Desulfovibrio salexigens DSM 2638 uid59223

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|242277515|ref|YP_002989644.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio salexigens DSM 2638]
    MSCTEVYEEVLSSASIGETVPDFVMEAYDPEDCGFTEVKFEEVRKAGKWLVLFFYPADFTFVCPTELADLADKHAELEKL
    GCEVVSVSTDTKFTHLAWKNDERLLQNVKYKMAADPTGEVSDFFGVYDHNTGLALRGTFVINPDGMLVSSEVNFYNVGRN
    AEELVRKIEANVYLKDHPEEACPAKWTPGEKTLTPSEKLVGKVYEELNGE

    >gi|242277587|ref|YP_002989716.1| heavy metal translocating P-type ATPase [Desulfovibrio salexigens DSM 2638]
    MRADKTYASIKHSIPGRIRFKVPDLRKDKILCGTVERNLEKVAGIIRTRTNDKCAALVIRYNPDFISPEHVYEALREIVA
    VHTTKICPIKDKKECGCPQVKGALRYFSFVSAVGGAVLISESLLGITVAQTLFSPLGFLTVLAAVPLVKEAVTKLREKKF
    GLEGILAGGIVAAVIAGEAMTAFEILWINAGAELLTAWITERSRRAISGILDNTTHHTFVLRDGVEVEVEINNLKEGDVV
    VLHTGEKICVDGTIVDGQGLINEAPITGRADFIHKQQDDQVFAGTFVREGVIYVRAEEVGDKTYLARILHKVEDSLENKT
    AIESTADKLSVRLVKIGFACTVGTLLITADPWRAFTVLLVMACPCATVLSASTPISTAISTAAKNNILIKGGRYLEEVGK
    CDIACFDKTGTLTGSEPSLEHIHTTEGVTESELLTYAFSVETHNHHPLAQAIKHEAGLRKISPLPHTVCEYFLGKGMRAE
    LPENENHSTEILVGNKKLTEQFDVRIGSLSRQVSTLKRKGLTVLYVVKDKDPIGLLAFANTIREESATVLNALGAGGVDR
    TVLVTGDEPATANDLARTLNIPEIHASAMPEEKATLVRTLQSEGGKVMMVGDGINDALALAQADVGVAMGTGGAEVAVEA
    ADIALVDDDLKGLMYVQQLSQDTVKIAYQNFWLATGSNIAGVIMGATGVLSPVMAGFLHILHTMGVIANSSRLLLHSPEA
    IESKQGKIYELPQNS

    >gi|242277708|ref|YP_002989837.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MSNSILVVGGGFSGITAALEAAEVGHEVFIVEKAPYLGGRVMQLNKYFPKLCPPSCGLEIQFQRIKNNKNVKFFTLAEVE
    SISGSKGNYEVKVRIKPRYVGPGSVELTDVIAKLSNDITDEFEFKLCDRKALYMDVPFAFPARYVLEKENCTDEDLKLLE
    GVDVIDLKEEEKVITLNVGSIVYATGWKPYDVTKLSNLGAGTVQNCISNMAMERLAAPSGPTDGKIVRPSDGAQPKNIAF
    VQCAGSRDENHLNFCSYICCMASLKQAAYVREQYPDAKVTIYYIDLRTPGRYDKFAKRILSDDKINAVKGKVAEVIEESG
    SGNVLVTVEDAESGIKSQNEHDLLVLATGMQPSLAGTPVPSGVQVDDQGFIVGGEEQGIFAAGCAKQPLDVMKTAQSGTA
    AALKAIQTVIGR

    >gi|242277762|ref|YP_002989891.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio salexigens DSM 2638]
    MIKTILCTLAILLLAHVPAQAKVAKEQIYKQHPLKAVDSVLKVKVGDEAPNFTLPAISGTKVSLSDYRGKKNVVISFVPA
    AFTPI
    CSDQWPGYNIARELFEMHDAVILGITADNIPSLHAWTTQMGEGGLWFPVLSDFYPHGEAAKKYGILRPEGITERA
    IFIIDKKGILRYIDVHDINKRPDLGQIIKALEKLN

    >gi|242277763|ref|YP_002989892.1| redoxin domain-containing protein [Desulfovibrio salexigens DSM 2638]
    MRKICFVLIIVTLFVTSMAYAAPIQPGMDFPEIPLEGKLTETQKQYLALKGNGPWKISDIDAEYLLVEVYSMYCPHCQRE
    APTVNTLFERLKKGSGKQVKLIGLAAGNTEFEIDFFKEKFNVEFPIFADPELDLHDKVGQPGTPHFFLLQNDGGKYKVLL
    SHEGPFESTEKFMQTINNKL

    >gi|242277773|ref|YP_002989902.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
    MTGTPLWEKSILRDAAGNTLRPGGFTITDRAVELARLKSGARVLDVGCGLGATVEHLHEKHGFNAFGMDYSPRQLSEAPA
    ELPLTRADGSNLPYADSSFEAVFCECVLSLIPNKEKAILEFKRVLTKGGKLIISDLYQRGKGLDQCSDGS
    CASTPLYLKR
    IEQIFKENGMQITSIEDYSRLLVELAAKLVFAGEKNPTAGQNCCDRPGYMLLIAEC

    >gi|242277787|ref|YP_002989916.1| Redoxin domain protein [Desulfovibrio salexigens DSM 2638]
    MNERTGIITFQGNPLTLLGTEIKVGDKAPGFNVTDNGLAPKALSDFAGKVLIISAVPSLDTPVCDMETRRFNNEAASLGE
    DIKILTLSMDLPFAQARWCGAAGVEAVQTLSDYKESSFGEAYGVLIKELRLLSRAVFVVDKSGEVQYVQYVNEITEEPDY
    DAALAAAKKLV

    >gi|242277809|ref|YP_002989938.1| NADH:ubiquinone oxidoreductase, subunit D [Desulfovibrio salexigens DSM 2638]
    MAKFKEVLLKPLLEDNPIAVQILGICSALAVTTKLETAFVMSLAVIFVTAASNVSVSSIRQHIPSSIRIIVMMTIIATLV
    IIVDQFLKAFAYGISKQLSVFVGLIITN
    CIVMGRAEAFAMQNTPKMSLADGIGNGLGYGLILIIVAFLREFFGSGKIFGL
    SVFKLTSEGGWYEPNGLMLLPPSAFFIIGLLIWSVNVYEKRKNKR

    >gi|242277810|ref|YP_002989939.1| NADH:ubiquinone oxidoreductase, subunit E [Desulfovibrio salexigens DSM 2638]
    MEHLVNIFVKSIFIENLALAFFLGMCTYLAVSKKVQTSMGLGVAVIVVMTITVPVNNLLYNYFLREGALAWAGFGDTDLT
    FVGLISYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLITVN
    CAILGASLFMVERDYNFVESVTFGFGSGVGWALAIVL
    LAGIREKMKYSDVPEGLDGLGITFIVVGLMSFGFLSFSGIQM

    >gi|242277827|ref|YP_002989956.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfovibrio salexigens DSM 2638]
    MSKRLVVIGMDEPALNAAQSYLKECPDAEVTVLYPELNPLPEFICGTVERYLQNGMTFPEDLRASGVDRDSKQVLTRDVA
    SGAESAITYDALIIATGSAPEDLNIPGDHLGGIVRVGSFDDAKRLRAIEGKTVIVGGGSSLLLTVSSLMRHKTGTVEVII
    PANSEYDAPLSDNLMGMVHHHLTTKGIVLHKDQKLVDISQCENGIKIRTTEKEIVADRIINATPSQPITHIFSSAGLSMS
    RNGGLVVDSRLRTSDPHIYACGSCATFTSPFCDIPIPGITIRASEPRQSCTLAANLIGNPRQFTTPTGAYSIILDKFTVA
    GAGLTLNEAKKCGFTPMSATVVQFDRAHFMHGVELMTLELVFDAPTRRVLGIQGLAKSGQALCGRISAVSAILSRKPKIE
    DISNLEIAYSPPFASAMDVLNTAANVADNMLEGINEGIDAIEFKELWKERECGEHFFIDCRELGNARPFVEKHPTHWNHI
    PQGQIARRLAEIPEDKKIILI
    CNTGARSYEAQVVLKHAGFKSVVNVDGGMAAVRQSGIEI

    >gi|242277851|ref|YP_002989980.1| Rhodanese domain protein [Desulfovibrio salexigens DSM 2638]
    MRKMQFFKVVVLALCLAFIAAPAMAKEVVPKSKMQDWMYKDMVDTDFVAKYAKMPKPEGVMIIDSRPYKGKYILGYIPTA
    VSIPDSKFDEMTDKLPKDKNTLLIFYCQGLK
    CKLSHKSAKKAVKLGYKNVKVYPYGYPGWMKSGRYGGIGLETVAEMMAN
    GDPYMLIDARPTKKFLAGSIPSAISIPDSKWAKRTGLLPADKKNTKLIYFCGGYK
    CKLSHKSAIRAMGIGYKNVHVAEAG
    YPGWKKMFGASGAVEVKSGGEEGSIDIEQFKKIVAENPNSIMLIDVRDADEYAQGHIPSAVNMSVDMLEKKIKTLPADKP
    IVFV
    CTTGARSGEAYYMTLDMRPDIKKVYYLEAETDFHKDGSFTIHTPKK

    >gi|242277852|ref|YP_002989981.1| rhodanese-like protein [Desulfovibrio salexigens DSM 2638]
    MIRMRISITTFFLFLIMFSAVQVRAEQERPIWWNDVQKEADRYGYKLLDGPGVEEKLKEVPGIMLLDVRAGYEFEGGHIP
    GARNMEFELGEDQYFSKEREKQLRELLGPDLNRPVIIY
    CRSFR

    >gi|242277879|ref|YP_002990008.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MLKLILLILSVAVLISGCFNKQMLKEQLAEAIRENPEIVLDAMRERKMDMLVILEQGISEREKLKREARLEAEIKNPLKP
    QIRAERIMLGNADAPVTIVEYSDFL
    CPYCSKGASVVSKLAQDQPDKYRVIFKHLPMHAKSRELSLNFEAIALFDKAKAYQ
    FHNLVFERQKELYDDNSGVVLSNILGEVGVDPEQVRKIANSAQVQQYLLDDGKEAGEFKINATPTFLINGVVVRGYLPVD
    MFENKVNLILEKSTQNAADATQEGELCEDCLNQM

    >gi|242277885|ref|YP_002990014.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MSESTIYDMVIVGGGPAGMTAGIYAARAGLKAVILEENITGGLVNSTYTVENFPSYPTIHGMDLMKKMRAHVDSLEVEVE
    EVCEIESMDLEGELKTVETDEGTLKAKTVIICTGRKPIPLDVPTECDQVHH
    CAICDGGPYKGKRVLVVGGGNSAFDESLY
    MITLGIKHITLIEVMDRFFAAQGTQDQLLGTGKVNARTETKVIDLVVENDELKAAVLENVSTGEQETVPVDGAFVFLGQN
    PNNELFAEKIKLSKNGYVITDEHMATSIPGVFSAGDINDKAYRQITTAMSDGTIAALAAERYIRT

    >gi|242277886|ref|YP_002990015.1| Thioredoxin domain protein [Desulfovibrio salexigens DSM 2638]
    MFTELTDANYAQTMADTESGVLICYKQQCPHCKNMEKVLEKFSKKNPDVSLFKLDSEANPEALAELDSERAPTIFVIKGG
    TMVARKGGLMNPKEMKAFFASA

    >gi|242278076|ref|YP_002990205.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfovibrio salexigens DSM 2638]
    MKIGVFVCHCGTNIEGTVDTAAVAAAAREFPGVVFATDTMYACSEPGQDEIIEAIKEHKLDGVVVASCTPRMHEPTFRKT
    LERAGLNRYLFEMANIREHVSWIGRDREANTNKSVDLVRMAAAKLLNNKPLHAKYFDMNKKVMIVGGGVAGIQAALDCAD
    GGLEVILVEKTSSIGGKMAKLDKTFPTVDCSS
    CILGPRMVDVAQHPNITLYACAEIEEVNGYVGNFSVKVKRKATYVDWD
    KCTGCGICMEKCPSKKADNPFDEELGKTTAINIPFPQAIPKKAVIDPNFCIKIKRDKCGVCAKVCPSEAIVYDQVDEFVV
    EEVGAVVAATGFDLVDWTVYSEYGGGQYPDVITSLQYERMLSASGPTEGHIKRPSDGKEPKNVVFIQCVGSRDKSIGRPY
    CSGFCCMYTAKQAILTKDHCPDSQSYVFYMDIRSPGKMFDEFTRRAQEEYEARYIRGRVSMVYPKGDKLVVRGADTLMGD
    QVEIDADLVVLAVGAESAHGASDLAKKLRISYDAYGFFMEGHPKLKPVETNTAGVFLAGSCQGPKDIPSSVAQGSAAAAK
    VLAMFAKDQLESDPAVSVVDIKRCIGCGKCISTCPFGAIKEIDFRGQPKADVIETICQGCGICTSTCPQGAIQLQHFTDN
    QILAEVNAVCRF

    >gi|242278105|ref|YP_002990234.1| HesB/YadR/YfhF-family protein [Desulfovibrio salexigens DSM 2638]
    MVEITEAAQKQLENYFADKDRTPIRIYLATGGCAGPRLALALDEPKDNDESFEVEGFTFLLDKDLNEQGSPFRVDLSYTG
    FVIDSKLELGGGECGSCSGSCG

    >gi|242278110|ref|YP_002990239.1| heavy metal translocating P-type ATPase [Desulfovibrio salexigens DSM 2638]
    MYALNAIPRFPANKDMFMHSTFEIKGMTCSACSARLERVIGNLDGVNSATVNLAAESLAADYNPDQISAADIIASVEMAG
    FEATEEIEGTELTLPISGMT
    CSACSSRLERVLNANDGIISAQVSLASESATLNFNPAVISLRQIRQLIADAGFESGQIQS
    AHNAKDNFEKRKAENEAKLGEMKNRLIAALAFTIPLLTITMGHMVGMPLPSFIEPHSSPLGFALIQLILTAPVLWFGRNF
    YLHGFPNLIRRAPNMDSLIAVGTSAAVIYSLWNTIEIAMDIDAHARAMDLYYESAATIIALILLGKFQETRARSRTSDAI
    EKLMDLTPAQAILLQNGEQIPTPVEEIGPGDLILIRPGDRVAADGKVAEGHSDIDESMLTGESMPVTKSAGDDVAGGTVN
    TGGGALKVQVTNVGENTVLARIIRLVQEAQGSKAPISSLADTVSFYFVPAVMAIGIAAALGWFFFSDEPFTFALRIFISV
    MVIACPCAMGLATPTAIMVGTGRGAQLGVLVKSGEALETAGKIETMIFDKTGTLTYGKPEVAETFTMDGENQQELLLLAG
    SAEKQSEHPLAKAVVRAAEEIGTPLPETTAFQAVSGLGINTETAGQPMLLGNRKFLEQNFVGGLDNIAANEAALRFAASG
    QSPLYIAKNGKLAGILAIADRIKDETPQTISKLHALGVQTVMLTGDNEKVAHAIADKAGIDKVIAQVMPDRKAEVVNNEK
    EAGRKVAMIGDGINDAPALASADLGIAMGTGIDVAIESGDVVLMKGDLSGVLTALSLSRATVRNIKQNLFWAFAFNVLGI
    PVAAGLLHIFGGPTLSPMFAAAAMSLSSVTVVSNALRLKFFKPED

    >gi|242278331|ref|YP_002990460.1| Methyltransferase type 11 [Desulfovibrio salexigens DSM 2638]
    MSFNIAEWTRIIHNETPIYIRPESPDWFVPTPKGDALLCTMLKNKGPELLQDLTIDDKRFLMRLPDNNEAVYPGRYELLK
    TDTLRELWFHITDNCNMSCSHCLFSSSPQAKRELATERVLELTAQAEALGCKMFALTGGEPLVHKGLDKILTRMLEIESS
    HVAVLTNGLAVEKFFSRHSYDFNRLHLQISVDGIGKTHDKLRGDGMFAALEKSLKWLSAKGIPFTLSMCVTKDNVLEMKD
    VVDFAAKTGASNVHFMWYFVRGRGESEQFVEPDVIYTHLLKAWETGERTGVTIDNIEAVKSMIFAPCGTIHDGSTAGWES
    IAIGPDEKIYPSAATVDIEKLSTCINGNLEHAWKQSSILGELRKSSGKNLETPFKLILGGGDTDHSYMHKGSFIGDDPYS
    ALYEKLALELIARKATESKQHDSPQLLLKMGDKLDRCSGHGAVALTHTNCLLAVAGNNSLAVVKDFYTEAADTAKEDILN
    PACYDPALMAHIPDQYRFRGYGCGSPVMDAGISEGEHVVDLGSGRGIECFIAAKQVGPNGKVTGVDMLEPMLAHARKGQA
    AVAESLGYDNMDFRKGYLETLPIEENSADLLLSNCVLNLSTDKRLTFSEMFRVLKPGGRLTISDVVCETEPGPEIRNDDT
    LHGE
    CIAGAQTQKNLCGLLEEAGFESLIMIKRFPYRTVGGHQFFSLTFSARKPLNDEMVKTVYRGPLKTAITASGAILTP
    GSVMEIPEQEANLLGEQLFIINNEGAVDNIFIGGSCCCPTPDSFDKPETETKKDTGHSKFSLKSMEGCMVCGAELEYLTS
    YREMICAFCGETHEANGHCANGHFVCDKCHSEDGMEVLPHLLKSSTETDMIELLKKARSHPAIPMHGPEHHALVPGVITT
    AYRNCGGGIDDKVIDTAISRGAKVAGGFCGFMGVCGAAIGVGAAMSAILEATPLTASERSIAQKGTLAALKLIADIEAAR
    CCQRDCWLALKAAAQVSEEVLGLRLQADAHILCDQMKNNKECMGRNCPVIRNSKGNHPPVMQLLGSIADSEKKV

    >gi|242278365|ref|YP_002990494.1| glutaredoxin [Desulfovibrio salexigens DSM 2638]
    MSKMIIYGKPTCPHTRRALEAYPDAEFVDVLMSAEDLNKMLELSGGKRRIPVIVEDGNVTIGYNRGS

    >gi|242278373|ref|YP_002990502.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio salexigens DSM 2638]
    MSKVQAGCSKPVGNNAEEVQPEVENVTSETTKGAGKMIKAGQKAPDFSAMAYQDGGFKEVKLSDYAGKWVVLCFYPGDFT
    FV
    CATEISAVAEKHAEFAALGVQVLSMSTDSVFVHKIWEYDELSKMITAGKVPFPMLSDGGGKVGEMYGVYDENSGVDIR
    GRFLIDPDGVIVGYEVLTPPVGRNVSETLRQIQAYQHVRATGAAEVCPSGWKPGKTVLSPGPELVGKVWEAWKVSMAFED


    >gi|242278398|ref|YP_002990527.1| electron transport complex, RnfABCDGE type, E subunit [Desulfovibrio salexigens DSM 2638]
    MSRLVKEFAKGLWDELPPFRVLLGLCPVLAVTSSAENGLGMGMAVIFVLTMSNLIISSIRKIIPTKVRIACFIVITASLV
    VTVELLMQAYAYPLYQKLGIFVPLIVVN
    CLILGRAEAFASKNGVILSIADALGMGIGFAVSLTFLGAIREIIGAGTVFGV
    PVMWESFKPAEFMIMAPGAFVGLGVILAGMNAFNRYQSRKKGETVPDVMNSGCAHCGACGGIQDLKDK

    >gi|242278399|ref|YP_002990528.1| electron transport complex, RnfABCDGE type, A subunit [Desulfovibrio salexigens DSM 2638]
    MEYFLLFISAIFINNIVLVQYLGACPFMGTSKSSDVALGMGGAVIFVTLMATAITWPLHQYVLIPHGLEYLQTIVFILVI
    ASLVQFVEMFLKKVIPPLYKSLGLFLPLITTN
    CAVLGVAIMVQRNGYSFIKSMAYGLASGIGFLIALVIISSIRERLDVA
    PVPHVFRGVPIALITAGIMSMIFFAFKGMVA

    >gi|242278429|ref|YP_002990558.1| methylated-DNA/protein-cysteine methyltransferase [Desulfovibrio salexigens DSM 2638]
    MGTFYTRFMTPLCEIILAGSEDGLSHLHMQTGEGRRVFEINPGWIRDDDFFSDIKGQIEEYLSGNRSKFNVKLDPQGTDF
    QKRVWSELCRIPCGETRSYKEIAIALGNENASRAVGTANGKNPVPLIIP
    CHRVIAADGSLAGFAHGTKIKQQLLDIEKGD


    >gi|242278440|ref|YP_002990569.1| methionine-R-sulfoxide reductase [Desulfovibrio salexigens DSM 2638]
    MKTLLPYLCFMVLLFAGQAFAVESRGEIKMQKTTNSYEIATVAGGCFWCVESDLEKVDGVLEVVSGYSGGHVDNPTYEQV
    SSGNSGHLEVVQVRFDPAKVSYEEILRVFMKHHDPTDPGGSFNDRGEQYTSAIFYHNDEQKKIATDVLLDIDGSGVFERP
    LATKLIPFEKFYRAEEYHQDYYKKNSVRYNWYRFLSGRDSFIEEHWKQEEGSTHPVQKIDGYKRPDDAELREILTPLQFK
    VVREDGTEPAFSNEFWDNHRDGIYVDIVSGEPLFSSKDKFDSGTGWPSFTRPIEGQGVVEKKDRSFFMTRIEVRSRKADS
    HLGHVFDDGPQPTGLRY
    CINSASLRFIPLEDLEKEGYGEYLKLFK

    >gi|242278793|ref|YP_002990922.1| cytochrome c biogenesis protein transmembrane region [Desulfovibrio salexigens DSM 2638]
    MRFKLICLILLSFISTFALICPQTVLSAQNQNPNLDTKWKLYSLSKDDQKQVGLKTNILVGLMLEPKNGWYTYSNNPGKL
    GQPTTLKVTLTPDNTVLPAIYLPGKLKDDPFNKGKKVSTYSEPTPILVPVPPALKSFTLKAKLSLLMCSKTACQPFRTDL
    SFFGMSVSPDKLPQASLQPWWPEFVEMRKGAKTIKISLKNIAAKVEGKNAERAAKSQPQKTAPPVASEEGNSAEAAFSFD
    SLTPRSFTPGLEVTDLTTAILFGLLAGFLLNFMPCVLPVISLKLSTLLAGAGHESPEEQKRGFREHNIFFALGIMLYFGV
    LSGILGMTGMAWGQIFQKPPVVIGLTGVVFALSLSLFGLFNLPIVDLKLGSENSGPRRQALFTGILATLLATPCSGPFLG
    GVLGWAMVQQHYVISSVFLSVGAGMALPYILMAIFPALATKFPKPGAWTIWIERAAGFFLAGTCIYLFSILPEDMYIPTM
    IFLWFTAVSAWMWGLSAGADKKSVMYLLRIGALAICIGAGFWAATPQERTAHWVGFEQQDFTARLGREAMLVEFTADW
    CP
    SCKVLEQTVLTPANLNRWQEKYNLTFIKVDLTAPDKVADKFLRALGSRSIPLAAIFKPGEESSSPTVIRDLYTTGQMDEA
    LSQTLK

    >gi|242278834|ref|YP_002990963.1| Thioredoxin domain protein [Desulfovibrio salexigens DSM 2638]
    MSEIKDITELASVEHFGSLDEAIVIFYKELCPHCKNMEKVLVKFGAKAPQVALFSVDSEKHVNLMSEYAFERVPTLLFIR
    EGKVIKTHSGLMNPRELKALYASL

    >gi|242278835|ref|YP_002990964.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MSNAYDLIILGGGVAGMTSAIYASRANLKVLLLDENACGGLVNWTKVVENMPSYKSIGGMELVERVQEQVEELGVTVEEA
    ACIDSMDLSGTIKTIEADDEVYTAKAVIVATGRKPAPLEAAGDCEQVHY
    CAVCDGSAYIDKRVLIVGGGNSGFDEALSLL
    DLGISELTLIEKMDRFFAASSTQAQLAERSNATMHLSTEVVSVNHSDKLESVTFRNVETGEEYTHECDGIFVFMGQHPGT
    ESFAELLDLDADGYIVTDDDMATSVPGVFAAGDVRPKKYRQITTAMSDGTIAALEAERFIHSMK

    >gi|242278954|ref|YP_002991083.1| HesB/YadR/YfhF-family protein [Desulfovibrio salexigens DSM 2638]
    MLKITEKAKEVLDQHFEDKDKEPIRIYIASACSGTRLALGIDSAKEGDETINLEGYDFVVDEELLAQAKPMVIDLSPMGI
    EISSSLVFEEENGCGGGCSGCGCG

    >gi|242278957|ref|YP_002991086.1| OsmC family protein [Desulfovibrio salexigens DSM 2638]
    MNNEIKIEFGPGQKLSAVSDDYCIDVDMPVSEGGEGSAPEPTHLFLASLATCAAHYARKFCEARSLPMEGLGLKVRYQYN
    EEGNQIAKFTYELSIPDGFPEKYKAALLRALDLCPIKKLLMSPPAFQLEIV

    >gi|242279208|ref|YP_002991337.1| electron transport complex, RnfABCDGE type, A subunit [Desulfovibrio salexigens DSM 2638]
    MKEYFLLFISAIFVNNIVLAQYLGNCPFIGTSKKISVAMGMGGAVVFVATMAAAITWAVQEYLLDPLGLAYLQTLTFILV
    IASLVQFVEMFLKKAIPPLYKSLGIFLPLITTN
    CAVMGIAIICQREEFTFIKTVAFSFASGLGFMLALIVLSSIRERIEV
    SRTPKSMKGTPIALVMAGLMSLAFFAFKGMI

    >gi|242279209|ref|YP_002991338.1| electron transport complex, RnfABCDGE type, E subunit [Desulfovibrio salexigens DSM 2638]
    MSRLWKEFSKGLWKDLPPFKVVLGLCPVLAVTKTADNGFGMGMAVIFVLTMSNILVSIFRKIIPPKVRIACFIVIAASLV
    VSVELLMQAFAYPLYQQLGIFVPLIVVN
    CIILGRAEAFASKNPVLLSAADGLGMGIGFTISLTLLGGLRELFGYGTIFDN
    QIMPENFKPFSFMVEAPGAFVCLGLMLAAMNIFTSWQARRKGQAVLDNPGHDCKTCGICSR

    >gi|242279217|ref|YP_002991346.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MTETNYDIIILGAGPAGLQAAIHSARKGLKVLILGKNDKSSLWWAHIENFCCTLEISGEQILRTGQQQAESFGAVFFNED
    VLKIKTPDLMDLSGGGFTVTTETKEFKTKAIIICTGTTRNKLGVPGEKDLFGKGVSY
    CVECDGNFFRGEEVAIVGGESAA
    AGGALHLSHLASKVHLVSKEFNFAPELMDKLKAANIIIHEGAEVEEITGESGVDGLVLKDGSKLDVTGVFIELGAKGVMS
    LAAELGIQLDESMKFIETDKQMRTNVPGIFAAGDICGPPLQMAKAVGEGCVAGLSAAKYVRKA

    >gi|242279289|ref|YP_002991418.1| thioredoxin [Desulfovibrio salexigens DSM 2638]
    MALQVTDSNFQEEVLNSDKPVLVDFWAPWCGPCRAMGPVIDELAEEFSGQIKICKMNVDDNPASPGKYGIRAIPTLILFK
    DGEVVDQTTGAVSKSSIKEMISSKAL

    >gi|242279290|ref|YP_002991419.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MKSYDAVVIGGGPAGMAAALYLARAGVNFLAVEKLSHGGQMLLTDELENFPGFPDGIKGYELADRMDRHVKHYKFDHVYD
    EVLQIIPGEEFHEVVIANGDHIKTQVVIITSGVTFRKLKVPNEEKLLGRGVSY
    CALCDGHFYRDKVVAVIGGGNSALEES
    IYLSRLVKKLYLVHRRDEFRADRVYQDKCLANPVIEPVLNSVVSKIVGDTEVSGVELKNMATGEYSVLDVDGVFIFVGFD
    AVCSFFPKELALDKYGFIKTTCEMESSIPGIYAAGDIRSKKCRQVVTAVGDGATAATAAYAYLEHK

    >gi|242279505|ref|YP_002991634.1| DSBA oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MLKRIALVICLVVMFSGCVNKQMLKEQIAEVIRENPQIVLDAMRENSVDMLTIVEQGIDQREKQKREAMLEAEIKNPFKP
    RVWSERPMLGSPEAPVTIVEYTDFL
    CPYCSKGAKVVSKLVAEQPEKYRLIFKHLPMHKNSRELALVFEAIAQFDKERAYK
    FHDLAFERQKDLYEDKEGIVLSKILEEVAVDPDLLQKHLRSPKLQAFLLADEKEAGAFGIDATPTFLVNGVSVRGYLPAD
    RFEQMVDMIMEKSGKAATSETIEGEVCEDCLNQM

    >gi|242279565|ref|YP_002991694.1| Rhodanese domain protein [Desulfovibrio salexigens DSM 2638]
    MKFGKVAAFLVKVILICVISGGLAVAFNTARSKPYTFAELSHPQPPEIGEIGSADLLQDFTVGKYFFVDARSDMEFAMGH
    IPGALNITTSMEGDEFAAQVAQIDRNLPVIVY
    CDGLSCGKSLIVAKKLVEQGFKDVTVYTEGIDGWIGAGMDLEAN

    >gi|242279668|ref|YP_002991797.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfovibrio salexigens DSM 2638]
    MSNLHEQLEEIQINAKANIPTATFNTMLDETAKLKASGIEGKAVQNGEKAPDFTLPNHLGQDINLGAMLKGGPVVVSFYR
    GGW
    CPYCNIELVALQKKLPEIEALGAKLICITPETPDNTLSTKEKQGLSFEVLYDAGNKIAESYGLVFTLSNDLKEIYSG
    FGINLDVQNGDDTWALPLPATYVIKSDGTVAYHFADADYTKRLEPEEIVTALKNL

    >gi|242279672|ref|YP_002991801.1| Thioredoxin domain protein [Desulfovibrio salexigens DSM 2638]
    MPKRIFVLIGCLLVLGMCLGACSADAEDRETAGIAASDLISGKPHELPITGMVTMVDIGAHACVPCKMMTPVIEELSKEY
    DGRAAIAFIDVWEYREEAAKYNIRSIPTQIFYDADGKEQYRHVGFLDKKSIVAKLKELGVR

    >gi|242279673|ref|YP_002991802.1| redox-active disulfide protein 2 [Desulfovibrio salexigens DSM 2638]
    MKIQVLGPGCPKCAKAEKIVQEAVAESGIQAEVVKISDFQEIAMMGVFSTPAVAIDGEVKVMGKVPSKNEVLKWLK

    >gi|242279738|ref|YP_002991867.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MSSKKIVVIGGSAAGPKAAARSKRLDADAEVVLLQKAPELSMASCGYPYYIGGNFDERNALLATPTGVVRDEGFFAAAKG
    VSARVNTEVTAIDRHNKTVSCTDVLTGESCSVAYDKLVLCTGATPRRTPIPGIDLEGVRSLSEMRDADKLRELVDSGKVK
    DAVIVGGGLIGIEVCEALSESGMNVNVVEMLSQLLMFLDWEIAKLVEKHVASKGVTVHTDNGVAEFLGENGKLTGVKLND
    GSVVPCELAVVAIGVTPNAKLAAEAGLEIGGFGGVAVDDFMRTSDPDIYAAGDCVEITQRITGKKTYAPYGDLANLEARV
    VADNIARGDKHKFPGTVNSGICKVFDLSAGATGFSEQRAKAEGYDVITATNASPDKPGFMGAKLLVSKMVADAATGRILG
    FQCVGPGEVNRQLAEAAMAVMNGNTIWEVGMADLPYAPPFSLAIDHFITTAHILDNKMAGQMTGISNAEVKERLDAGEKP
    FILDVRAPNEFEEMRLNVGENLIPLGKLRNALDQLPQNKDAEIITF
    CKISMRGYEAQRVLEANGWTNVKVMEGGIMGWPF
    KVEM

    >gi|242279924|ref|YP_002992053.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfovibrio salexigens DSM 2638]
    MARYDYDLGIIGGGAAGLTIAAGAAQLGVKVLLIDKEDKLGGDCLHYGCVPSKTLIRSARVRHLMGRAGDFGLPEVELSP
    VDFAQVAKRINEVIDIIQVHDSVERFNALGVEVRFGKARFVDSHLVSLNGSNVSARSWVLATGSSPSVPPIKGIDEVPYL
    TNVDIFTLQELPESLVVLGGGPIAVEMAQSFQRLGSRVTVIQRSNQILSREDDDMASYVMEGMVEDGVRFILGSTVHEIR
    NSGEGVEVLLESGGEEMTVTGSQLLVAMGRMSNTSGMGLEGLGVKLEHGSVVVDARMRTSVPNIYAAGDVTGKHLFTHAA
    GYEGGVVVSNAVFKIPRKADYTWLPWCTYTDPELASVGMNEKAAQKAGIKYKIVIEEFSSSDRALAEGEGRGRIKLLLNE
    KEKPIGCQIAAVHAGELLSEWVAAVNGKVGLATLAGAIHPYPTLAEMNKKVAGKLLGEKIFSDRVRSILKFLFSYRG

    >gi|242280050|ref|YP_002992179.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfovibrio salexigens DSM 2638]
    MSEHVVVIGAVALGPKAACRYKRIRQDARVTLIDRDEIFSYGGCGIPYFVSGDVSEANQLRTTAFHMVRDEPFFNDIKGV
    EVLSSTEATKIDRENKQVHITNLKTGEKSVLDYDQLVIGTGATPRKLGLPGEELENVFYVGNMHDAEKIKEGITKGQYGK
    AVVVGAGFIGLEMAEAFSDMWGIETTVVEIFDQILPRMCSPVLAKMGQKHMEEEGVSFKLGQTVSRIEGDGKVERVITSD
    GEVEADIVIISAGVIPNDKLARECGLECSERGGIMVDETMRTTDPLIFSGGDCAIIKNAVDGSPLFLPMGSMANRQGRVI
    GGNLAGRKETFPAAAGSWCVKIFERAMSGTGMSLGAAKQAGFDAISVMLIMADRAHFYPEKDMMTLEMVVDKATRRVLGI
    QGISAGGDALVGRINAVAAIMKYQPTIEDVSNLEVAYSPPFASAMDVLNAIANMADNAINGMNHGHGPDIFAEYWDNRES
    GEYCFLDVREKADAEPFLEKYPEHWHNIPQGEIPKRYEELPKDKKLVLV
    CNTGGRSYEAQIMLDALGFEEVHNTQGGMAV
    IKAYGVDI

    >gi|242280126|ref|YP_002992255.1| OsmC family protein [Desulfovibrio salexigens DSM 2638]
    MNTVVDLTFKDGMQISAKIREHEVLTDVPADHGGADEAQTPFELFFSSLACCAGVYAKRFFESKNLSTDGFGIRLVCESD
    PEQNGMRVAKVNYEVTLPKDFPEKYEKPLMRTIDQCTVKKQVLNPPEFEISFLR

    >gi|242280143|ref|YP_002992272.1| beta-lactamase domain protein [Desulfovibrio salexigens DSM 2638]
    MYFKQLTTEGLGCYSYVIGCPAAGEMVIVDPRRDVQEYLDISREEGMKITRVINTHVHADHVGGEQELKSIVGAELFIHE
    NADVGYEHTSIKEGDSFIVGAAKLDFLYTPGHTPNAISILVTDTMRGNEPWMILTGDLLFVGDIGRPDLPGDEILDEQVA
    NLYDSLYIKLGKLPDYLEVYPAHGQGSLCGKGMSAKPSSTLGYERRYNPMLQFKTFEDFKTKVLESFPSRPKSFTHIINT
    NFDGAPLLERCPLDRAMNPEKFKQMIEQGCTVIDVRDAAGFGGFHIPGSINIGLEKQLANWVGMAVEPDSDLLLVVNSKE
    DYDRMCKELHRIGYDRIFGYLHGGIAAWLMAGYPVENLAQKSTQQLHDAMAENKNFTLLDVRTPAEWSNGHIKGAIHKPF
    ARVLEEGIDVDKDSPVIVM
    CGSGYRSNIVGSYLQGNGFTQVCSLAGGAIAWSRSGYELE

    >gi|242280214|ref|YP_002992343.1| Rhodanese domain protein [Desulfovibrio salexigens DSM 2638]
    MKLVWNKQELPNKGWWKLTRKYVVSKFRKQTYGVIDSSELEDLLNSEKQLTIVDCRLEDTYCKFGHIPGAVSYPITLFEN
    DCPEIERDRQLVVV
    CYFGFVCQLAARKLGAQGHKDVLILKGGMDAWNIKNRPLELL

    >gi|242280459|ref|YP_002992588.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MTSNSFPTETRSYDLVVVGAGPGGFDAALEAAEEGIKVALVEKELLGGTCLNVGCIPTKMYLGATSPVEELAAQSKARVA
    KGEIEIDFKALCTKKDRFIAATRKAMAQKAKKLGIDIYPAVAKVIEPGKVEVSHPEEQAVLEYKNLVLATGSHPTVFPGL
    EPDNETILDNTGFLALEEMPTSLLVIGAGFIGLEMAQIAHRTGCKITVVDALDRIAVYEDPEVSKALQGVFKRHKWQFNL
    GVKVKSVTAENGQAVLRTEDGQEFTAEKALIAIGRRPNSADIGLETLGVETAGPGFVKVNENLEAADNVYAIGDLNGKIL
    LAHAASHQAGYVVRRLAGKTDGPYEHGPVPSILYGSPETMRVGLMPADLEGQGEVKVSSFPLVANPIAQAYASTQGFVKV
    VWLDGKVAGITAVGHHVSGFTTAAAMIVQEAWTKDDIHKVVFPHPSLDEALLGALKAEQLDPK

    >gi|242280489|ref|YP_002992618.1| dihydrolipoamide dehydrogenase [Desulfovibrio salexigens DSM 2638]
    MPSITIIGSGPGGHIAAFEAARRGAEVTLVEKADIGGTCLNTGCIPTKTIKSSAEALETAGNLSAFGISAESGAEGVNFK
    ADMEAVVARKERVRKVLCGGLEKTCSSLNIRVVRGSAELSADRTVLVHTEEGSEEIKSDKVIIATGSSILDLPSLPVDHK
    HIINSDDALNLDHVPAKMVIVGGGVIG
    CELAFIYRAFGSEVTIVEGMDRLLPVPSVDKDMSKLIQREAKKHRIKVQLAKT
    VKSAEVVDGKVQCVLGPSPFVEGAKGDDTTIEADVVLVAVGRTPNTEGLKLADAGVETDQRGWIKADHNMRTSVEGIYAI
    GDILGPSRIMLAHVASHEGLCAVDNCLGKERALDYSVIPSGIFTSPEIGTVGLSEEEAIAKGIDVRSQVFQFRELGKAQA
    MGELAGMFKIICEKESGKILGAHIAGAHATDLIAEAALAIKKGLTAADVAHTIHAHPTLAEGLYECCEAWLRGC

    >gi|242280591|ref|YP_002992720.1| protein of unknown function UPF0061 [Desulfovibrio salexigens DSM 2638]
    MDAEIISVMPFDNSYARLDKKFYQRINPTPVKHPRIILVNRELAGEMEFPLPETDAELAELFSGNKPPQGSEPLAQVYAG
    HQFGNFVPQLGDGRAVLLGEFVSSSGKRYDIQLKGAGQTMYSRNGDGRSPLGPVIREYIVSEAMFRLGIPTTRALAMVCS
    GEEVFREQALPGAVFTRVASSHIRIGTFEYFASRNDYEGVKTLADYAIDRHYPHLKEAGNPYAAFLGKVCSVQARLIAKW
    MRIGFIHGVMNTDNTTISGETIDYGPCAFMDGYDPATVFSSIDHYGRYAYARQPSIAQWNLAGLAGCLLPLIHKDTGQAK
    SRAEEIVQGFGPEFRTHYFAEMCSKIGLKPEEPVQELLNDLLQIMHESKADFTLSFRMLGKAVLGNETPLLKLFNERDKI
    REWLEKWDEERERQNIKKEDAVRTMDRNNPAFIPRNHRVEQAISAAVENDDFEPTKKLIKILHHPYDDQPEYDEYMQPPE
    PTERVYQTF
    CGT

    >gi|242280863|ref|YP_002992992.1| Rhodanese domain protein [Desulfovibrio salexigens DSM 2638]
    MKMVRNISVIAALCALMFAMTGCLGADKFAQEVEKEKGAVKLLKEVQRGGYDIITTPELKALQDKKEDMIIIDTMPYEAS
    YKKEHVPGAKQFLFPIPDMLEWDVKETDGKTKEQFIEMLGPDKDKLIVIYCGFVK
    CTRSHNGAAWAKKLGYTNVKRYPGG
    IFAWKGAKYPVGSVK

    >gi|242281002|ref|YP_002993131.1| hypothetical protein Desal_3546 [Desulfovibrio salexigens DSM 2638]
    MSKTLTIMLMSGSAENEDAQFATNLAEAALEKGHKVQMYLFGNAVNISKKEEPIEGDLHIAARLVDHIEPTKNFERVASL
    IEKGADIST
    CHTNEHARGIESKEYVEGVKWGDVGGSFTKYLMTSDVLLSVGH

    >gi|242281116|ref|YP_002993245.1| Redoxin domain protein [Desulfovibrio salexigens DSM 2638]
    MKIFNKLSILIALLLVLVAGCNKAETAEGVDTVNAQGIQDIIAKNKGKVVLVNFWATWCPPCRAEIPELIELRKKFSDDD
    LVIIGVSVDQDSAAVDEFMLKSAKFNYPVYFAAEDVGAAFRIQSIPRTMLYDPAGQRVFDKEGSYPGTMFERYINKMLKD
    R

    >gi|242281194|ref|YP_002993323.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio salexigens DSM 2638]
    MSTLSAEEKYRNFIPEESREYLEKLFAEFKRTVTIEVYTAEGEHREYNDFTLNICRAFNVISDKIELREYAVDSEMGKNR
    NIIATPTVLISPDEYDIRFLGAPAGEEGRALVEALNLASKGADGISESTKEILEPLEEDRLVKIFASPT
    CPYCPGQAINA
    FKAAVARPDKISAWNISTLDNENMAHEYKVGSVPHTDINDTVTFTGLEPEEKFMLQLLFLKPLEEVVEEQRAAKAETTED
    TVYEDVDLAIIGGGPAGMSAGIYAKRSGLSCIILEKQGVGGQVALTPKVENYPGFTNIQGFELVEILGSHAREYTDIQQF
    AEVKDVKYGPRIEITTDEKNYRAKGVLLATGVNVRMLGVPGEDKFYGHGVSY
    CATCDGNFYKGGKAVIVGGGNTALTDAL
    HLKHLGIETTIVHRGDKFRAEKVLQDSVNREGINIIWNSQVTEIIGEDQVESARIVNKDGTETILDTDVVFVAIGHTANT
    ELAEKLGCELRPDGFIKVDPTQRTSVERVYAAGDVTGGVRQIITATGQGAAAALTAFDDFTRLFDDIKDNTKNIW

    >gi|242281245|ref|YP_002993374.1| alkylhydroperoxidase like protein, AhpD family [Desulfovibrio salexigens DSM 2638]
    MAEKQIEIHKQIGENWGTYMKLMPEVGDLYDQFHGEVYKDGTVKAKEKRLMAIVGALVSGCRACMLYQTKEALNLGATVD
    EILETCAVAISLGGTMAAGEATHIMGFLKELGKID

    >gi|242278069|ref|YP_002990198.1| HI0933 family protein [Desulfovibrio salexigens DSM 2638]
    MSNTSSKYDVIILGAGASGLYCAMHAAARGRKVLVLDHSGKAGRKIRVAGGGKCNFTNMDVAADNYISANPHFVKSALAR
    HNQWDFISFVAETGIEYEEREDGQLFTLEGAGLIAGLLVSKCHRAGVETLLDRQIEEVSGEGPFMVRSGSQVFEAESLVV
    ALGSPAWPQVGASAFGYKLAEQYGLKTIPARPSLVPFTISGRDGKFCKELSGNALPVEITCEKSTFAGDMLFTHKGISGP
    AVLQISNYWRRGSALTINLLPTHNISELFESHKGENVALHNFLARYFTRKMVGLLLEGQDGETPVSQLTKKRQLALAERI
    HSWVVKPQGTEGFAKAEVAAGGVDTSEISSKTMESKKVPGLYFVGEVLDVTGWLGGYNLQWAWSSGYAAGQFV