYKDKVRYVFKHMPLDSHDNARLASEYHVAA
    GLQDGKKAWAFYETVFRDREKLVAEGEPFLKKAAADAGLDMKRLAQDIKGKKVKDSIEEDMAEARALNVQGTPYFLVNDL
    VIRGSLPLDLFSDAVDMALEAAAKTKK

    >gi|218887709|ref|YP_002437030.1| Rhodanese domain protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MLLWLAALCVAAYSVQAMLPRIAPDTVRAAQQTAGQVDGLVGGWRNVTPQEAATVIGQRANDEAFMVLDVRTPGEFSEGH
    LQGARNIDFTSPEFRDRVRSLNRNRTYLVY
    CRSGNRSGKALEVFRELGFTSILHMDGGTLAWNAAGLPLEK

    >gi|218887845|ref|YP_002437166.1| protein of unknown function DUF255 [Desulfovibrio vulgaris str. 'Miyazaki F']
    MLAGNRLSTSKSPYLLQHADNPVHWHPWGDEALQRARDEDRPLFVSVGYSTCHWCHVMAHESFEDDEVARLLNDAFVCVK
    VDREERPDIDAAYMAACQMLTGSGGWPLTIIALPDGRPFFAATYLPKHSRPGRIGLMDLVPRVLEVWRHKRDDVLDSADS
    IVEHVRRHAEAMLRPPADGRLPGAGTLHAACEAMASEFDAVNGGFGTAPKFPSPHNLLFLLRWARRNGHAAGQPGLAQAG
    TVPTGEESGGAKALRMAAQTLRSIRRGGIHDHVGYGFHRYSTDARWLLPHFEKMLYDQAMLMLAYAEAWLATGDGEFRRT
    AEETAAYVLRDLASPEGAFYSAEDADSELDGARGEGLFYTFTLADIEEACAPLDVRPGVRPAVRPDGDGGGGVNPASLSE
    ADLTARAFGCTAYGNYEDEATRSRTGRNVLHLPRAPQELARDLGLPPREVEERLEAARAALFDLRARRPRPHLDDKVLAD
    WNGLAIAAMSRCAQAFDAPHLAEAAAAAADFVLARMVTQEGRLLHRWRDGEAAVPGLLDDYAFMIWGLIELYGATGEVRW
    LRRALRLQEVQDTFFHDAEGGGYWMTPADGDALLVRRKEGHDGALPSGNAAALFNLLRLALLLGRPEYGERARGVLRAFA
    TQVRHHPVGSTMFLCGVDFALSGGRSVIVAGEPDQPDTEAMLAAVRGTYAPTTVLHLRTTDNARDLAALVPFTAHLAPLE
    DRATAWLCENYACSPPITDPAELKARLLAVRPLAQG

    >gi|218887903|ref|YP_002437224.1| methylated-DNA/protein-cysteine methyltransferase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MPQPRSATPRRRAALDIPDTALFDEVRERLVAGPLSLILHWRAQHGKDRLREITMSWDGAALAGAPAERDGWTNPRPDAW
    PGLPAGPVTAHGRAVQAALADYVAGKPVRWPDMPLLLDGLTPFTRDVLLALRDKVGHGQFTTYAGLAELAGRPGAARGVG
    QIMARNPWPLVIP
    CHRVLGGSGRNIRLHGFGASGLPMKRWLLLLEGAIDNTMKD

    >gi|218887946|ref|YP_002437267.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSELITAASLSGKAAPDFRLADASGAPRGLADFAGTWLVLYFYPKASTPGCTREARDFTCMLPDFTAAGAAVVGVSPDSP
    KAIGNFTLKQDLGVALLSDPDRAVAKAYGAFGTKMMYGKAVTGIVRSTFLIGPDGTVRAVWSPVKVDGHAQAVLDELRRL
    AGK

    >gi|218887978|ref|YP_002437299.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSNSILVVGGGFSGLTAAIEAAEVGYEVYIVEKTPFLGGRVAQLNKYFPKLCPPSCGLEIQFQRIKKNPRIKFFTQAEVT
    AVSGDAGNYTVKVHIEPRGTVPSSADLSLLASSLESDVDNEFELGLAKRKPLYMSVPFAFPSRFVLDKAALSRADELKVG
    KSAFCDMNEAPRDIELNVGSIVVATGWKPYDVTKLSNLGAGAFANCVSNMQLERLASASGPTAGQIKRPSDGKAPKKVAF
    VQCAGSRDQNHLNYCSYICCMASLKQALYVREQYPDAEVTVYYIDLRTPGRYDKFLRKVKADEKIALVKGKVAGVEEDAA
    TGDVIVEVEDAVKGEKRKYRYDLVVLATGMQPSLAGQKLPFDVPVDEEGFIVGGEEKGIFAAGCAQKPLDVMRTAQSGTS
    AALKAIQTVRGR

    >gi|218888017|ref|YP_002437338.1| glutaredoxin [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSDDSNEVKLFALSTCVHCKNTKQYLEEHGVDYKCVFVDQLEGDERKAVLEEIRAHNPKLSFPTLVCGNGRVIVGFHKED
    IKEALHL

    >gi|218888120|ref|YP_002437441.1| cytochrome c biogenesis protein transmembrane region [Desulfovibrio vulgaris str. 'Miyazaki F']
    MRKENKIMHLNGVFFCSRVSLAVLVWLLCAAFSLHAADLSVPEGGSTGLGPRPEVTVEVFREVRAGEDGVLAVVWLEMPS
    GYHAYANDMDGSGGKGSGVGLPTVVTVRGASSQVSAPAQAAAPVGTPGILYPPGREIMDPLSPGQRVQVYEGRAPVFVRL
    PQDHLDRDLTASVSLLLCSDRNCLPYRGGVGFRVDGATLGQLPRADDQPWTEQLRTARPGVQVASTRLGEDAATAGQPAS
    TAAGSGTFPRVAPAADATPAKGTQDAQGAQEQGDRVTIPFGKGGRSVPLPGMPDAQAAANATEGAVSGSLPGTIHWNFAP
    RYQVPELEVSGLGKALLLGLLAGLLLNLMPCVLPVISLKLSGFVAVAGLGGDEARRAHFREHNLLFAAGIMAWFLLLAFI
    LGGAGLAWGQLFQRPGVVMGLLMVVFGLGLSMFGLFTLPVLDLKAVGAGGSSRAQPFFTGLVATLLATPCSGPLLGGVLG
    WAFQQPPEIMAFVFTSVGMGMALPYLVLAARPGLVRHFPRPGAWTGTLEQLVGFFLMGTAVYLLTILPDAWLMPALVTLL
    AVAFAAWIWGRWGGLDASPRRRTVVRLTAPALVAVAVWLAFAPSAPPARWEPFEPATFRAMLGREPLIVDFTADW
    CPNCK
    LLEQTTLSSGAVSEWARRYGARLVRVDLTAESPEAQALLRSLGSSSIPVVALFPKGLLSASPVVLRDLFTTGQMEQALLE
    AFGKPKQEWTD

    >gi|218888139|ref|YP_002437460.1| peptide methionine sulfoxide reductase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MSTLLQSPFIETATSALTALATHPALSGLSGLSAISGLLLTPLLLAALLLPATARAAQDNTAAPPRQAAATATAVFAGGC
    FWCMEKPFDQLDGVLETTSGYTGGNVDSPTYKQVSSGLTGHAEALRVTYDPARVTYEALLDVFWRNVDPLDAGGQFCDRG
    NQYRSAIFVADAAQREAAETSKKAVEARLGKPVATGIEMAGTFWPAEEYHQDYYRKNPIRYAYYRTGCGRDKRLEQVWGA
    EK

    >gi|218888253|ref|YP_002437574.1| heavy metal translocating P-type ATPase [Desulfovibrio vulgaris str. 'Miyazaki F']
    MTTPEELPGVPQQSAPASGTPPVPEGAAAPDLSRQILPVRGMTCAVCAGRIERMVGQMDGVSRISVNLATETMDVAWNPA
    ALHLDDIAERVKDLGFEAVLPDPASTAGQDDGLLRYAVRGMH
    CAACSARIERAVGQLEGVAAVTVSLATETAQVTPAPGL
    GPDATDALAAAIPARIADLGFSAERILPRQDSGTALWEAQREEAAARLARMRGKLAREFAFTIPLLVLSMGHMAGLPLPA
    SLDPHHAPLAFALAQLLLTLPVMWFGRDFYRIGFGNLARRAPNMDSLVAVGTGAAFAYSLWNTVEIGLGVEVARRVMDLY
    YESAAVLIALVSLGKYFELRSRTRTSEAIKALMELAPDTALRMEGGEAREVPVASVRVGDRLLVRPGARIAVDGVVEDGT
    SSVDEAMLTGESLPVTKNPGDPVAGGTINRHGSFVMRAERVGADTVLARIIRLVQDAQGSKAPIANLADRVSLWFVPAVM
    ALAVLAGVAWYAAGAEFAFALRIFVAVMVIACPCAMGLATPTSIMVGTGRGAQLGVLIKSGEALEQAGRLTALVFDKTGT
    LTVGSPRLTDVVLLTDVVPLTDVAALTDAATAGAAGEAAPAHGDAHFDESALVRLAASLEALSEHPLAEAVAAGATERGL
    APWPVQDFLAVPGKGVRGSVVTDDGAQRAVAIGNVAFMAAENVAGHDAPHVTARADALAEQGRTPLYMAVDGRMAALLGV
    ADPLKPEAPAVVRRLRDMGVRVVMLTGDNRRTALAVARQAGIDDVRAEVLPDQKEQAVSALQAEGHVVGMVGDGINDAPA
    LARAHVGIAMGTGIDVAVEAGDIVLLRGGLDGVLTALALSRATVRNIRQNLFWAFGYNVLGIPVAAGLLHAFGGPTLSPM
    IAGGAMALSSVSVVSNALRLRFFTPDDGSADGPETNPETSPAASPETSPEGAGKNA

    >gi|218888262|ref|YP_002437583.1| OsmC family protein [Desulfovibrio vulgaris str. 'Miyazaki F']
    MTMKFIDVAFNGGMKIDAILHPAVTPTGADAPTGQDTPQPAPGTAAPASTVIRTDQPVKDGGEGTAPTPFDLFLASLATC
    AGVYAQRFCEARKISTEGLGIRVGCEFAPKGFQVTRMTFVVTPPQGFPDEYRDALVRAVELCAVKKHIMTPPAFEVVLA