Desulfovibrio desulfuricans ATCC 27774 uid59213

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|220903305|ref|YP_002478617.1| DSBA oxidoreductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MTVFKKAGAVALLGLMTFGGWALLAQQGARAASVQVTEENLPQMLEKLFQERPDLVMDVLRKHSEAVLDIAQQGSNLRRQ
    RSLEAQWNQEMKTPKPVKVEGRPVLGAKNAKVRIVAFSDFT
    CHFCQQAAGTVSGIMKEYGKDVSLVFKNLPLDEKGPASI
    ASRYFLAVAQQSEEKAWKFHDALFADRNRLVTEGETFLKKTAQDLGVDMKRLAKDVHSKKISDIMDEDQQDAQKLGVEGT
    PYFLVNDLVVRGALPPDLFKRAVDMAKNQADNKSAK

    >gi|220903399|ref|YP_002478711.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MAYKLVHYINQFFAGIGGEDKADVSPEVREGIVGPGMAFKAALGDQAEIVATFICGDNYCANNLDAVAARMVETVKSFGA
    DGLIAGPAFNAGRYGTACGAVCAAVNKQLGLPVVSGMYRESPGVDLYRKEVTIVETADSARGMGKAVPAMAAVVLKLLRG
    EEIADPAAEGVFPKGIRKNMFYDEPGAERAVRMLIKKVGGEEFKTEYAMPIFDRVEPRPAIADMSRATIAVVTSGGIVPE
    GNPDHIAASSAQNFGAYSIEGVTDLEKGRYLTAHGGYDQTYANQDPDRVLPIDVLRDLEKEGRIGKLYNVFYTTVGNGTS
    VANSRKFGTEIGSQLKAAHVDGVILTST
    CGTCTRCGATLAKAIEEAADVPVVHMCTIVPISLSIGANRIVPTVSIPHPLG
    NPELSAAEEKHLRRELVLKALQALSTGVDGQTVF

    >gi|220903400|ref|YP_002478712.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MEKRELVIIGAGPAGLSAAIYGKRAGLDTLVLEKGRPGGQILTTSRVENYPGIIDGTGTGLADAFRAHAEFFKAEFRSVS
    VQKLEVRGNEKIITLKDGTEIAAGAVIVASGAYFRKQGCPGEKKYTGMGVSY
    CAVCDAAFFEDLEVAVIGGGNTAVEEAC
    YLTGFASRVYLIHRRDEFRADRLVVEHALANPKIVPVMDSVLESIEGSDMVEKIMVRNVKTNKMRQIDLSGVFIFIGTLP
    NAEFLHGLLQTDAGGWIITDDKLQTSVPGIFAAGDVRNTSLRQVVTAAGDGARAAMAAYAYLQH

    >gi|220903403|ref|YP_002478715.1| Thioredoxin domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MIIVDKENFEAEVQQSAMPCVVDLWGPQCGPCLALMPAVEELAATYEGKVKFCKLNVAENRRLVIGLRVMAVPTILFYKG
    GECVARLTGDAVSVESIKAEADKLL

    >gi|220903404|ref|YP_002478716.1| Glycine reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MGKLTGKKLLLLGERDGVPGPAMADVFANSGAEILFSATECFVCTAAGAMDLENQQRVKDAAEKFGGENVVVILGSSDPE
    GAEIYAETVTMGDPTFAGPLAGVPLGLCVYHILEPEIKEEADPAKWEEQISMMEMVLNVDALVESVRKMREANSKFSL

    >gi|220903437|ref|YP_002478749.1| dihydrolipoamide dehydrogenase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKKLTIIGSGPGGHMAAFAAARAGHSVTLVESAAVGGTCLHTGCIPTKTFKSSADALEKIRHMGNYAITGNADASISMPD
    LLARKKNVIGLLTTGLEKTCASLKITIVRGRGRVVSAREVAVSTQEGTVLVESDNVIIATGSRPLDLPSLPADHKHILNS
    DDALALEHVPTSIAIVGGGVIGCEMACIFRSFGAQVTVIEGQDRLLPIPSVDAEMSKLLLREMKKAGIRVELGKTVSAAT
    VEQGVAKLAVSPSRPRGDAPAEAAMLDVESVFVTVGRVPNTEGLGLAEAGIAVTPRGWIEVDDCLQTSVPGVFAIGDVLG
    PEKIMLAHMASAEAEHVVAHLDSPAPCDYSVVPSAIFTTPEIGCVGLSEEQALAAGLPVRCTLLQVRELGKAHAMGEIAG
    VFKLVAHAENNTILGAHLCGPHATDLVAEAGLAIRMGAKVDDVAHTIHAHPTLAEGFYELCHKAARP

    >gi|220903439|ref|YP_002478751.1| OsmC family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MAKINVEWKGNMVFEGRDSDGHSLVMDASAIYGGSNQGVRPMEMLLISLAGCTGIEVGHAMNKMRLEYTSFTITADAVRR
    EEIPQIFTEINVEYTVEGTGISLERFVRAFELGAVKYCSVANMLKASSKINYSFVLNGQHYNYPLQDGEAAPQ

    >gi|220903877|ref|YP_002479189.1| peroxiredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MANLINSKVEPFNVQAYHLGELKNVCDTDLLGHWSIFFFYPADFTFVCPTELEDLSDTYEDFKKLNCEIYSVSTDSAFVH
    KAWADASPSIAKIRYPMLSDSAGTLSRAFHVLIEEAGQALRGSFIVNPEGIIKAYEVHDLGIGRNAEELLRKLEAAQFVA
    QHGDQVCPARWKPGKSTLKPGLDLVGKL

    >gi|220904178|ref|YP_002479490.1| hypothetical protein Ddes_0905 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKQGFNILSTTTGIIVVGLIFGVLAVLLQQAGNPGNMGICVVCFNRDIAGAVGLHRADLVQYLRPEIMGMVLGAFAAAML
    FGEYKPRGGSAPIIRFFLGAIAGIGALVFLG
    CPWRVILRLAGGDAHALFGLAGLIVGVGIGTVFFRMGFSLGRSQGQGKI
    SGLLLPALMIALVALYLADPQIIGELKSGVLFYSIKGPGSQHAPFIFSLCAGLAVGFLAQRSRFCTMGALRDVILFNQWF
    LALGFIAMFAAALIMNIGFGSFHWGFENQPVSQPNDLWNFMGMVTAGLAFALAGG
    CPGRQLFMAGEGDNDAAVFVMGLIA
    GTAMAHNFGMASSPAGIGPHGMAATLAGLGICLCIGFYNCKRGA

    >gi|220904182|ref|YP_002479494.1| HesB/YadR/YfhF-family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MLELTESARQELDAYFKGKEKSDIRIYLAPGGCTGPRLALAIDAATEDDQSEEQGGFTFCINKDLLGQIEGVKIDLTHMG
    FMVEPTVPLPQSGGGGCSGCSGGCGV

    >gi|220904284|ref|YP_002479596.1| Redoxin domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MNTVTFKGTPLHLVGQQPAVGQKAPDFTLAANDLSPRNLKDYAGKVLVLVSVPSLDTPVCDMEVRRFNKEAAALSDKVRI
    VAVSCDLPFAQARWCGTAGVQAVETLSDHKETSFGKNYGLLIDELRLLARAIVVVAPDGSIAYTQLVPEVSSEPDYDAAL
    AAIKKLA

    >gi|220904294|ref|YP_002479606.1| cytochrome c biogenesis protein transmembrane region [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKLNDFYLIKVFRAYRFSTALWLIPLCISLFLFVFFSRAEAESLSGRFETAAEGGNLIGALHLTLPQGFHAYAHDPGDAG
    RPTTLRFSVDGGAPQAVWYPEGAVQRDFYDPSATIFVYESEVTLYVLLPAADAGKTYTADVSMLLCSTRNCMPVNQQFQG
    VVPRADLPLADVPWAARWRGLKKQPPRFFEGGTAQALPAFGTGSSLAAGSDQVPAEGQGSVSSDGKSEGIARWLAAQNGE
    AAPASDKKLEEEKGQKALPPPDGFVSLTPRYMDESMEISGLGKALLFGILAGLLLNAMPCVLPVLTFKVSGLLMVGGYDK
    EGLKNFRRHNICFAAGVMTLFSALALVLGLADLMWGQLYQSQPVLLVMLLLVFLMGLSMLGVFTLPVIDLKTGTNTKNPC
    LQAYFTGLVSTFLATPCSGPLLGGVLGWAFTQPLMVVVVVFWAVGLGMALPYVLFSIWPVLARILPKPGAWMHVFERVVG
    FFLLGTALYLLSILPVEKHMQVLSVLLVVALCAWLWGQFCGISAPPLRRRVVGLVSLGLLLASFVWVLRPVAPLPQWRDF
    TPQTFEATLGHKPMLLEFTADW
    CPNCKFMEATVLTDERLRRLQARYGMELVRVDLTNANAYAVRLLEALGSKSIPLTALF
    PAGSEATAPLVLRDVYGGETLERALGEAFGK

    >gi|220904430|ref|YP_002479742.1| methylated-DNA/protein-cysteine methyltransferase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKNLWFYTCPIGKIGIVEKNGAICQVFFSTEAPPDGFTLQKSPVIERAEHQLTEYFAGDRKEFDLPLDLGGTEFQATVWQ
    ALQTIPAGETRSYKDVAVMIGKPGASRAVGMANNRNPVAIIVP
    CHRVIGHDGSLTGYAGGLAIKQYLLDHEKMWQPERIH
    AQYTLF

    >gi|220904469|ref|YP_002479781.1| thioredoxin [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MAEQVTDATFESVVLKSDLPVLLDFWAPWCGPCRAVGPIIDELATEYAGKVRIVKMNVDENPATPTKFGIRAIPTLVLFK
    NGETVEQITGAVTKAAMKDLLDTKALA

    >gi|220904470|ref|YP_002479782.1| thioredoxin reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKAYDAVVIGGGPAGVTAALYLARSGCSVLMPERLTSGGQLLQTEALENYPGFPKGIKGYELADLFAAHLDGLAVDRPAT
    VVESITGLAGRFTVRTSDGEHTCKTVLVCSGAKHRQLGLEDEDRLRGKGVSY
    CALCDGNFYRNQTVAVVGGGNAAMEESL
    YLTKIVGKLHLIHRRDSFRGLKVYEDRLESMPDKVNIIRSSTITKLHGEDFLTGLTVKNLLSGQEELLPVDGLFVYVGFA
    PVTDFLPQGIVLDEQGFIVTDTEMRTSIPGIFAAGDIRSKLCRQVITAAGDGATAAQAAFVFLEQLHA

    >gi|220904510|ref|YP_002479822.1| electron transport complex, RnfABCDGE type, E subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSILQEFTKGLWKELPPFRLVLGLCPTLAVTNSADNGLGMGVAVIFVLVLSNMLISMVRSIIPKTVRIACFIVIAASLVV
    AVELLMQAYAYPLYQRLGIFVPLIVVN
    CIILGRAEAFAAKNGVAASIADGLGMGLGFTLSLTFLGSLREIFGNGTWFGQS
    VMWEGFEPMRIMIQAPGAFICLGLILAAMNMYNYWKAGRGKAVPAPQGGCGSCGCCSLERREEAR

    >gi|220904511|ref|YP_002479823.1| electron transport complex, RnfABCDGE type, A subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MDIFAIFISAIFVNNIVLAQYLGNCPYVGCSKEKGVALGMGGAVVFVTIAATLCTWLMQKYVLDPYGLGYLQTIVFIVVI
    AALVQFVEMFLKKIVPPLYAALGIFLPLITTN
    CAVMGVAILVQREGYGLMESLVWALAYGLGFTLALLLMAAIRERLDTC
    RLPKAMAGTPLALVMAGLMSLAFMGFKGMG

    >gi|220904683|ref|YP_002479995.1| hypothetical protein Ddes_1415 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSITLYTAPDCIRCRIVKSFLAERGLEYATVDFKADAQTFNAFYRANRKAIYRNPEGVEFPLFDDGKVIKQGSGEIIAYL
    LSGHDMECCVTRSDMLHGKIAGIYPSLCPDGQEENLLILVDRLAKGGLQVWLQVDGRKPALLEKLLHIKDVHVILNVVGG
    ADAAGRIFGGAPSKEDLAKTIALVQASPDGIIRFLAVPHPADGGQWAWPQRADAAAAAQMVAEACGQPTLPYVITAITPD
    MAWDMRGLDALPEQNMLVYRSASRQFLFKADIAK

    >gi|220904684|ref|YP_002479996.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MQSFDVIIIGGGPGGTTAARILAQGGKKVALIEDKHWGGTCLNCGCIPTKMLLGAVAPGSLLRAQERLRVVKGNVKVDFT
    ALQGRVSRFTKGTSQTLAKALAGSGVTLFEGLGTCLERKEGQPRVQVVCAENRTDMTAPDVILACGTASAAFPGLAPDHQ
    CVLDSTDLLQSAAIPESLIIVGAGAIGLEMADFFSAMGSKVTVVEAASHVAPTEDPDIAKEMLRALTKNGITCHEGTRAK
    DLRTVDGKAQLSLEDGTVITAAKALVAVGRSPNTEGLGVENLGGTKTPRGYAQVDENLQCASGLYAVGDINGLTLLAHAA
    EHQAAYVARRILGQADGPYESGPVPSCVYGGTEIMRVGHTATALLQQGKSVEVSQAPLSMNPIAQASGGTAGFVKVVWHE
    GRMKGIAAVGAGVSHLVTVAQMLLKEGYSGHRLHEIMFAHPTLDEIVPMAINAPRKAVTAG

    >gi|220904709|ref|YP_002480021.1| Redoxin domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKKILLPLLLCLLLPCAAFAGSSSASGVPSLNLAGLTDLLAKNKGKVIMLNFFATWCPPCQVEIPELVQVNKKYAGKNVL
    IISLSVDEDAKVVTPFIKKMGMDYPVYMADRDIARAFQVTSIPHNVFYAKDGQRVISEPGIADAEMMEMVFNKLLEQK

    >gi|220904911|ref|YP_002480223.1| Rhodanese domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSAVQSISARELHSVDLKQALVVDVRSPMEYSEKRLAMPTAFAPVTDLDPRDVALRSGVLADTQLFTICRSGARAKSAAE
    KFFRAGYTNVRFIDGGIAACEEAGFATVGEGLSKTGEASPSLDRQVRLAAGALTVLFMLLGYGISPLFYLGALFIGAGQV
    FSGITNWCGMALLLMRAPWNQKGASCTLGGACSIGGNKGGGASPGASCQ

    >gi|220904962|ref|YP_002480274.1| OsmC family protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSTVSAKYLGDLRVECVHNQSGTKIITDAPSDNQGKGEAFSPTDLCATALGACAMTIIGIYGKNHGVDVTGTEVEITKAM
    SADPRRIGKIEVIFKMPPRTYSAREKASIERCTAS
    CPVHLTLHPEVEQVFTFIWQD

    >gi|220905138|ref|YP_002480450.1| heavy metal translocating P-type ATPase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSEAIAGKDAAEGACPLQFDIGGMHCAACSSRIERVVGRMDGVEKISVNLATAKAEVWASPGREDEVQHQIMGRVATLGF
    SATPASDDDASTEFAEGRARAIKDSRHRLRRLVPMACFAVPLLVVSMGHMVGLDLPGWLDPHASPCAFMLVQLFLSLPIV
    WLGRHFYVDGIRALLRKAPAMDSLVAVGTGAAFLYSLVNTVLGLMGLDPVERAMNLYYESGAVLLTMIELGQFLEATAKR
    KAGDAMGALMSLTPETALRLDSADEAQPPREVPLSEVKAGDHLLLRPGGRVPVDGEVLTGKSAVDLSLLTGESIPVAVGP
    GDKLVAGSVNGEGSLTLRADAVGRNTRLARIIRLVREAQGSKAPIARLADRVSYYFVPAVMIYAVLAALAWLVFSSEPVT
    TPLTVFVAVLVMACPCAMGLATPMSIMVGTGRGAQLGVLIKNGSALEQAGHINVLAVDKTGTLTTGKPVLTGVTLLEGAG
    ELDENGLLSLAAALEARSEHPLAQALIKAGHDRNLPARRVEDVVVTPGMGIAGRVFADGQGCRVAVGNRAFMKECGLEVS
    RDVVDRLAVLAEAGQTPLLLALDRGGENRLAGILALADGIRPESPSVVARLREMGVRVVMLTGDNERTARAVAAQVGVDE
    VAAGLLPAEKADYVRRLQEEGHVVGMVGDGINDAPALALANVGMAVGTGVDVSAEAGDIVLMRGGMEAVLTALALSRATM
    RNIRQNLFWAFGYNVLGLPVAAGLLHVFGGPMLSPMIAGTAMALSSVSVVTNALRLRFFKIEHSSFEKV

    >gi|220905188|ref|YP_002480500.1| Methyltransferase type 11 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MKSAGKETDRQTITETVRSGYAAIASGAQRSCCSNRRSGQADPARLAESLGYDAKTLARLPEGANMGLSCGNPVALAALL
    EGQTVLDLGSGGGFDVFQAGERVKASGRVIGVDMTPEMLAKARKNIESYRELTGLDNVEFRLGEIEHLPVADNSVDVVLS
    NCVINLSPDKAQVWHEIFRVLKPGGKVAVSDLALLKPLPDNIRDMAAALVG
    CVAGAVLIDTSAALLEKTGFSGVTLTPKP
    SYVQSMQDWNDPLYAEIATNLPKGEDLTDYVVSLSIEAVKP

    >gi|220905211|ref|YP_002480523.1| peptide methionine sulfoxide reductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSQRVFFLILTAWLLCGAFVPAAADCAAAGPVDAALPETAMKPSFPMPPLSGPEADIILRKATEAPYSGQYTNKREAGTY
    VCRQCGTPLYSSRDKFESGCGWPSFDDELPGAVRRQPDADGRRVEIVCANCGGHLGHVFAGEGFTAKNTRH
    CVNSLSMSF
    YPAGSPEEAQALARSSPQGCTATAIVAGG
    CFWGVEDAFRKMPGVCAAVSGYTGGRTPDPTYEAVCGGNTGHAEAVRVSFD
    PSVVSYEQILRRFFEIHDPTQLDRQGPDVGDQYRSAVFFLDAEQEAVARSLMSRLRELGYDVVTRLEPAGPFYMAEEYHQ
    RFAERTGRGRCHMPVPRFDIPAGGGGGALRK

    >gi|220905349|ref|YP_002480661.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MPEKILVVGGVALGPKAAARCKRLMPDAEITLVDENVFISYGGCGIPYYVSGEIQNLDDLRSTPYHTVRDADFFRDMKGI
    TVRTQTRATAIDRTAKTLAVKNVVTGQEEKLPYDKLVLATGATPRVPPVEGKDLENVLSLTRLEAAGAIRTACQEGKITE
    AVIVGGGFIGLEAAVALADMWGVKCSVVEMVDQILPGVLSHPVARMAAHDCVTHNVNVYTGEKVLRLEGKDGKVCKVVTD
    KRELEAQLVVFAAGFIPNGQLAGDAGLDVAPFGAIVVDRHMRTSDPAIYAGGDCVAIKNIITGKLGYLPLGSMANRQGRV
    IGTNLAGGDATFPGYVGSWAVKLFDLSFCGVGLTVERARAEGFDAFSVSVEQFDHAHFYPEKAMMTLELVVDKATSRVLG
    MQGACADGDSLKARVDAVAAALQYSQPTVEDISNLEVAYAPPFASAMDVVNVVGNVADNVLAGRFTPVTADQFMDLWKNR
    EKNNMFFIDARPAAAGRAVQEKHPDWHAIPLEEVAARISEVPRDRPVAII
    CNTGLRAYDGLLVLARHGITDVVNSTGGMQ
    AAIKMGLSV

    >gi|220905352|ref|YP_002480664.1| Rhodanese domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MPHSMQNSVSRRFLCAFALLTLVMLAALPAAARDISVQDAADLLQNPPQGLIIVDVRTPAEFREGHLPGAVNIDYFGGPF
    EAQIANLPKDAPVLLY
    CRTGNRSAGAYKSMQKAGIGNILHMNEGISIWQQRGLPVEK

    >gi|220905362|ref|YP_002480674.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MRIGVFVCHCGSNIGGTVDCAKVAEIARTYPDVVYADDPMYTCAEPGQAAIEAAIHEHKLDGVVVASCSPRMHEPTFRRT
    VERAGLNRYMLEMANIREHVSWIGRDKEANTNKSAELVLLAVEKLRNNKPLLAKSFDVNKRVLVIGGGVAGIQAALDCAD
    GGVPVVLVERDATIGGKMAKLDKTFPTVDCSA
    CILGPKMVDVAQHSNITLYAYSEVEDISGYVGNFTVKIRKRATYVDWS
    LCTGCGACTEKCPSKKTPDAFNEEISNTTAITIAFPQAIPKKAVINAGHCRQFIKGKCGVCAKICPTGAIKYDMEDEIIT
    EEVGSIVAATGYDLMDWTVYQEYGGGAYPDVITSLQYERLLNASGPTAGHIKRPSDGKEPKNIVFVQCVGSRDKSIGRPY
    CSGFCCMYTAKQAILTKDHIPDSQSYVFYMDIRAAGKMYDEFTRRTMEEYGTEYIRGRVSQIYPDGQGQLVVMGVDTLMG
    QAIEIKADLVVLAVGIEASKGAPQLAEKLRISYDSYGFFMESHVKLKPVETNTAGVYLAGVCQGTKDIPASVAQGSAAAA
    KVLALFAKDKLESDPQIAQVDMRRCVNCGKCIQCCPFGAIKEVEVRGEGKAQVIETVCQGCGLCTATCPQGAIQLSHATD
    NQILAEVNALCQL

    >gi|220905389|ref|YP_002480701.1| heterodisulfide reductase, putative [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSNAILVVGGGFAGLTAAIEAAELGHDVYIVEKSPWLGGRVAQLNKYFPKLCPPSCGLEIQFQRIRKNPRVKFFTQAEVV
    GFSGVKGDYTVKVRIQPRHTAPHNVDFSLLASSLDGESPSEFDFGLSKRKGLYKAMPFAFPSRYTLDKQTLSKADKARVA
    GNQFLDVTEAPREIELGVGAVVIATGWKPYDVTRLSNLGAGNVKNCISNMQMERLASPCGPTAGRITRPTDGRRPHRVAF
    VQCAGSRDQNHLNYCSYICCMATLKQCQYIAEQNPDTQITVYYIDMRAPGRYVKVLEKVKAMPNVHFVKGKVADVVQAEG
    DKVRLTAEDAVSGEKLTLDYDLVVLATGMQPSLAGEDAPLPLPLDEEGFVAGGEEAGIFAAGCARMPLDVMRSAQSGTAA
    ALKAVQTVKGR

    >gi|220905606|ref|YP_002480918.1| hypothetical protein Ddes_2346 [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MSHNLSVSLSRKGARVDLDMDVAAIGMISIDGEAVPSEERAGVAKKMLGASALYCYCAALDKALDTRNAKYDRIEGSATV
    RTGTDELGRGRVVGIDIDVTVHMDEEFAFIFDRVEKVMRKG
    CLVTGSLENAFSVTYKLTLAEDED

    >gi|220905607|ref|YP_002480919.1| dihydrolipoamide dehydrogenase [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774]
    MTAETKTLTVIGGGPGGYTAAFAAARAGMRVTLVECESLGGTCLNHGCIPTKTIKSSAEALELAQNAAAFGVRIEGGIHI
    DPAAVLQRKERVRSILCSGLEKTCASLGIDLVRGRGRILRAGLVELIGTGGTRTVEADNIIIATGSRPVELPGLPIDHTH
    ILNSDDALRLESVPSSLIIVGGGVIGCEMACIYRAFGATVTLVEGQDRILPLPSVDEDISALLQREMKKRRIACETGCTL
    TNVTTGPDGVHAALAASPFAPAGAVPRPEKTVRAEKVLVTVGRAPCTDGLGLEETGIAADARGWITADARMRTSVPHIYA
    IGDVLGPGRVMLAHAASAEALCAVADCLGKDTGRDMDYRHIPSAIFTSPEIGCVGMSERQARDAGHEVKTSVVQMRELGK
    AQAMSALPGFCKLVADARTDALLGVHMAGAHATDLVAEGVLALHLGAAVADVAAAVHAHPTLAEAMGEAALRMPQ