Desulfotomaculum reducens MI 1 uid58277

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|134298016|ref|YP_001111512.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MTTTNKVGAVLVVGSGIAGIQASLDLAESGYYVYLVEREPAIGGTMPMLDKTFPTNDCSMCILSPKLVDCGRHLNVNSMT
    NSEVVGLEGEPGNFKVTIRTKARYIDVNKCTGCGSCAEACPVKVDDAFNQGLNKRKAIYKLYAQAFPNAYAIDSSKCLKF
    KNLSNDKLCGKCIKACQAGAINHHMQDEETQIEVGSIVLVPGFEAFDPTQLELYQYGKLKNVVTSLEFERILSASGPFGG
    HLIRPSDHKEPQKVAWIQCVGSRNCRIGNGYCSSVCCMYAIKQAVIAKEHTPYDLGASIFYMDMRTYGKDFEKYYERSKA
    QYGVNFVRSRVYSLDLGENDNVKIRYALEDGTVITEEYDMVVLSVGLEPHKAAVELAKTLGVELNQYNFVDVPELSGVAT
    NKPGVYVAGAFSGPRDIPETVMQASAAAGEVQKLLAEAKGTLTKTKEYPAPKDVSGEIVRTGVFVCHCGINIGGVVDVPS
    VAEYAKTLPGVVYATEKLYACSQDASAQIKEAIEEHGLNRIVVASCSPRTHEPMFQETLKEAGLNPHLFEMTNIRDHCSW
    VHQNEPEKATEKAKDLVKMAVKKAALLEPVHPITLPMNHDVLVIGGGVSGLTSALNLADQGYQVYIVEKAEELGGIAKRI
    KYGMGGEDVPAYLNELIGKVNSHTKIKVYTSVEIADVQGFMGNYQTKLTNGEEIKHGVVIIATGAAEYQPTEYLYGHNTR
    VRTLLEVEGMLADGKLQNANNYVFIQCVGSRDDERPYCSRICCTKSIKLALKVKEAKPSANVYILYRDIRTYGYFEDLYT
    EARRKGVVFVRYSVDAKPVVEGTSFGTKVTFTDHVLNRPVEIYADIIGLATAIVPNDNTSLSKLFKVPINAEGFFLEAHM
    KLRPVDFGTDGVFMCGLAHGPKNLEENISQAKAAAGRAVTALAKENIETDGKAAYVDKRKCMACGVCVEVCPAKAATLVT
    DERGNTVADINPALCKGCGACSSSCRCGAINVKGCSNEQLMAMVQAVAWQ

    >gi|134298021|ref|YP_001111517.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MTTTNKVGAVLVVGSGIAGIQASLDLAESGYYVYLVEREPAIGGTMPMLDKTFPTNDCSMCILSPKLVDCGRHLNVNSMT
    NSEVVGLEGEPGNFKVTIRTKARYIDVNKCTGCGSCAEACPVKVDDAFNQGLNKRKAIYKLYAQAFPNAYAIDSSKCLKF
    KNLSNDKLCGKCIKACQAGAINHHMQDEETQIEVGSIVLVPGFEAFDPTQLELYQYGKLKNVVTSLEFERILSASGPFGG
    HLIRPSDHKEPQKVAWIQCVGSRNCRIGNGYCSSVCCMYAIKQAVIAKEHTPYDLGASIFYMDMRTYGKDFEKYYERSKA
    QYGVNFVRSRVYSLDLGENDNVKIRYALEDGTVITEEYDMVVLSVGLEPHKAAVELAKTLGVELNQYNFVDVPELSGVAT
    NKPGVYVAGAFSGPRDIPETVMQASAAAGEVQKLLAEAKGTLTKTKEYPAPKDVSGEIVRTGVFVCHCGINIGGVVDVPS
    VAEYAKTLPGVVYATEKLYACSQDASAQIKEAIEEHGLNRIVVASCSPRTHEPMFQETLKEAGLNPHLFEMTNIRDHCSW
    VHQNEPEKATEKAKDLVKMAVKKAALLEPVHPITLPMNHDVLVIGGGVSGLTSALNLADQGYQVYIVEKAEELGGIAKRI
    KYGMGGEDVPAYLNELIGKVNSHTKIKVYTSVEIADVQGFMGNYQTKLTNGEEIKHGVVIIATGAAEYQPTEYLYGHNTR
    VRTLLEVEGMLADGKLQNANNYVFIQCVGSRDDERPYCSRICCTKSIKLALKVKEAKPSANVYILYRDIRTYGYFEDLYT
    EARRKGVVFVRYSVDAKPVVEGTSFGTKVTFTDHVLNRPVEIYADIIGLATAIVPNDNTSLSKLFKVPINAEGFFLEAHM
    KLRPVDFGTDGVFMCGLAHGPKNLEENISQAKAAAGRAVTALAKENIETDGKAAYVDKRKCMACGVCVEVCPAKAATLVT
    DERGNTAADINPALCKGCGACSSSCRCGAINVKGCSNEQLMAMVQAVAWQ

    >gi|134298233|ref|YP_001111729.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MNRIGVFVCWCGSNIGSVVDVPRLATEAAKFPGVVFSTDYKYMCSVPGQDLIVQKISEYRLDKVVIASCSPRLHEQTFRK
    TLERAGLNPFMMRIANIREQCAWVHSRQKDGATEKAIALVRRAVAKANNTEPLYEERIPVTKRALVIGGGIAGIQAALDI
    ADAGHEVVLVEREPTIGGKSAMLDKTFPTLDCSG
    CIVTPKMVAVVQHPNIKLYTFAEVCEVSGFIGNFNVRIKQKPKYVD
    HNKCTGCGTCWEKCPAKVPSEYNLHLGQRKAIYISSPQAVPNKPIIDPKGCRMLLSGKCGVCQKVCQAEAINYKDTEQFF
    EEQVGAVVMATGYDLFDWAGSYGEYGHSKYPDVISSLQFERLLNSSGPTGGKILRPSDSKEPKSIVFIKCVGSRDESKGK
    SYCSRACCMYTAKHAQQILEKIEGARVYVFYMDVRTPGKGYEEFYQRSVNEGACYIRGRVSKIYPKGEKLVVRGADTLLG
    RPVEVETDLVVLATAMTPSRGSDELAKVVGFTTDKDGFYQEAHPKLKPVETNTGGIFLAGCCQGPKDIPDTVSQASAAAA
    KVIVLLSKDELATNPMVSQIDERRCTGCMACRDVCPFNAIEEKLITDKSMGQGVQRTVAAINTGLCQGCGACAATCRCGA
    ADLKGFTNQQVMSEIIALCI

    >gi|134298242|ref|YP_001111738.1| dihydrolipoamide dehydrogenase [Desulfotomaculum reducens MI-1]
    MIYDAVVIGGGPGGYVAAIRIAQKGGKVAVIEKDQLGGTCLNRGCIPTKALIASVDKLKAVEEASEFGIEVGKPVIDFRK
    VQARKAEIVDKLVSGIKYLFDKNKIDHLNGTGKIKTANIVEVNNADKTYELQCKNIIVATGSSPSLIQSLGYNGTTIITS
    EEALKLTEVPKSLLIIGAGVIG
    CEFAHIFGSMGTQITMVEAAPSILSIQDKDISRRMQTVFKKKKFNIKTNVAITKMEQT
    GAGIQAELENGDIIKAEKALISIGRQLNTKNLGLEDIGVQLGEKGQILVNDRLETNIKGIYAVGDVISKYQLAHVASAQG
    IVAAENIMGKESTMDYNAVPSCIFTSPEISSVGITEQQAKDRKIPVKTGKFNFMANGKALSMGEGEGFVKIVAHKETDVV
    LGVHIIGPHASDLIAEATLAVRKGLTTKELAVTIHAHPTLAEVIMEAAENVHGLNIHG

    >gi|134298419|ref|YP_001111915.1| redox-active disulfide protein 2 [Desulfotomaculum reducens MI-1]
    MEIKVLGTGCQKCKEVEKLVREVLAEINVPANVEKVEDIAQIVQYGVMLTPGLVINGKVKVSGRVPNKADIKKLIEEEK

    >gi|134298420|ref|YP_001111916.1| hypothetical protein Dred_0547 [Desulfotomaculum reducens MI-1]
    MGANLDAKTLALIGVGASVGANCFPCLEQKVTEALKAGASVEEIAQAVQLGEEAKMQPNQGIKALAEMLLQNAQSLLDRG
    SAGGCG

    >gi|134298457|ref|YP_001111953.1| redox-active disulfide protein 2 [Desulfotomaculum reducens MI-1]
    MDIKVLGTGCQKCKELDKLVREVVAEINVPANVEKVEDIAQIVQYGVMLTPGLVINGKVKISGRLPNKADIKKMIEEEK

    >gi|134298477|ref|YP_001111973.1| dihydrolipoamide dehydrogenase [Desulfotomaculum reducens MI-1]
    MTYKAVVIGGGPGGYVAAIRIAQLGGKVAVVEKDRLGGTCLNRGCIPTKSLIAAVDKLKAVEEAAAFGIEVGQPMINFSK
    VQARKSEVVEKLVGGINFLFNKNKVELFNGTAKIKAPGVVEVENNGETQKLQCENIVIATGSSPALIKALGYNGNTIITS
    EEALQLTEIPRSLLIIGAGVIGCEFAHIYGSMGTEITMVEAAPSILSLQDKDISRRMQTIFKKKKFNIKTNVTIKKIEEV
    DNGIQAELENGDIIKAEKALISIGRILNTKNLGLAEAGIECGERGQILVNDQMQTNIKGFYAIGDVISKYQLAHVASAQG
    IVAAENIMGIESTMNYSAVPSCIFTSPEIGSVGMTEQQAKDQEIPVKTGKFNFMANGKALSIGEGEGFVKIVTHKETDVI
    LGVHIIGPHASDLIAEATLAVKNKLTAKELASTIHAHPTLAEAIMEAAENVHGLSIHG

    >gi|134298507|ref|YP_001112003.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MANKSILVVGGGISGITAAVEAAEVGYEVFLVERNAYLGGKVSQINEYFPKLCPPNCGLEINFQRIKKNPKIRVITMAEV
    ESISGQEGNFDVTVKMNPRYVTDNCTGCGKCSEVCPVERANAFNLGMDKTKAVYLPQPFAYPMKYVIDNTACTGASCGKC
    VEVCDVKAIDLNMGAKTMNLNVGAVIWATGWNSYPVEKLANYGSGTVTNAISNIMMERLAAVTGPTNGKIVRPSDGQEPK
    NIAFVQCAGSRDENHQKACSSVCCMATLKHIDYVKRQYPDAKVTIYYMDIRAMGKHEDFYNKIKEYDINMIKGKPSEILE
    DETKDVIVIAENQNTQEITQLKYDMVVLATGMAPATAVSQVPAAVAYDVDGFVQSGSVPGVYAAGCVAKPGDVASSVQSA
    TAAVLKAIQSTVRG

    >gi|134298629|ref|YP_001112125.1| thioredoxin [Desulfotomaculum reducens MI-1]
    MAENIVGLTDDNFKNTIQAEQLPVLVDFWANWCGPCKMIAPEVEGLAAEFEGQVLVCKLNVDESRETPNSLGVMSIPTLI
    LFKNGQEVERTIGFRKKEELRGLIKKYL

    >gi|134298769|ref|YP_001112265.1| thioredoxin [Desulfotomaculum reducens MI-1]
    MALELNAANFEAEVLKSDIPVLVDFWAAWCGPCRAIAPVVEQLSTEYAGKVKVGKVNVDENRELAQQFGVMSIPTLIFLK
    NGEKVDQVIGFTGKADLEKKLNAIL

    >gi|134298918|ref|YP_001112414.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum reducens MI-1]
    MASKKILIIGGVAAGPKTAARARRLDPEAQITILEKGKYISYAGCGMPFYLSGKIHDFDHLYSTSYGVKRDPEFFKSERG
    VDVFTGVEAISIDRTNKKVVARDVETGEEKIFEYDKLVLGTGSNPITPPIENLDLKGVYRLNHLTDAAAIKQALDAGEVN
    DVVVIGTGFIGMEAVDAIFSPRRTVTVVEFRETLLPGILDPDMGKLLYKSFYEQGLEGRFGEKVLKLEGEDGRVSKVITD
    KGSIDADAVILAVGVRPNVKLAQDAGLTIGETGAIAVNEYMETSDPDIYALGDCAENTNLLTGKKVFAPMATYANRQGRV
    VGDNVTGRKSTFKGILGTGVLHCMDMNVARTGLGEVQARALGYDIETITVATFDMTHYHPNSNKIVLKMIAEKGTQRILG
    IQGLGKGEVAKRADVVAALIQYGGTLDDLLNVDLGYAPPYNTPIDPMVHAGNALKNKLEGIANTYTPAEVQAKLEKGDDF
    VLLDVRTAQQFNMRYIEDERTKQLALGELRQKLAEVPKDKEIVTV
    CVMGSRAYEAARILEGAGFNNVKFMEAGMEGWPFD
    MEDF

    >gi|134298935|ref|YP_001112431.1| putative oxidoreductase [Desulfotomaculum reducens MI-1]
    MAKQIIPKKHPMPHQDPKVRAKNFDEVALGYTEELALAEAERCLKCKNPMCMKGCPVSVDIPEFIAHVKERKYEEAAKVI
    KRTNALPAVCGRVCPQENQCEKFCIVGKKNEPVAIGRLERFVGDYMVNKEAEIEKAEATGYKVAIVGSGPAGLACAADLA
    RLGHSVTMFEALHTPGGVLMYGIPEFRLPKAIVQKEIQNLKKMGVEIETNAIVGQIASLDELLQEEGFDAVFLGTGAGTP
    YFMNLPGENYNGVYSANEFLTRSNLMKAY
    CFPQCDTPIKVGKKVAVLGGGNVAMDAARTALRLGAEDVYIVYRRSRAELP
    ARLEEVEHAEEEGVQFLFLTNPTKYVGSEEGWLTGLQCIKMELGEPDASGRRKPVPIDGSEFVLPVDVAIVAIGQGPNPL
    LTKTTPDLETNKRGNITADETGKTSKEGVYAGGDVVTGAATVIKAMGAGRVAATSIHEYLMGKGPKKN

    >gi|134299105|ref|YP_001112601.1| SirA family protein [Desulfotomaculum reducens MI-1]
    MLKEINNRGLACPHPVINTKRALEEIEQGTVISIVDNEVALENVKRFVENAGYQVKVEENSGEFYITIIKGEGTDPVEVV
    PVVCETGSMVYLFTSNTFGNGAEDLGEILMVSFFNSLLEKPAPRMIILVNSGVRLAIQQSRVLEQINKLVEQGTEILA
    CG
    TCLDYYKLKDQLAVGRVTNMLEILENLTGRDKVITI

    >gi|134299190|ref|YP_001112686.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MGNIQTDKKITGAVMVVGGGISGMQSSLDLAESGFKVYLIDEKPAIGGTMARLDKTFPTNDCAMCIMSPKLVDTGRHKNI
    EIITGAKIKDVDGEPGNFKVKIHQKARYIDIAKCTGCGDCARACPVELPNEFNGNIDTRKATYKLYAQATPNAFAIEKKG
    VAPCKAACPAGVNVQGYVQLVKSGKPVDAWKMIYKEMPFPAVLGRICAHPCQTACNRAKIDDAVQIKNLKRFAADVAYAN
    LDKLPLPEKAEQREEKVAVIGAGPAGLSCAHFLALKGYQVTVFEALPITGGMMRVGIPEYRLPKKWVDLEVDLVKRLGVE
    IKLNTALGKDITIDELFKQGYKSIFLGVGAQKGLQLNVPGSDSDGVYTAVEMLRQVGLGEKVRVGKKVAIIGGGNVAMDA
    ARVSRRLGAEVHVLCLESEGQLPADIEEIHEAIEEGISFHYAQSVQKIKNKNGKVSGLVTANVTSLFDTEGRFAPQCGDK
    VIHWDGFDGVVIAIGQTADLSFAGDKPLVNERGNRLVADPDTLATQVEGVFAGGDAFTGPRLLIDAVGAGKRAAESIHRY
    IQGEDLKAGRAFKIPQEEISPLRQKPNEIPVETALAQGYAAADVRASNFEEVALGYNEEQAKAEAERCLNCAVCSECMQC
    VEACLPKAINHDMQDQELEIEVGALVLNPGFKPYDPTDLRLYGYGKYPNVVTSIQFERILSASGPFAGHMVRPSDHKEPT
    KIAWIQCVGSRNERIGNGFCSSVCCMYAIKQAMIAKEHSHDPLDTTLFYMDMRTPGKDFERYQNRAKEEHGINFVRSRIY
    EISPANDESDDLIIRYADEDGSIHYETFDMVVLSIGLAPPAGAKDLGHAAKLELDQYGFCRSKEFTPGCSSRPGIFVSGA
    FGEPKDIPETVVDASAAAAMASRLLAPARGTLTTKQEFPPEKDVVNKAPRVGVFVCNCGINIGAVVKVSEVAEFAKTLPG
    VVHTEEFLFTCSADNIIKIKERIGEHDLNRVVVASCTPRTHAPLFQSSMKEAGLNPYLYEHANIREQSSWVHRDRPQDAT
    EKAKDLVKMAVAKVRLLKPVQTAFIDVNQRTLVVGGGVAGMTNALSLAEQGYPVTLVEKTDVLGGHARELRYSLTGEDIP
    AFIAKLKSDVEANLLINIELNAEVDEVSGYLGNYVTTLLKNDGTRIEVKHGAVIVATGADAMAPTEYLYGSSPAVLTQTK
    LEQKLAETGLGEAKTVVMINCVGSREPERPYCSRVCCTHAIKNALKIKEINPDANVIILYRDIRTYGFKEEFYTEARRKG
    VIFIRYNVDDKPEVRASGDKVLVTVTDHVLQQKIKIEADILALANGIQPRPDIDRLSQLFKVPLNADGFYLEAHMKLRPV
    DFAADGLYLCGTAHGPKNINETISQANAASIRAVTLLSKGRLESLGITAEVDTELCKGCGICVSACVYGARVLDERKGIA
    LVREVLCQGCGACVAACPSGATQQKGFEKQQLLAMMDAALG

    >gi|134299191|ref|YP_001112687.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfotomaculum reducens MI-1]
    MTDQKYFGSVLVVGGGISGMQSALDLAESGYRVYLVEKKPAIGGTMARLDKTFPTNDCAMCTMSPKLVDVGRHLNIEIIT
    GAELIGLEGEAGNFKAKVLQQARCVDISKCIGCGACAEVCPVKVQDDFDAGLGQRKAIYKLYAQATPNAFAVDKTKCLKI
    KNPKACGKCAKECPAGAIDHAMADTTLELEVGAVILSPGFEPMDGDLRGEFGWGIYQNVVTSLQFERLLSASGPTMGHLV
    RPSDHVEPKRIAFLQCVGSRDKAKGNPYCSAVCCMYATKHAIIAQEHEAGLETKIFYMDIRAYGKDFEKYYDRARIQHGV
    KYEKAMISSVKEDPQTKNIIVKYRNPDGSFNEEQFDMLVLSVGLKPSAGNQKLAEACQIQLDDFGFCKTVEFSPGLTTRE
    GVFAGGAFCAPKDIPETVVDASAAAANASRLLSQVRGSLSKKKEYPPERDVTSEDPRVGVFVCNCGINIGSVVRVPEVAE
    FAKTIPNVVHSEEFLFSCSQDSIEKIKERIKEHQLNRVVVASCTPRTHAPLFMSSLKEAGINPYLFEQANIREHSSWVHR
    DNPAAATEKAKDLVKMAVAKVKLLKPVYTSFMDINRKALVIGGGVAGMANALNLAGQGFQVILVERTDKLGGHALDGRYT
    MKGNNPAELAAKLAGEVQIHPNIDLNLNSTIKKVAGYLGNYKTTLTTPAGERDVEHGVVIIATGADQATTSEYLYGQHEA
    VCTQRELEHKLDGSGIGGAKTVVMIQCVGSRDENRPYCSRICCYNAIKNALKMKELDPTVNIFIIYRDIRTYGFYETYYA
    EARRKGVVFIRYTLDNKPRVEPRSNGLKVHVKDPILNKILELDTDLLVLSTGIEPAKGTDTLSQLFKVSLNADGFFSEAH
    MKLRPIDFAADGLYLCGLAHSPKLIDESIAQANAAAVRAVTMLSKDKLESLGNVAMVNPKWCKGCGLCIEACSYGARVMN
    EMTHVAEVLDVLCQGCGACVAACPSGACQQKGFEKQQIIAMLDASNS

    >gi|134299385|ref|YP_001112881.1| heavy metal translocating P-type ATPase [Desulfotomaculum reducens MI-1]
    MDKGGITVQKTHADKQKEQCGCGCEGKRINPTRGFSMGKINYKSALTKDFALPSSPFITEEKADQKKTELRLSGLDCADC
    AAKLERKIQALPGVAEAKINFGAGKITVCHTTPAETILQAIKTAGYQGRLANEARKPPKQSVFEDTKLVLTGFSGLMVAV
    GFFLSFSNISETLVNGVYLAAILSGGFYTARSGLTSLKSVSLDMNFLMTVAVVGAVAIGEWAEGATVVFLFALGNTLQAF
    TMEKTRNSIRALMDLSPKDALVLRNGQELRLPVEELRIDDIIIVKPGECIPMDGEVVAGTTDVNQAPITGESMPIEKTVG
    HEVYAGTMNGHGAIEVKVTKLVEDTTLAKIINLVEEAQAQKAPSQQLVDVFAKYYTPAVVIGAVLIALVPWLFFAQPFQL
    WIERALILLVISCPCALVISTPVSIVAAIGSAARKGVLIKGGAYLEEAGSLKVIAFDKTGTLTRGRPEVAAVIPVDGVSS
    QRVIELAAAIEKRSQHPLAEAILRYAKEKEIKVPIGTEFQSFTGKGAAAIVDGMVCYIGNSRLFEELNLFPAPLQEQITV
    LQNQGKTVMILGSGHEVLGLIAVADQIRESSRAAVAGLRQAGISQLVMLTGDNTGTARIIAQELGIDDYRAELLPENKLK
    AIQQLQQEYGKVGMVGDGINDAPALATAAVGIAMGGAGTDTALETADIALMADDLSKLPYAMHLSKQTLRIIKQNIWFSL
    AIKAVFIAATFLGFANLWMAVFADTGAALLVIANGMRLMKVEDPYTRDSLDSRKLSSQTCTSV

    >gi|134299391|ref|YP_001112887.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfotomaculum reducens MI-1]
    MKKNILFLVIIIAIAAGVFIYRNYQEDELVGQVSQSDSVTTGQTEQKELTKEDKTMAPDFKLKDLSGKEFSLADFREKIV
    LINFWTTW
    CPYCIVEMPEIEKTYQKYKDKGFVVLAVNLTDQEKNPQDPVKFIAEKGYSFPVLLDEKGEVSLQYAIRSLPT
    SFIIGPEGEITEAKIGPFAPMELETKIKGLLKE

    >gi|134299590|ref|YP_001113086.1| thioredoxin reductase [Desulfotomaculum reducens MI-1]
    MLEKELVIIGGGPAGYAAGLYAARADINSVLIERGMPGGQAAATEWIENYPGFPGGIGGIELAMKMDEQARSFGLEVTMT
    DVSKLELQGSEFIVFTGQETIKTKTVIVASGSKPQFLGVEGEGKFHGRGVSY
    CATCDGAFFRDKTVAVVGGGDAAVEEAL
    FLTKFAAKVYIIHRRGELRATKLIQKRAMANDKIAFLWHSVVDDILGDSKVESIRIKDVRTDELSTIPVDGVFIYVGTRA
    NSELIKDLVEMDSRGYILANEKMQTSVPGLYVAGDVRQKSLRQVVTAVADGAIAAMEVEKYLASLEE

    >gi|134299603|ref|YP_001113099.1| thioredoxin-disulfide reductase [Desulfotomaculum reducens MI-1]
    MNEMNIVSEYDIAIVGCGPAGLSAAINAVIRKKKIGVFGTEFCSPKLHHAPHVDNYLGFQHITGEDLRLKFLNHAKDMGI
    TINKNKVTGVFPDKKGFTLQSRDKFYLAKSVILATGVSTLKPIEQEIEYLGRGVSY
    CATCDGPLYKGKKVIVLAYNREGL
    EEANFLAELASEVILVSLVKEKDSQGIRLSDNISRVNGKPQAIIGEMWASGVALENEKIYADGIFIIRESVLPDQLVPGL
    EVSQKGILVERSGATNIPGIFAAGDCIGAPYQLSKATGEGQVAALSAVKYLDEFNYSNKEEAEKVSASV

    >gi|134299985|ref|YP_001113481.1| heavy metal transport/detoxification protein [Desulfotomaculum reducens MI-1]
    MSEIVLKVDGMSCNHCKMAVEKAAKAINGVENATVNLEQKEVVVTGSVPKEEIVKAIEEAGYDVIG

    >gi|134299986|ref|YP_001113482.1| copper-translocating P-type ATPase [Desulfotomaculum reducens MI-1]
    MENQTQVTEKNNLATCTIPVTGMTCAACSARVERGLKKLQGVAGANVNLAIEKATISFDSNQTKVEDIITKIQTLGYDVP
    VETLELVISGMT
    CAACSARVEKRLNALPGVQEAAVNLATNKATVKYISGLIHATEIRKTVEKLGYKAQRANDLSQDQEGK
    ARQKEIRYQILKFVLATVLSLPLAWMMVTEVLGWHQFMIDPWIQLALATPVQFYAGWTFYRGAYYALKSGGANMDVLVVL
    GTSVAYFYSLIAVLQGWKTLYFESAAIVITLILLGKILEAIAKGKTSEAIKKLMGLQPKTARVVRDGEEVDTPIDEVEVG
    DTILVRPGERIPVDGVVLNGLSNVDESMLTGESIPVEKGPGDEVVGASVNKQGSFTFRATKVGKDTALAQIIRMVEVAQG
    SKAPIQRLADRVSGIFVPVVIVIAALTFLGWYSTGATITEALIHMTTVLVIACPCALGLATPTAIMVGTGVGAEKGILIK
    GGEYLERAGRLDTIVLDKTGTITKGEPSLTNLFVLAPFQENEVLQAVASGEKKSEHPLGQAIIQEADERKLPLMETAEFE
    ALPGKGIRFKLDNNLWYIGNEALAHSLHIDLSPVRAEKDKWEEDGKTVMIAVAGDDLAGLVAVADAVKENAREAIAELKE
    MGLEVYMLTGDQRRTALAIAKQVGIDHVIAEVLPAHKAKEVENLKGIGKVVAMVGDGINDAPALATADVGMAIGTGTDVA
    IESAAITLMRGDLRAIAAGIRLSRQTLRKIRQNLFWAFIYNVIGIPLAVFGLLTPVMGGAAMAFSSVSVVTNSLLLKRYN
    PSI

    >gi|134300073|ref|YP_001113569.1| arsenate reductase and related [Desulfotomaculum reducens MI-1]
    MNIQIFGIKKCFNTKKAERYFKERRIKYQFIDLSIKGLSQGELKSVAAAIGLNNLIDTQSKDYKKLCMDRIIGSSVREEL
    LLNNPGLYKTPIVRNGKKATVGYEPEIWGIWE

    >gi|134300504|ref|YP_001114000.1| thioredoxin domain-containing protein [Desulfotomaculum reducens MI-1]
    MADILRALDPDNFDEVVYEADNPVVVMFGAERCHVCQEVKPGVESLAENYKDQAEFCWVDVDAHKSLLERFRLKGIPQVL
    FFNEGELNAKLGGLREEEELEEKLTELL

    >gi|134300505|ref|YP_001114001.1| thioredoxin reductase [Desulfotomaculum reducens MI-1]
    MSNTTHDIIIIGAGPAGLAAGIYGARAKLRTLIIEKGAIGGMASNTREIVNYPGFKQTSGTALTKEMAEHAKEMGTEIIK
    GEVKTVDLSGEIKRVVTRKKQEFTARAVILATGTLPRVLGIPGEKELRGNGVAY
    CATCDAEFFEGQHVVVVGSGDQAIEE
    GMFIAKFANQVTVIVLHDEGKLDCNRLSAEKALHHPKLKFVWNSTLTAVQGDEEVTGVQVKNIKTGEMSEIPCQGVFFFV
    GMIPATHFLKGQVELDDRGYVMVNDLLETSVEGVFAAGDLRPKYLRQVVTATADGAAAVVAAERYLQEKENLRTTVLEAE
    KPVILAFWSPEDQASLQAVSRVEKVVSELPNEYLFVKTDVTRQRMLAKKYQVTTLPRVFVLNKGEVVQTIDTDAEVDDIK
    EILKALIQQA

    >gi|134300665|ref|YP_001114161.1| dihydrolipoamide dehydrogenase [Desulfotomaculum reducens MI-1]
    MTNETFDVVVIGGGPGGYTAAARAAALGGRVALVEKEALGGTCLNQGCIPTKTLLKSTEVLETVKKAKDFGVEVGVPEVA
    LEKLINRKQAVIKRLNTGVEFLMKSGKISVFQGEGKITGANEITVSNPSKQVILRTQKIIIATGSRPAVIPGLETDGEKI
    INSNHALMLSDVPGSLLIIGGGAIGVEFASIYHKLGAKVTLVEAMDRILPFADEEVSNGLKQLMTREKISILTSAKVSGV
    NNSEEGLLVNVDTPKGIQEFRVDKVLVAVGRRPNVENLGLEEIGIQIERGRIVVNTYMETNVPNIYAVGDATGGILLAHV
    ASTEGIVAAANAMGGHKEMDYAVVPSCIYTSPELASVGITEAQAKEQGIQVVVGKSQFTGSGKALAMGENKGLVKIIADV
    ENGKILGVHILGPQATSLISEATLAIKLGATAEDMAETIHAHPSLPETVMEAAEQVVGLLKTI

    >gi|134300686|ref|YP_001114182.1| hypothetical protein Dred_2853 [Desulfotomaculum reducens MI-1]
    MIKTEQKSNRLINEKSPYLLQHAHNPVDWYPWGNEAFDMAKRVDKPIFLSIGYSTCHWCHVMERESFESEEVAKILNEHF
    VSIKVDREERPDIDQIYMNVCQSLTGSGGWPLTIMMTPDQKPFFAGTYFPKQAQYGRPGITEILENVASLWKNERQHLLE
    VGDKLVSHMQSEASTAPGQLPADILDKAYHIFAQNYDATYGGFGTAPKFPTPHNLMFLLRYWHKTGEAKALSMVEETLDA
    MHRGGIYDHIGFGFSRYSTDKKWLVPHFEKMLYDNALLALAFTETYQITGNPRFGRVAKEIFTYILRDMTSPEGGFYSAE
    DADSEGVEGKFYVWRPEEVISLLGQVDGELYCQYYDITSTGNFEGESIPNLIGQDPFKFSQDLEITLGDLVEGLEACRKT
    LFEERAKRIHPYKDDKILTAWNGLMIAALARGAQVFQSKRYLEAASNAMGFIFDRLQRNDGRLLARYREYEAAYPAYLDD
    YAFVIWGLLELYQATFEPRHLQNAVYLTDDMIDLFYDDKQGGFYFYGKDSEQLISRPKDIYDGAIPSGNSVATVNLFKLA
    RLTGNSRYEELANQQLQVFADELARYPAGYSFFMMGAYLQQEPPMEIVIAGTKEDPSLQQMINTLRQNFLPNASVLVRYD
    DEFANKWSPLLPLLKDKTPVNGKAAAYVCQNLACQAPLTEPEALQKMIGK

    >gi|134300756|ref|YP_001114252.1| methylated-DNA--protein-cysteine methyltransferase [Desulfotomaculum reducens MI-1]
    MQVQLIATSQGVSAAAWQNGLLEGVTLPHSCKETALATLCGYVKEKLSEKNICCDLTSLQKDFEKNMVLYFAGKPAGFNV
    PLNWEKLTPFQQRVLSIVQQIPYGEALSYGEIAELAGCRGGARAVGGAVGANPWLLAIP
    CHRVLAAKGGLGGFGCGREWK
    EKLLQMEKIQYKPSGS

    >gi|134300799|ref|YP_001114295.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum reducens MI-1]
    MTKKVLIVGGVAGGASAAARLRRLDEDAEIILFERGEYISFANCGLPYYLGGVIKERENLLVQTVQGMQERFNVDIRIKS
    EVTKILRETKEVEVLSQGKTYRESYDYLVLSPGADPILPPIPGIQREGIYTLRNMADVDRIKSLLEEKKPKRAAVVGGGY
    VGIEMAENLKHAGLDVVLIEAAEQVMGPLDVEMARIVEKELMDNGIRLVLQDAVQRFQGEREIEIILGSGKQEQVDMVIM
    AAGVRPETKLAKEAGLEIGERGGIRVDEHLRTSDPAIYAVGDAIEVKDRISGEYAIIPLAGPANKQGRIVANNICGGTDQ
    YLGSLGTSIIKVFHVTAAAAGNNEKILRRAGIPYLKSFTHSGSHAGYYPGAFILTIKLLFSPEDGKILGAQIVGREGVDK
    RIDVLATAIKHGLTVYDLEELELAYAPPYSSAKDPVNMAGFTAANILKGDVKILHWEDLQSLNRAEYVILDVRTKEEYEN
    GSFEGSIHLPVDNIRQRLDEIPKDKKIIIY
    CKVGLRGYIAYRILAQRGYDVYNLSGGYEIYLAEEYKYAEGIDLDEQMTK
    FEQIPAPAEMQGKTIRVDACGLQCPGPIMRVYQEMEKIQEGEILEVQATDPSFPRDVKAWSARTGNTLLQTETTDKGYRV
    MLKKGSTQPQACGNDQKPLDIPHGKSLIVFSSDLDKAIASFIIANGGASMGRKVTMFFTFWGLNILRKDVVTGVNKNFME
    RMFGWMMPRGSKRLGLSKMNMAGMGPTMIRNIMKKKNIASLEELIQQAQKSGVRLVACTMSMDVMGIKAEELIDGIEYGG
    VASYLAEAEESDVNLFV

    >gi|134300814|ref|YP_001114310.1| heavy metal translocating P-type ATPase [Desulfotomaculum reducens MI-1]
    MDIHKVSLKILGMECAACAAKVERTLKKLDGVTEVSVNLAVEKVTVNFQPNRVGIDQIIKTIVDLGYQVPTEKVDLKISG
    MT
    CAACAARVERALGKREGVLRANVNFAMERAAVEFDSTVVTVTELKRTVADAGYQAEEGAKCFDGDHEKRERETRKQIR
    LLIMSAVLSLPLLAVMFAELFNFPLPMLLHNKIFQFALATPVQFIAGFQFYRGAYRSLRHGSANMDVLIALGTSAAYLYS
    AGATFFYPGHVYYETGTIIITLIILGKMLESIAKGRTSEAIKKLMGLQAKTARVVRNGQEMDIPVEEVQVGDLVLVRPGE
    KVPVDGVMKEGFSTVDESMLTGESIPVDKKIGDEVIGGTINKHGSFKFEATKVGSDTALAQIIKIVEEAQGSKAPIQRLA
    DIISAYFVPAVVGIAVVTFAVWYFFADPGNLARALINFTAVLVIACPCALGLATPTSIMVGTGKGAENGILIKGGEHLEK
    AHALNAIVLDKTGTITKGEPSLTDVITIDKGISEDELIRLVASAERGSEHPLGEAIVKGARERGIELAEPQEFEAIPGHG
    IASRIGENIVLIGNRRLMYSQNIDISRLAKQVDALEEEGKTAMLVAVGGRATGIVAVADTVKETSAEAIRALRDMGIKTL
    MITGDNRRTAEAIAKQVGIPPEDVLAEVLPQDKAKEVSQLKESGEVVGMVGDGINDAPALATADVGFAIGTGTDVAMEAA
    DITLMRGDLRGVAASIKLSRATMCNIKQNLFWALIYNTLGIPVAALGFLSPVLAGGAMAFSSVSVVTNALRLKRFDPYRD
    FRREEKKVPHRLIPEPARRPE

    >gi|134301062|ref|YP_001114558.1| OsmC family protein [Desulfotomaculum reducens MI-1]
    MNNILLENVQQTMNAIKADPEVGKKNFSARINWQDGVQNQASIGEFPPLLMDEPQPLGGMNKAPNPVEYLLAAAVGCFAI
    TFEVLASQRGIALEKVEAQIEADIDAAVFLGIKEGHGGIQNPTIKLRAITTATEQQVKEIAQFALRKSPVLLSLQAEINL
    VTE