Desulfovibrio desulfuricans G20 uid57941

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78355106|ref|YP_386555.1| ADP-ribosylglycohydrolase family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSKIRSAILASFVADSLALGAHWEYDRERITRELGRVDRLLAPRLNTHHAGKEAGDLSHYGDQTLLLLEAVAETGDFSLA
    RFAARWQQMMVHYNGYMDRASRDALTRFTEGLPPDKTGAVTSDFSGASRVAPLLAVLGDHEDRLAAAARAQCLMTHGSVL
    VADGAEFMARAAHALLQGQNVPQALATAAGADYAQLPAQDWLAFADMHAALEGCEAVSRFGQA
    CGMKGAFMSVVHLAVRY
    ENAPAEALVENVMGGGDSCARGLALGMLLGARHGQDWIPVHWLSGLRSRNAVEECFTRLWR

    >gi|78355210|ref|YP_386659.1| DSBA-like thioredoxin domain-containing protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKRLLKNQGAFLGAMLMAAVVVLSAAPQARAAAEQDRLKDMVREVLRDNPGLVMDVLRQNPEQVLDIVRDGNRIARDRAM
    RAQWQADMTQPKQVKLDGRPVRGPQDAPVTIVAYSDFT
    CPYCAQAAGTVAALMEHYKGKVRLVFKHYPLKSHDNAETASR
    MFVAAAMQDEAKAWALYDAMFVERARVIKEGSAFISAKAAELGLDAARLARDAQSDAATRILREDRQEAENLGLEGTPTF
    LVNDIVVRGSLPLPQFADAVDMAWAKAAGR

    >gi|78355257|ref|YP_386706.1| AhpF family protein/thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSENDSAQNSEERRWLIPEEGRKHLAGVFAGLPGEVTLDVFTDGDEKNQYNEYTVRFAQELAELADKIDTRVHALDSAEA
    QRLGVTLGPSTLLNAGTYAIRFTGAPLGEEARGFIEAIMLVSAGKAAVSENVGRILERLEEKRTVRVFSSPG
    CPYCPGQV
    VNAVKCAIASPQLVSAEAVNSDEFPELSRKYGVGSVPHTNINDEFDAVGLMPEERFAVELVTMKDASGMVREAGQDAGTG
    DYPVEKVDLVIVGAGPAGLTAGIYAERSGLKSVVLDKAVVGGQVAVTPVVENYPGFKNVGGMNLVEMLAAHTREYAHVQE
    HEEIEEIKIGRNIEVYTARNVYLARALVFATGAQWRELGVPGEDTYFGKGVSH
    CASCDGFMFKGKKVIIVGGGNTALTDA
    LHLKNLGVDITVVHRRDAFRAEQQLQDALEREQIPVLWDTVVEEILGTDGLVTGARLKNVKSGDVHEVALDGVFVAVGHV
    PNSALAAELGVTLNEDGTIAVDRAMRTNIPRVYAAGDVTGGIRQIVTAVGNGATAALSAFEDLQSSRWKK

    >gi|78355352|ref|YP_386801.1| AhpC/TSA family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MNIYMRQFSFAGILAVAVVCAFAIAAAPLRAAAHGPHQPDVYDMGTLQPVATVPLLHKGDAAPDFELPATDGTKVRLSSF
    RGSKNVVISFVPAAFTPV
    CSDQWPGYNIARELFHRHDAVLLGISADNTPSQHAWIQQMGGLWFPVLSDFWPHGATAAAYG
    VLRPEGVSERAIFVVDKQGRIAAAIISDINKRPDLGLIIDALKDLP

    >gi|78355353|ref|YP_386802.1| hypothetical protein Dde_0306 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MFNTAKTFMLRHESGCSNARQVNMHRSLFYGRTLCAALLTALLLTAAAQAHPLKSGDSFPDIPLTGTLTPQQQQELGLKS
    GQAPVLSGIGTPFVLMEIFSMY
    CPFCQAEAENMNRLHTAIRQEGLDGTIAVIGLGAGNSQFEVDFFRTKYSVPFALFTDP
    ELELHKQTGETATPHFYLISLKDRKPRVIYSHTGRMQSVDDMLQTLRSLTGRE

    >gi|78355421|ref|YP_386870.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MPQNIVVIGAVALGPKAACRFKRLCPEDNVIMIDQSDRISYGGCGIPYYVSGEVNTLEELQMTPYHTIRDAEFFRVNKDV
    KVLARTKVESIDRQAKKVLIRDLTTGETAELPYDKLVLAMGSAPNRPPFEGIDLEGVHT
    CTTLDDAQAIREAVAAGSVSG
    AVVVGGGFIGLEVAVSLADMWGIKTSVVEIADQILPGFLSGNMVKIATHDLRKNDVDVFCGEKVIRIEGENGKVARVVTD
    KRTIDAELVVMAAGIRPNTEIARAAGIELNERGAIIVNDRMQTSDPDIYAGGDCVTVPNLVTGKPGFFPLGSMANRQGRV
    IGTNLAGGDARFPGGVGTWAVKLFEQNAAGAGLTIESALREGFDAVNVHVEGFDRAHFYPEHTVMALDLVVERPTRRVLG
    IQGTSSLGDALVARINAVAPLLQNKPKLEDISNLEVAYSPPFASAMDIINTVANVAENVLEGRNHTLDPDEFAVMWQNRE
    SGSCTFVDTRLASNAESLVEKYPGQWLSIPLEEMEQRLDEIPEDKTVVLI
    CNTGLRSFESQLIMNRHGRKSLSVQGGMAS
    VTKQGNEI

    >gi|78355511|ref|YP_386960.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSLQTVAPGDLDARIEQTAQGIVLFHKELCPHCKNMEKVLAKFGAKNPDVELLAVDSEADPAVMEAYGVERVPSLVIVRG
    GRAVYTRTGLMNPKELTTLYHSV

    >gi|78355512|ref|YP_386961.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    METRQVDVLILGGGVAGMTAAVYAARAGLRVTLLEENACGGLVNWTRVVENMPSYISIPGMELADRMAEQVAALGVDVEE
    AACIEEISLAAGDKTVVADDVRYEARAVIAATGRRPVLLDCAGDCCQVHY
    CAICDGSAYKGRHVLVVGGGNSGFDEALAL
    LDTGVARVTLIEAQDRFFAAAAAQRALAAREGAVMYTSTRVTQLHGTDALESVTLTRADGSEQQLPCDGIFVFMGQEPST
    QLFRGQLELDAQGYIVTDGLMATSVPGVFAAGDVRPKRYRQITTALSDGTVAALEAERYIRRTAG

    >gi|78355631|ref|YP_387080.1| electron transport complex RsxE subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MASMWKEFSKGLWREIPPFRLVLGLCPVLAVTKSANNGFGMGMAVIFVLFLSNVIISLVRNLIPKKVRIACYIAIAASLV
    VAIELLMQAYAYPLYQQLGIFVPLIVVN
    CIILGRAEAFAGKNPVHLAAADGLGIGMGFCLSLTFLGSLREMLGTGTVFGH
    QVMWQGFKPLTFMVEAPGAFISLGLVLGAMNLLSIVQAKRKGIPEPENPTPGCESCRGCAAGHR

    >gi|78355632|ref|YP_387081.1| electron transport complex, RnfABCDGE type subunit A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MDYFLLLISAIFVNNIVLAQYLGQCPYLGCSKEKGVSLGMGGAVIFVMMLATPITWLLQKFVLTPLHLDYLQTIMFILVI
    ASLVQLVEMFLKKMVPPLYSSLGIFLPLITTN
    CAVLGVAILVQRKEFDLGTSVFYAFAAGLGFMLALVLLAGLRERLEIT
    RVPRALAGVPVGLVMAGLMSMAFMAFQGMIS

    >gi|78355725|ref|YP_387174.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSVIRSFPFCRTSMRRSPHNVLAPAYVLLALCCLHMSAAAQPPLPPQQPALSAHAPGAAPENNTTRTEPHWHKTMRLQAA
    EHGYRLLDLDAVDSLPETTLLLDVRPDYEFAAGHVPGAVNMEFDPGDTDSLSAEKTLQLQQTLGPDKERMVVIY
    CRSFRC
    LRSGAAAKAAARLGYTNVWRVVEGYFGWLEQHRPDHSGRADGCSDRRTTQARTLPDHGLAILGGDADRRILGLPAGAHTV
    RLEEIPCDVLVVLFFNTH
    CTQCREQMQQLEHLARTVNSRAATQSHRAVAFAGIGVRESKRTLARLRRKQVHAVPLFADPD
    ASLFAASGFAGIPGAWVIGPAGGKATDSPQTGGRAVLLSVAGDIAQNPEFRSLIFRMTNVPAWGISGPHTQEAAAAAEKP
    R

    >gi|78355726|ref|YP_387175.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKTMRKPLLTTLMLMLGLMLLSGCAAQQPREPWMINDIVDVEYVAQYVKVPHPENVMIIDSRPYEAKFVKGYIPTAVSIP
    DTQFEKHADRLPADKNALLIFYCGGWQ
    CKLSHKSARKAMDMGYTNVKVFAAGYPAWLESGRVPALGLEALHDMLASGADY
    MLIDSRPVQKYLEGTIPSAISVPDSRFDAKKGLLPADKNTPLIFFCGGLK
    CPLSHKSAAKAQALGYTSVWIAEEGEPGWK
    ALYGGGQAVAVQSGGEEGSIDAEQFKTIMAESPGSIMVVDVRDPDEFNAGHMKGAVNIPVDRLEKEIAALPADKPVVFV
    C
    ATGARSGEAYYMTRDLRPEIKDVFYLEAETTYHKDGSFDITVP

    >gi|78355751|ref|YP_387200.1| methionine sulfoxide reductase B [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKPNYILLLDFAAVFSYLSFVTGSAAQSGAHTPQNTPAVSGKTWHGSTLPDKEELKAKLSPLQFAVTQHDETEPPFKNEY
    WDNKQPGIYVDIVSGEPLFSSTHKYDSGTGWPSFYQPLAAGHIVEKEDRGLFFTRTEVRGRLADSHLGHVFSDGPPPTGL
    RY
    CINSAALRFIPADALDKECYGELLYLFDQ

    >gi|78355760|ref|YP_387209.1| hypothetical protein Dde_0713 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MVYVRAKFFTGAPCAGAGGDSMKMFAQAGMAAGGIRGVFFLHFARTGAVRCCVLAAVLCCMLAGAAGVRAAEPFPDITLP
    PHPQAAQLGLPGHSFRLSDTTADVLLVNVYSWF
    CGPCQAEAPRLAALDREIRRQGLKDRVLLIGIAAGDGPDMVERFREK
    HAIPFALFADPDMTLYAGLGGLPVPAMHVVRRTPQGLVRTELHLGMFAEEPAAFLRRVAALP

    >gi|78355853|ref|YP_387302.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKRIVSLLVMLTAVLALSACNMPFMSSENELDLETKTVKLVKEVQRGDYDVVTTAELKKWIDEGRSMLIVDTMPYEASYK
    KNHIPGAAQFLFPIPDMNEWDMKETGDKSQAEFEAMLGPDKDRVLVFYCGFVK
    CTRSHNGAAWARKLGYTNVYRHPGGIR
    AWIEAGYPVDSIK

    >gi|78356045|ref|YP_387494.1| methylated-DNA--protein-cysteine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MYDVEILVSGPLAMLLEWSGPDGAPDGPACAEPCIARVGLRWSAGLDGSGLLTGVKLPRPGAEAGDLLPRTLVAFSGSVP
    DGMHNGAAELSATGSRMLEALDSYVQQGRTQWPQVALPMDGLTPFARKVLETLRHEVPAGSTVTYGQLAAMAGRPAAARG
    VGQIMARNRWPLVIP
    CHRVLGSKGAMVGYTGAGVDMKRYLLQLEGASL

    >gi|78356049|ref|YP_387498.1| methionine sulfoxide reductase A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    METVTERAVLAGGCFWGMQELIRKLPGVLATRTGYTGGNVPNATYRNHHGHAEAVEIIFDPAVLSYRSLLEYFFRIHDPT
    TADRQGNDIGSSYRSAVFHTTQQQRETALATIRDINASGVWPAEVVTQVEPVSDFWEAEPEHQDYLQRVPGGYTCHYERR
    GWVLPPR

    >gi|78356050|ref|YP_387499.1| methionine sulfoxide reductase B [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MPCLPVPFFPPRILDLPTRVLIAIEYTHHPLAPQENPMPQKYRKTPEALAALTDEQRRVTQENGTERPFSNAFHDHTAAG
    LYVDIVSGEPLFSSLDKFDSGCGWPSFSRPVELNIVEKKDTSHGLVRTEVRSKHADSHLGHVFTDGPEHLTGLRY
    CINSA
    ALRFIPADKLEEEGYGEYAHLFTTRE

    >gi|78356074|ref|YP_387523.1| bacterioferritin comigratory protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSVTPAGMPAEGSPAPDFALADKDGTTHTLQSFNGRWLVLYFYPRANTPGCTREGKDFTDLLPRFEALGCTVAGVSPDSL
    KSLCNFAQKQELAVTLLSDKEKDAASAYGVYRMKKSYGKESPGIVRSTFLIDPAGILRRVWSPVTVDGHAAAVLDALELL
    ADS

    >gi|78356158|ref|YP_387607.1| heterodisulfide reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSNSILVVGGGFSGLTAALEAAEVGYEVFIVEKTPFLGGRVMQLSKYFPKLCPPSCGLEIQYQRIRNNPKIKFFTQATVQ
    AVKGEAGNYTVKVAIKPRHTAPYSADLGLLASSLEGESTSEFDFGLAKRKPLYLSVPFAFPNRYVLDKEALTKADELKVG
    RSVAVDMNEAAREIELEVGSIVLATGWKPYDVTRLTNLGAGQIANCVSNMQLERLAASGGPTGGAIRRPSDGKAPKKVAF
    VQCAGSRDQNHLNYCSYICCMASLKQATYVREQYPDAEVTVYYIDLRTPGRYDKFMRKVRADEKISLVKGKVAGVEEDAA
    SGDVIVEVEDAVKGEKKKVRYDMVVLATGMRPTLADEKLPVDVPVDEDGFIVGGEDKGIFAAGCAKMPLDVMRSAQSGTS
    AALQAIQTVKGR

    >gi|78356249|ref|YP_387698.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MFTQLTDADFEQVLAATASGVVIFFKKQCPHCKNMEKVLEKFAAKNPDVALFSMDSEENPATVERLEAERAPTIIVIKNG
    AVAARKAGLMNPKEMKAFFAAA

    >gi|78356250|ref|YP_387699.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKESRQVDIVILGGGPAGMTAAIYAARASLNVALLEESVTGGLVNSTYTVENFPSYPAIHGMELMQKMRDHVDSLGVTVE
    EVCEIESVSLAGQVKTVETDEAVFQARAVILATGRKPVPLDVPTGCEQVHH
    CAICDGAAYKGRRVLVVGGGNSAFDESLY
    MLGIGVEHITLVEKMDRFFAAQSTQDTLLETGRVDARTQTVVHDLIVENDSLKAAVLEHTGSGVRETVPVDGVFVFLGQS
    PNNDLFRDVVTLSAGGYVVVDEHMATSVSGVFSAGDINEKHYRQITTAMADGTVAALAAERYIRS

    >gi|78356256|ref|YP_387705.1| heterodisulfide reductase subunit A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MRIGVFVCHCGSNIAATVDCPSVAETARMFPDVVYSTDTMYACSEPGQEGIVQSIAEHNLDGVVVASCSPRMHEPTFRRA
    LERAGLNRYMLEMANIREHVSWIGKDIRRNTVKASDLIRMAVEKLRHNAPLTPKHFEVTRRALVIGGGVAGIQAALDCAD
    AGIEVIMVEREPSIGGKMAKLDKTFPTVDCSS
    CILGPKMVDVAQHPNITLYAAAEVDEISGYVGNFEVKIRRRQTYVDWS
    KCTGCGLCMEKCPSKKSFDRFNEGVATTTAINIPFPQAIPKKASIDPDYCRKLQGKKCGVCEKFCPMGCIDFEQQETVVT
    EKVGAIVAATGYDLFDYTVYGQYGAGKYPDVITSLQYERLMNASGPTGGHIKRPSDGREPKEVVFIQCVGSRDPAVGRPY
    CSGFCCMYTAKQAVLTKDHIPDSNSYVFYMDIRAPGKGYDEFTRRAQEQYDVQYVRGRVSMIFPRGDKLVVRGADTLAGT
    QVEVEADLVVLAVGVEAAHGAPQLAEKLRISYDQYGFFMESHPKLKPVETNTAGVYLAGACQGAKDIPTSVGQGSAAASK
    VLTLFSREMLESDPQVAKVDTARCVGCMKCAMTCPFGAVRETQDRAGNVKADVLETVCQGCGICTATCPHGAIQLQHFTD
    NQILAEVNALCPPLMDESFE

    >gi|78356348|ref|YP_387797.1| Thiol:disulfide interchange protein-like [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MCLSMKTLRISFFSCLFTLLCLLPAFLAARAVELPPAASSAAGTPDTPDPLVTASQAFSVSINGPARRVAVITLTPAAGY
    HFYAREAGEAGKPVAIIALAGDEERPVLYPQGTPKPDAFDPSLTVNVHDGPARFYVPLPDDPAVQTLSWSVSALMCSAAN
    CWPVSREGTTELAGQLQRAEAQPWWGEYARLEQTSRPPSAVRRIDAGMAAVKQHPADGNEVRLSWNFTPRFFMESLEVRS
    MGKALLFGLIAGLILNFMPCVLPVVSLKLSTLLTASGIQDQNKRIHHFRMHNIWFSAGIMCFFLLLAAVLGLAGLAWGSA
    FQSQTLVAVLVVLVFTLGLSMFGVFNLPVLDLKAVPAEAQSSPRGQAFFTGMMATLLATPCSGPFLGGVLGWAFMQSPLV
    LGAVFASVGLGMSSPYLTMAVFPALVKHFPRPGSWIGILERLVGFFLMGTTVYLLRILPETLWPSMLVLLWITGLAAWVW
    GRFSGLEKSFRQRLCVRVLCAATVMAAAWWLNQPPAPHPGWERFEAARFEQMLGKQPVIVDFTADW
    CPNCKVLEHTTLHA
    ENLRRWMKQYNARIVQVDLTEPSVQGESLLKSLGSSSIPVVALFPAGQHSDKPLVLRDIFTTEQMEEALQQAFGLPATE

    >gi|78356358|ref|YP_387807.1| peroxiredoxin-like [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MALQKRLDAVSRRLESQLPREIIAVMDTVATQLRLADVQGKAARQGAYAPMFSMRDMLGNVINPVDRLLQGPVLISFFRG
    KW
    CRYCIEELLELNVLAAQVRQAGGSIIAVTPQLPRFNRAMAYECSLGFDVLTDTGCRMASAMGLAYQVPPAVKNLFVHF
    GIDLARYNGASGWHLPVTSRYVVGTDGRIACAHIDLDYSRRTPPEETLGVLRSLGAA

    >gi|78356360|ref|YP_387809.1| heavy metal translocating P-type ATPase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKDDSQLSAADGGETGAAGVTHDGAQPPRTARMPVKGMTCAVCAGRIEKVVGAMQGVQSVNVNLASEIMDVSWNPEVVRL
    DDITAGVKKLGFEAMPPRDEAPEETVLRFSVGGMT
    CAACSGRIEKVVGGMEGVASVTVSLPAETATVVPMAGTAHRALVD
    AVEARIRALGFTAQYMAPEAADDAHALWEKQKAESDARLAEMRRRLVPAFLFALPLFVISMGEMAGLPMPALLSPHRSPV
    SFALVQLMLVLPVMWSGRNFYRVGFRNLINGGPNMDSLIAVGTGAAFAYSLWNTVEIVLGVDVMQRAMDLYYESAAVIIA
    LISLGKYFEVRSRARTSEAIRGLMELTPDTALLVEPEGHREVPVAEVHRGDRLLVRPGDRIPVDGILVSGTSSVDESMLT
    GESMPVTKREGDSVAGGTINGTGSFTMRAERVGADTVLARIIRLVQDAQGSKAPIASLADRVSLYFVPIVMAVALLSGLS
    WFAFSGEGFAFSLRIFIAVLVIACPCAMGLATPTSIMVGTGRGAQLGVLIKSGTALEAAGRVQAVVFDKTGTLTEGHPVL
    EDVEPVGSAAQPDVLVRLAASLESASEHPLGAAIVEGARRRQLSLWPVDGVSAVPGRGVTGTVASPEGERRIHIGNTAFL
    REAGMQADWDAVGRLMQGHAEKGRTPLLMGVDGQVAGVLTVADPLKENAPAVVAGLKDMGIHVVMLTGDNATTARAVAER
    AGIDDVVAEVMPDEKDAKVAALQERGYRVAMVGDGINDAPALARADVGIAMGTGIDVAVEAGDVVLMKGDLHGVLTALAL
    SRATVRNIKQNLFWAFGYNVLGIPVAMGLLHALFGGPTLSPMIAGAAMAMSSVSVVSNALRLRFFRPS

    >gi|78356402|ref|YP_387851.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MNAWRCIMQEEPAEGGRFPHRQTAAAEMGGYRLVDAQSAHGMLLGGEALFVDVRDALLYRQGHLPSAVCFPLPMTWRARL
    QHRWKLRKLLCTAECRPVVFYTEGPS
    CRRSDVAARAAVITGFPAVYRFAGGVQAWVAAGLPLEAGTCPPPLRSFEEHGHD
    Y

    >gi|78356508|ref|YP_387957.1| mercuric reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MMAKYDYDIIVIGGGAAGLTVTAGAAQLGVKVLLVESGHALGGDCLHYGCVPSKTLLRTAGVRHLMRHAARYGLPDAQLP
    PVDFAQVAQRISEVQAVIQQHDSVERFTALGAEVLFGAASFADDHTVEIRSDDSVVRATGAKIVIATGSGASVPPLEGLK
    ESGYLTNREIFSLPVLPASLIVLGGGPVALEMAQAFRRLGTEVTVVQRSGQLLSNEDADMADIVRLRLESEGVRVLTRTE
    IQSIRRGADGVQVRLVHEGSEKLLSAAELLVALGRAPHVSGLTLENAGVVYSARGVGVDARMRTNVPHIYAAGDVTGRYL
    FTHAAGYEGGIIIANAVFRLPKKADYTNMPWCTFTDPELASVGLNERRAQAAGVDYTVRTELFSGNDRALAEGAPEGRIK
    MLLDPREKVLGVQICGAGAGEIINQWVAVQAGKVSLSRIAGAVYPYPTLGEISKRVAGNVMADKLFSGKVQSALCFLFRH
    QGKACS

    >gi|78356733|ref|YP_388182.1| dihydrolipoamide dehydrogenase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MTHEQYDLVIIGAGPGGSRAALDAAAAGMRTALVEKADAGGTCLNWGCIPTKFLLGGTAAVPLLQIQKKYKAAGGDVHLS
    LAALHQRKDRFIKGTRQNLVKQLTQAGVNFITGAASFAGPRTVVVEKEDGSSLLEFENLILAAGSEPASFPGLIPDGNCV
    LHSSHILQLETPPQSLIIVGGGAIGLEMGDLFARFGTQITIVEALPHLVPAEDGDIADALTKALKREGWTVHTGRRVRSL
    VTDEEGALLTFEDGTAIRADKALMAAGRSPATAALHPEKAGIMTDGRGWISTDNFLQAAENIYAVGDVNGRTLLAHAAEH
    QARYVVSRLRGLTAAEYPAPVMPSCVYGHMEVMRTGATAKELTAQGISVSVSRAPLASNAIAQSCGATQGFVKAVWAAGN
    GTPELRGIAATGHGVSHLVGLATVMVQQRWRRENIHDIIYAHPTLDEALEAALSAPLENA

    >gi|78357061|ref|YP_388510.1| HesB-like domain-containing protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MITLQESAGKELDAYFTDKEKSPIRIYLAPGGCSGPRLALALDEPGEADTTEDAGGYTFIMNTGLFEQVGNVTIDLTCSG
    FTLTPEIPLPGGGGCSGCGSSSSCCS

    >gi|304570587|ref|YP_388558.2| thioredoxin reductase (NADPH) [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKLYDSIVIGGGPAGMTAALYLLRSGVSVAWCEKLSPGGQMLMTEEIENYPGFPKGLKGYELVDLFAAHLDGWSFDKYTD
    EVAEIIPGNGVHRVRVGDEWVEGKTLIICSGARYKRLGLPNEERLTGKGISY
    CALCDGNFFRGQEVGVVGGGNSALEESL
    YLSKLVKKLHLIHRRDDFRAMKCYQDKVCIKPDIEVVRSTVVTEIHGENALEGVTLRNLKTGEEYFLKLDGLFVFIGFEP
    VTGFFPDQLGVDAQGFIITDVEMATNVPGIFAAGDVRSKLCRQVTTAVGDGATAANSAFLYLEQLDA

    >gi|78357110|ref|YP_388559.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MAVQVTDSNFEAEVIKSELPTLIDFWAPWCGPCRAMGPVIDELAAEFAGKVNIVKMNVDENPATPSKYGIRAIPTLILFK
    GGEVVEQITGAVSKSSIKDMITQKALG

    >gi|78357157|ref|YP_388606.1| thioredoxin family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MRRSFLIMRTMLTVCCLVVLWAGAVRAADVQEGGSALLLDSIAAQSGKPVLVNFFASWCPPCKEEIPGLVSLRSQYAADD
    VAIIGVSLDESRSALDRMIQDFGINYPVIRGNRELAGTFGVTGIPRLLVYSAEGKLVSDHLGYMTEEELRQLIDANIVK

    >gi|78357194|ref|YP_388643.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MHTPLVIIGSGPAGLSSAIYTCRSGIDTIVFGSKPKVAGDYEIDNYFGFEETISGKELLEKGRAQAERFGARFKEDRVLS
    VHHNESGGFHIKTEHEEFDACAVILATGVGRVRPGISNLKDYEGKGVSY
    CVSCDGFFYKNRKVIVVGEGIYAANQALELL
    SYTPHVTIITQGKKSSITPEFQQRLSAAGITVSEQKIETLSGSPALSSVTLSDGTSLEAEGIFIAMGEASSLDFAYTLGL
    ERSGVFLVADKEQKTNIPGIYAAGDCTGGFLQIAVAVGEGATAARSAIAHIKENCKG

    >gi|78357356|ref|YP_388805.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MNERTGIITFKGNGLTLQGTPVEKGGKAPDFTVLANDLSPRTLADYKGKVLILSSVPSLDTPVCDVETRRFNQEAANLGD
    DVKVLTVSADLPFAQARWCGAAGIDAVETLSDHKDLAFGNAYGVVIKELRLLARAVFVVNRDGVITYQQIVPEVTSEPDY
    EAAIAAAKAAL

    >gi|78357525|ref|YP_388974.1| peptide methionine sulfoxide reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MLRHFPGIILAAALIIIPLTTLYATAKLPPGKLPDSPPEGLAYATFAGGCFWCMEPPFDRTPGVLETISGYTGGHTEHPS
    YEQVSAGGTGHYEALRVVFDPRQVSYDTLLTIFWSNIDPYDASGQFCDRGDQYRSAVFWHDDGQKEAALRSVAHGLQDGS
    LDKAPATEILPAQDFWQAEDYHQDYYRKNPVRYKFYRFSCGRDQRLEELHDKR

    >gi|78357602|ref|YP_389051.1| 3-Cys thioredoxin peroxidase / 1-Cys peroxiredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MEEGKFVLIGDALPEMHVTTTRGPMTLPGDLKGKWFVLFSHPADYTPVCTTEFVAFQKRYDEFRKLNCELVGLSIDQVFS
    HIKWVDWIKEKIGVEIEFPIIADDMGQVASRLGMIHPGKGTNTVRAVFIVDDKGIVRIIFYYPQELGRNMDEILRAVKGM
    QVSDAQSVAIPAGWPENEIVRDHVIVPPPKSVQEAQKRLTEGHECYDWWFCHKKL

    >gi|78357603|ref|YP_389052.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MLWKQFFTPVKSYSVKEAAEFLTGKNPSDVTVLDVRQPGEYRQGHLPGARLVPMGELSDRLDELERDGPTLVYCAIGGRS
    RVAAQMLAGKGFKHVINMAGGFKDWESMQQGSGWTSTGDYTQGLELFPDDIDVRRALEVAWGMEAALEEFYRDMAARARE
    AGKETTAAMYDRLARFEVGHKAKIENRYAALAGSDAELEKKAAQVVEGGMTTEEYMQRSGIDPADPAHIAGFAMMMEAQA
    MDLYARAARSAADAGTAAFLEDMVQEEKSHMQQVGRLLDSLLEDQNHG

    >gi|78357781|ref|YP_389230.1| hypothetical protein Dde_2739 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MGTQALPCACIVICSGRCYVAGDINPLRKGSTMAENSDVRLYALSTCIHCRKCKEFLEEHSVPFECVYVDMLSGDERSET
    ISFIKKHNPKLSFPTLVIDNGGTVIVGFHKDQIEEALDL

    >gi|78357820|ref|YP_389269.1| redox-active disulfide protein 2 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKIQVMGPGCPKCAEAEKNVKEAVAEAGVEAEVIKVSDFQEIASFGVFSTPAVAIDGEVKVVGKAPSKKEVLSWLK

    >gi|78357823|ref|YP_389272.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MVDLGAHSCIPCKMMAPIIKELSAEYSGRAAIVFIDVWENPNVPPQFGLRAIPTQIFYDAEGKERFRHEGFMDKESIVEK
    LKKLGVN

    >gi|78357825|ref|YP_389274.1| hypothetical protein Dde_2783 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MVHATDSTVQLDGANGEISIKDAAMFFLSRRAVFLDARSQMEFKSGHIQQALSAPTKDFDYTFDEIALHLRGAETIITYC
    DGER
    CSLSLSRDA

    >gi|78357828|ref|YP_389277.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MDTLNELLPQMDFEFFGSGQHGMSVEGLRKNIENDHMFFLDVRSKEEVGHVSFPFAKHIPLNELPQRLDELPKDKLVVAF
    CSSVFRGAIAYTYLLSQGFEEVKALTANTEDIVKAFKPGPLYKV

    >gi|78357889|ref|YP_389338.1| hypothetical protein Dde_2848 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MTAQRPNRLINESSPYLLQHARNPVDWHPWGEEAFALARSEDKPVFLSIGYSTCHWCHVMAHESFEDEAVAALLNEAFIN
    VKVDREDRPDIDSIYMAACQMLTGSGGWPLTIVMTPDGRPFFAATYIPRLSRGGRTGMLELVPRIRDIWRKQRADVTASA
    DSVAEHMRRHAEGLLRPSSGGAPDDTTVRQAVDTLCQRYDARHGGFGSAPKFPAPHSLLLLLRHAHRTQDAARRAQLTGM
    VSHTLEAMRLGGIFDHAGYGFHRYSTDKEWLLPHFEKMLYDQAMHVLAYTRGWQLTGRPLFRRTAEEIMMYVMRDLTSPQ
    GAFYAAEDADSDAPPHFAAMGLPHRGEGFFYLFTLQEIRGLLSREDALLAEKIWNLQEEGN

    >gi|78358173|ref|YP_389622.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MIPDFTHRKALTAGVLVFLMLASGMAFMQWYRYGHTADTGMQLVPVSATQAAGLLNEKSVIPLDVRTPAEFARGHIKGAV
    NADFHAPDFAGQLARLDSRAAYLLY
    CRSGARSARTLRTLEKLGFKGPVYHLQHGLLEWEQHKLPLTKNGTAH

    >gi|78358288|ref|YP_389737.1| rhodanese-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MHSQEIRAARVSAEGLRQLMARRREGEYTIVDVRSADEYRQGHIPGAVHIAVTELEQRIGELDAAQEHVFYCHSGSRSAA
    AAVLAAESGRLRGPLYNLDGGILAWEGASVADVPRIAVFDDVKDMRGLLLRAMDMEKAAFLLYSRVRGAVAHAGVCSLMD
    RLVNMEETHARVVYSYLKRQWDEIPDFKELFESLEGRVLEGGLTMDELEPWIRGAGTGDCTEIADLALEVEANALDLYRT
    LAHRAGRGGQDGGIASDEAVSAFTDLAQQEKQHARLILQHMEAFGGQD

    >gi|78358353|ref|YP_389802.1| hypothetical protein Dde_3313 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MKNRCCVAILVLLCVFLAGIAPAGADDGDIQRVVTSVTTDDVNRAAMAIAFTRGIMQEKQVEGILFFNVYGVNLVNAGKD
    SPVYGNGKTVAQMLREFMDAGGVVMA
    CPMCMQHVGGMTSADLIQGVSAVKGGGVKAVSGPRTLALSY

    >gi|78358455|ref|YP_389904.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MSDSIHIVCPHCQSINRVPANKLAEKPNCGRCQHPLFTGEPIDLTTATFARHLERSDLPLLVDFWAPWCGPCKMMAPQFE
    QAASLLEPKVRLAKVNTEAEPHLAAQFGIRSIPTLILFRGGHEVARQTGAMGAQDIMRWVTSRLPQ

    >gi|78358565|ref|YP_390014.1| heterodisulfide reductase subunit A [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MNIGVFVCHCGSNIAGTVDTEKVAEAARMYPEVRFATDTMYACSEPGQEGIISAIREHGLDGVVVASCTPRMHEATFRRT
    LERAGLNRYMFEMANIREHVSWIGKDMEANTSKAMDLVRIAVEKLRRNTPLHPRKFDINKRVMVIGGGVAGIQAALDCAE
    GGLEVVLVEREPTIGGKMAKLDKTFPTVDCSS
    CILGPKMVDIAQHPNITLYALSEVESVNGFVGNFSVNIRRKAAYVDWS
    LCTGCGACEEKCPARKTYDKFNEGIGRTTAIKIAFPQAIPKKAVITPETCIMLTKGKCGNCAKVCPAGAIQFDQKDSIVT
    EEVGAIIAATGYDLFDHTALGQYGGGRYADVITSLQYERMLSASGPTGGHVKRPSDGAEPKNIVFIQCAGSRDKSIGRPY
    CSGFCCMYTAKQAILTKDHIPDSQSYVFYMDIRSPGKMYDEFTRRAMEEYGARYIRGRVSAIQPRGGRYLVKGADTLLGN
    QVEIEADMVVLAVGVESAKGASELAEKLRISYDSYGFFMEGHPKLKPVETNTAGVYLAGSCQGPKDIPSSVAQGGAAASK
    VLSLFSRDKLESDPQVSAVSLLRCVGCGKCRETCPFGAIEMTEFRGMPKASVVETVCQGCGICAVTCPQGAIQLQHFTDN
    QILAEVNALCRY

    >gi|78358581|ref|YP_390030.1| ubiquinone/menaquinone biosynthesis methylase-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MTCTGTAPAAACEPLWARPAMRGASPDAWRPGGLELTDRAAALAGVKPGWRVLDAGCGTGASALHLRRRYGALAAGMDML
    AGRHRQGDVPCRVATGVPMVRADAMQPPFIPESFHMILCECVLSLLPDPARALHIFRNLLRSGGTLAVTDLYLTGQKKHT
    LPAGS
    CLGWQATRSGILAMLRQAGFLPLCFEDHTPMLGTLAARLVLAGEPLCSLSAAAAGRSANIPHTGTGAGYFLLLAR
    RSG

    >gi|78358804|ref|YP_390253.1| hypothetical protein Dde_3766 [Desulfovibrio desulfuricans subsp. desulfuricans str. G20]
    MAESLIIYGKENCPHTRRAREAHPGHIFMDVQSSLTAMQNMLELSGGVRRVPVLALRTDKGEQLISVGYNKGS