Desulfotomaculum acetoxidans DSM 771 uid59109

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|258513709|ref|YP_003189931.1| Peroxiredoxin [Desulfotomaculum acetoxidans DSM 771]
    MDSMSESFRMPLIGDDAPVFTAKTTMGDINFPADYKGKWVIFFSHPADFTPVCTTEFMTFATMQEELKKLNTELIGLSID
    SIYAHIAWLRTIKDKIEYKGMKNVEVLFPLIEDLKMDVAKKFGMVQPNASTTQAVRAVFIIDPNSKVRAILYYPLTTGRN
    MEEIKRMIIAMQKSDSDGVATPANWVPGDDVIIPPPGSCGSAKERMESQEEGKYCLDWFMCFRKEK

    >gi|258513723|ref|YP_003189945.1| methionine-R-sulfoxide reductase [Desulfotomaculum acetoxidans DSM 771]
    MKDSIDLGRDEFATFAGGCFWCMVRAFQETAGVADVISGYTGGCKENPTYEEVCTHTTGHYEAVQVRFNPVVVSYEKLLE
    VFWRQIDPTDPGGQFFDRGSPYQTAIFYHNEEQKQQAESSKKALIESNRFDKPVVTLILPAATFFPAEEYHQDYHQKNPL
    HYNQYRRSSGRDAFIEKYWEDKRSKDKEPLKQRLTKLQYEVTQNNATEPPFRNEYWDNQREGIYVDIVSGEPLFSSIDKF
    NSGCGWPSFAKPLNAKNIKEEIDLSHGMKRTEVRSQAVDSHLGHVFQDGPTPTGLRY
    CINSAALRFIPKENLLKEGYDEY
    LSLFNFER

    >gi|258514182|ref|YP_003190404.1| selenide, water dikinase [Desulfotomaculum acetoxidans DSM 771]
    MDVNLTSYSPGSGCACKIGPADLLELLSGLPKVVDPKVLAGREDNAAVYKVSNDLAVVQTVDYITPVVDDPYQYGMIAAA
    NAISDIYAMGATPAFALNIVGYPNQSLPLSILGQILKGGADKAAEAGIAIIGGHSITDHAPKYGLVVTGFVNPSRMISKK
    GAKPGNALILTKPLGIGVITTGIDRKLVNNELIGRVTKQMTTLNKQAAEIMQEVGVNACTDVTGFGLLGHLREILIASGT
    GACITASKVPIIPETEELIQAGAVSGGTHNNYRYLRDLVEWDTRLSKEVKLILCDPQTSGGLLIAVPQENKNKLLKALQS
    KEEVLTAVEIGEVVEGPGQVSVVV

    >gi|258514501|ref|YP_003190723.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum acetoxidans DSM 771]
    MPGENNSYEIAIIGCGPAGLSAAVNARIRRKTFVIFGGEFCTPKLHSSPQVDNYLGFPKVKGEDLRKHFLRHVKEMEINI
    NSVRVSAVYPQAEGFELVAGEHNYNAKSVIIATGVTAAKLFPGEKEYLGRGVGY
    CATCDGPLYSGRTVAIIGYIKDALKE
    AKYLSELCHKVYFLPLFEEQVGSLQQNVEIIKDQPVRINGQQTVTELQTEGRRIAVNGVFIYRQTILPDQLVPGLEIEGS
    AIKVNRSLETSIKGIYAAGDCTGSPYQLAKAVGEGAVAALHAADFLG

    >gi|258514560|ref|YP_003190782.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MSTSKPVTGSVLVVGGGIAGIQASLDLAESGFYVYLVEKTPAIGGVMPMLDKTFPTNDCSMCILSPKLVECGGHLNVDVM
    TTSVVQDIKGEPGNFTVTILKKARFIDPLKCTGCGSCVEVCPKKVTDEFDQGLRDRRSIYKPYAQAFPNAFAIDGSSCLK
    IKKPKACGKCLEVCQAGAIDHTMQDEIVEINVGSVILCPGFEKFDAKLLSYYGYGKFAGVVTSLEFERLLSASGPFGGHL
    IRPADEREPKKVAWIQCVGSRNEKEGCGYCSAVCCMYAIKEAVIAKEHAHYPLDTTIFFMDMRTYGKDFEKYYNRAKEEH
    GVKFVRSRIYEVTENEDKNLVIRYSNEDGTITTDVFDMVVLSIGLKPNSDMVELANKVGIELNKYNFCEAKELTGVETSK
    EGIYVAGAFSGPRDIPETVIEASAAAGACAVQLASARGTLIKTMEYPEEINVYGEIPRTGVFICHCGINIGGVVNVPSAV
    EYAKTLPGVVYAQESLYVCSQDAQVQIKEKIAEYNLNRVVVASCTPRTHEPLFQKTLHEAGLNPYLFEMANIRDQCSWVH
    MHEPEKATVKAKDLVKMAVAKAQLLTPLYEQELDMDHGALVIGGGVSGMTNALNLAEQGYKVSIVERTEKLGGIANRITT
    GFKGEDIKGFVANLASKVNNHANIDVYLNSDLADVHGYLGNYLTKLTDGQEIKHGVTIIANGGMEYKPTEYLYGENDRVI
    TQLELEEAMVSGDAKVKDAKNFVLINCVGSRDNERPYCSRVCCNKSIKLALKIKEKNPDANVFVLYRDIRSYGFFEDNYR
    EARCKGVIFIRYSVDNKPVVEAVGDVIKVTVTDHVLGQPLEIEADIICLAAAIVPQKDNGKLSQFFKVPLNADGFFLEAH
    LKLRPVDFSTDGVFMCGLCHGPKSTEENVAQAKAAAARAGTALSKENVQAEGKIANINNKKCAGCGVCELVCPSKAIAVD
    TEKMIAVVNEALCKGCGACASSCRCGALNIKGFTNEQIVAMISAL

    >gi|258514618|ref|YP_003190840.1| thioredoxin reductase [Desulfotomaculum acetoxidans DSM 771]
    MDNLKDLIIIGGGPGGLAAGIYAARADLKTVLIEKGVPGGLAATTEFIENYPGFSEGISGPELAMNMESQAKRFGLEVIY
    DYVEELKPLNNNFAVKTGSGELYARAVILATGASPQLLGVRGESTLHGRGVSY
    CATCDGAFFRGKKVAVVGGGDAAVEEA
    LFLTKFAEEVFIIHRRGELRAAKIIQQRAKDNPKIKFIWHSVVEEISGSSAVDAVKLKDVRTGEFSDLEVGGVFVYVGTR
    PSSELVKDLIELDSRGYIMTDEDMKTSHAGIFAVGDVRQKTLRQVVTAVADGAIAAVAAEKYLEEL

    >gi|258514628|ref|YP_003190850.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MKNEEKTVGAALVLGAGIAGMQSAQDLANAGYLVHLVTDSPSVGGKMGQLDKTFPTNECAMCMLGPVMNETMSHPNIKLH
    TVSKLIDVEGEAGNFQVKIKKAPRYVDVEECTACSDCEQVCPVELPNKYNQGIGTVKAVYKLFPQAVPNKYLIDKKGTPP
    CREACPAGINVQGYVQLTKVRKFDEALALVHEKNPLASICGRICTRPCESACNRGKADDPVAIKNIKRFLADRILLGDNP
    APEITVKKNKKIAIIGAGPGGLAGANFLALKGYQVTIFEALPVGGGMLRVGIPEYRLTKDIIEAEIARIQKMGVEIKYGQ
    ALGKDFTLESLKEQGYEAVLLAIGCQKGTTMNIEGTDLNGVMNGVDFLRKVNLGEPVVVGKKVVVVGGGNVAMDVVRSAI
    RLGAEEATIVYRRSQDEMPADHEEIEHALEEGINLAILTNPTKLIGDKGSVVKIELQKQALGEPDASGRRRPVPVEGSEY
    LMDVDTVIMAIGQAADMNGVSDSIVGSGKIVVDKNSMATGMAGVYACGDVVTGPATAVEAIAAGNKAANAIDYYLEGGKP
    EEFKFEFFQEVPPSENPFVMPEDIPFENRPKMPMISAEKRKTNFDEVELGYTEDMAVAEAERCLNCGGCCECLQCVDVCK
    KNAIDHNAREEIVDLNVGSIVLVPGFDLFDAKLKGEYGYGIYPNVITSIEFERFMSPTGPKGGHIYRPSDHKDPIRVAFI
    QCVGSRDCNNGSEYCSSICCMYSTKEAIIAKEHDNRIEATIFYLDIRSYGKNFDKYVNSAKESGVRYVRSMISKIKEDPA
    TNNLFIKYIADGEIKEEEFDLVVLAIGVLPPKEAQLLSKTVGFELNEYGFAKTDMATPTKTTRDGVFVAGAFQGPRDIPE
    TVVNASAAAGSAGGLIASARGTMVKGKDYPVEIDVLGQEPRIGVFVCHCGINIAGVVDVEKVVEAAKKMPGVEFANNYLY
    TCSEDTVKSIGDLIKEKGLNRIVVASCTVRTHQALFREGLKLGGLNQFYFEMANIRDQCSWVHRDNPERATEKAIDLVKG
    AIGKVKYHDPLYLEPSPVVQKALVVGGGIAGMTAALSFAEQGYPCYLIEKEKELGGTMKHIYTNLTGENMQEHLNETINK
    VKNNPLIEIYTEAELYDFHGHKGNFVSTINQAGAKIDLSHGVAVVATGGKEKTPQEFLYGANDKVITNQQLESLLNTGKF
    DPASKQVVFIQCVTTPEIDGLKYCSRTCCGQSVKNALQIKKQNPNTQVFILHRDMRTYGYMEKYYKEAREIGVIFVPYDS
    KKDIKVNSAADGKLSLQVLDAASRTVLKLNPDILSLASSTEASEGVEGIANLMKLTLNEDGFFVETHAKLAPVDFPSQGI
    FLCGTAHSPKFVGEAISQAQGAVARACTILSKENLMVGGVVAVVDEDKCAACLTCVRTCPFGVPKINERHRAQIESVQCQ
    GCGTCVGECPNKAIQLQHYKDIQLIGKVEGMFYEINDSAS

    >gi|258514631|ref|YP_003190853.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MKRVGVFVCWCGSNIGGVVDVARLAAEAGKFPYVVHSVDYKYTCSEPGQKMIVDAIKEHRLDRVVIAACSPRLHEQTFRK
    TIARAGLNPYLLEIANIREHCSWVHSKEPEKATEKAIDLVRRAVAKVVNLEPLSESSIPITKRALVIGGGIAGIQTALDI
    ADAGHKVVLLEKEPTIGGKMVMLDKTFPTMDCSA
    CISTPKMVAVAEHPNIELLTCCEVVEVSGYIGNFTVKVKQKARFVD
    HTKCTGCGTCWEKCPKKVPSEFNLNLSLRKAIYIPFPQAVPNKPSIDAENCRYLTEQKCGVCQKVCPVGAIDYEQKDENL
    EIEVGAIVMATGYELFDWAKAYGEYGYGKYPDVITGLQFERMVNASGPTGGKIIRPSDGKEPKNVVFVKCVGSRDEAKGK
    AYCSRACCMYTAKHAHQVIEKIADAQAFVFYIDVRTPGKGYEEFYKRTTDEGAQYIRGRVSKILTSGDRLLVKGADTLMG
    RQVEVEADLVVLATAMIPAKTAQDTARLVGFSVDGDGFYQEAHPKLRPVETNTAGIFLAGTCQGPKDIPDTVAQASAAAV
    KVCVLFSRREMAADPMVAQVNQSICHGCLACQKVCPYKAIEAKTISERLGGQVIERTVAHVNSGLCQGCGSCTVACRSGA
    VNLKGFSDEQLLAEVDAICL

    >gi|258514656|ref|YP_003190878.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MRAVLVVGAGLAGTKAALDLAEAGFDVYMVEKLPFVGGTMPKLDKMFPTHDCLICTLSPSSMDMGCKLSLVNRHPNIRTI
    INAQILDFTGRPGDFQVTLNGTCSVPTEPLNSCKIGMDLKAFTVNVGSVILSPGFKVADPGELSYYKYGIYPNIVTSLEF
    EEILKASKTSEKAILRPSDYKPAQKIAWIQCAGSRNEKLNKGYCSSICCMFAIKEAMMVKECSAEIKTKIFSMDLRIHGK
    GYEKYHRKAEKDYRIDFVASRIFEINQIEESHNLGIRYAAEDGTLYYEEFDLVVLSIGMEPPEDALELSEIFGIALDRFN
    FAKTVDLTGVCTTAPGIFVAGAFAGPKDIPETIAQASACVAEVALAAGEEKYISGEPLPLTDNLPWNPRTGVFICTCNNQ
    LDSILDLRKIAEKLGADSVHIVSEICTREGKFAVQNIIKHEKYSHIIIAACGSRTSAFFMKQLVKECGLPESLLQIVNIR
    EQCAWVHANEPAKATLKAFEQIRMAFVKASMSTVLPVEFSHIVPAVLIVGGGIVGLTSALYLAKLGFRVHMVEKEAVLGG
    KVARIKVGLKGENISVHLQHLVNEVINQPNIKIYLKTQVKSHSGFVGNFKSLLSSGEVVRHAVTIIASGGQEYISDEYYC
    NQDPRVYTQLQLEEAIYKNDASVRKAKNIVMIQCVGSRDKDQRTYCSKICCTKSLKLALQLKEQYPDKNIFILYRDIRTY
    GTFEKYYSEARLKGIIFIRYNLNNKPVLEKTEENLKVYIDDHILGQKMEIEADIISLATGVAASAENPKLARIFSLPLED
    NGFFKEAHMKLRPIDFNTNGVFVCGLAHAPKSIEESIVQAKAAVGRSCTILYKDYLQSAGPVAVNNGKCAACLTCTRVCP
    YGIPRVINNKVFIDPVQCKGCGICTVECPHKAIELQNMSDEIMMAMIRSLFIPVEF

    >gi|258514880|ref|YP_003191102.1| hypothetical protein Dtox_1621 [Desulfotomaculum acetoxidans DSM 771]
    MNNKRLMVILTGGVLGLLAVVLVKYGNPPNMGYCIACFLRDISGGLGLHRADTVQYFRPEIFGLILGAFITALLTKEFKA
    TGGSSPIIRFTLAFTGMIGMLVFLG
    CPVRAVLRLAGGDLNAAIGILGLIAGVAVGIQFLKNGFTLGRSLPINKANGYIYP
    LTAAAMLVLVFAGANFLFYSTKGPGSMHAPLLLSTIAGLIVGVLSQRSRFCMIGGIRDFILFRDTHLLYGFLSLLIVAFI
    GNMVLGSVKFGFANQPIAHSDGLWNFLGMMLAGWSSVLLGG
    CPLRQLIAASEGNTDCAITIVGLILGAAIAHNFGLAASP
    QGVPLAGQYATIIGLATVFGISFFTCTQALTGGVKVGSTN

    >gi|258515000|ref|YP_003191222.1| cadmium-translocating P-type ATPase [Desulfotomaculum acetoxidans DSM 771]
    MQTVIDRPTTKYLLKGMACAGCAAKIEKLLQEQEGMHYTQLNFAAKSIYLKEEHVFRAQQIINSIEPGVELVPVNLQEKK
    YKLKGLH
    CTGCAAKIQSTLSKTGGLENSALNFAAGTLLINPQYFRQAQEIIDSIEPGVILEEINKPQEEKSNIKKPLTVM
    GIAFVLLATGLVFDDNLRNTRYTWAEYTVFLSAYFLVGWKVLLTAFRNIFKGNMLDENFLMTLATGGAIAIHLLPEAVGV
    MFFFYVGEFFQNLAVNRSRASIKALLDIKPEYANLKLNGNIEKVSPETVHTGDFIIIKPGEKVPLDGIITEGFSFFDTSA
    LTGESVPKRLKTGEEVLAGMINTSGLITIQVSRQYADSAVAKILDLVENAGSRKAPVEKFITRFSYYYTPAVVLGAAALA
    FVPPLVIPGAVFSDWLHRALVLLVISCPCALVVSIPLGYFGGIGGASKRGILVKGANFLDALTGVNTVVFDKTGTLTRGV
    FHVTDIKAQNNFSPEDVLKYAAKAEANSYHPIARSIMEAYDGNSPYEQAEAYEEIAGCGIKAKYKSQLIIAGNEKLLDLE
    NIPYERCVAEGTIVYIAVNGLFAGCITIADEIKEDSFSAISKLRKLGVKQVVMLTGDDETAAADVSSRLELDAVYSRLLP
    QDKLARLEKLMANLSIKEKLAFVGDGINDAPVITRADVGIAMGGLGSDAAIEAADIVIMDDQPGKVAVAIDIARHTKKIV
    LQNIIMALTVKGIFVALGSIGQANMWEAVFADVGVALLAVLNATRVLKHKENY

    >gi|258515016|ref|YP_003191238.1| alkylhydroperoxidase like protein, AhpD family [Desulfotomaculum acetoxidans DSM 771]
    MSALLDNKTRQLIAIGASMAANCVSCLHQHYNAAMAAGATVEEVIEAIKVGEAIKAQPSAQIKQEIAMLLNDKENLFPHH
    HHGKKSCGCGCN

    >gi|258515063|ref|YP_003191285.1| copper ion binding protein [Desulfotomaculum acetoxidans DSM 771]
    MGCSCNNNQTITINVEGMSCNHCKAAVENALKQIGVNKVEVDLAAKKVSASYSSDKLTLDDIKKSIIDAGYEVVG

    >gi|258515245|ref|YP_003191467.1| arsenate reductase and related [Desulfotomaculum acetoxidans DSM 771]
    MALTFYCYSKCSTCKKAKAWLNGKGITYQEKDIVASPPQAEEIKDLVALSGKELKKLLNTSGKSYRELGKEAVAAMTEEQ
    LLQAMQADGKLIKRPLLSDGQRLLIGFNEAKYEEFLKTIV

    >gi|258515308|ref|YP_003191530.1| heavy metal translocating P-type ATPase [Desulfotomaculum acetoxidans DSM 771]
    MIGENSMRAQSLPAENLVFKISGMSCAACARRIEKALSGIEGIAEAGVNLAAETASVKYDPNSVTVEQMMDRIKKLGFEV
    VTEKIDINISGMS
    CAACAGRIEGKLNKTGGVIKATVNLATEKAFIEYNAAQVNLADIKQVINNLGFKVVHEDSGLPVDTE
    KNRRQSEINRQKKLFAFSAVLSFPLFLFMLAMVTKSHHFFPAIIMNPYFQFALATPVQFGPGYFFYRDAYLTLKSKGANM
    SVLVALGTSAAYFYSVAVTFFGSRLGLNEVYYEAGALVITLVLLGKMLESIAKGKTSEAIKKLMGLQPKTARIIKNGQEV
    EIQVDEVRVGDLVVVRPGEKIPVDGIVREGISSIDESMLTGESMPVDKKTGDQVVAATINKLGTFKFEAIKVGRDTALAQ
    IIKIVESAQGSKAPIQRMADIISGYFVPAVVAMALLTFASWYLIGTPGDFTRALVNFTAVLVIACPCALGLATPTSIMVG
    TGKGAENGILIRGGEHLERVHKLNTLVLDKTGTITKGKPELTDIISLYEYQGQENTLLTMAAGAEKGSEHPLARAVINAA
    LERNLAIKEPEIFQAVPGHGVEAHIEGQKVLLGTKKLMLEHGVNVNKITSDIERLESQGKTVVILSIDEQPAGLLAIADT
    VKEESQAAIAALQAMGLEVWMITGDNQRTAHTIGQQVGISNILAEVLPEEKASEIKKLQSQGRIVGMVGDGINDAPALVV
    ADVGFAIGTGTDVAMEAADITLMRGDLWGLVNSIKLSRATIINIKQNLFWALIYNTIGIPVAALGFLNPVLAGAAMAFSS
    VSVVSNALRLKNFKFNH

    >gi|258515385|ref|YP_003191607.1| protein of unknown function UPF0061 [Desulfotomaculum acetoxidans DSM 771]
    MTEGKTKIKIGWNLDNSYARLPKLFFTKLNPTPVRSPKLIVLNYPLATSLGLNVKALQSNDGVAVLAGNRTPEGSFMLAQ
    AYAGHQFGHFTMLGDGRTLLIGEQISPLGERFDIQLKGSGKTPYSRQGDGRAVLGPMLREYIISEAMHALGVATTRSLAV
    VTTGESVIRETALPGAILTRVAASHLRVGTFQYASKWGTVEDLRSLADYTLQRHFPNIEVDENRYLFLLREAIKRQAVLI
    AKWQLVGFIHGVMNTDNMALSGETIDYGPCAFMDVYDPATVFSSIDTHGRYAYGNQPNIAAWNLARLAETLLPLLHDKQE
    KAVKKAQEAISDFAELYHHNWLAGMRAKLGIFNEEIEDESLVDNLLIMMQKYRADYTNTFRALTFDKPEDTDLFGNTDFA
    QWYELWQARLGRQQETKDSSHQLMRNSNPAIIPRNHRVEEALEAVAKQGDFSVMERLLDVLSRPYAHSPEQADYSTLPEL
    SSCPYRTF
    CGT

    >gi|258515471|ref|YP_003191693.1| thioredoxin [Desulfotomaculum acetoxidans DSM 771]
    MALEVNQSNFESEVLKASEPVVVDFWAPWCGPCRSMAPVIEELAKDFEGKAKIAKLNVDENQALAGQFGVMSIPTLIFFK
    DGKAVDTVVGFTPKNKIAEKINAII

    >gi|258515492|ref|YP_003191714.1| Thioredoxin domain protein [Desulfotomaculum acetoxidans DSM 771]
    MSHISDYFYKLTIIMSSHIIILAVARIPISFCKRKGASLLAVNALSISTDDEFEQLINNSQVPVIVYFWAEWCLPCKIIS
    PVIDTLVDEFAGKILIAKLDSDNCKEIVKHHKVYSIPTVMILKNGIETERLIGSRHRDELQRAILRNIK

    >gi|258515543|ref|YP_003191765.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum acetoxidans DSM 771]
    MKVVIVGSSAAGITAAETLRFLNKQVQITVISEEPDTAYSRCLLPEVLAGFKNLAGIRYRSADFYTKNNIDLRLNTKVAI
    IEPLNYSCKLEDGEVIKYDRLLIATGAAPVRPSGLGSELDGIFTLRSYRQTLKIGQAADTAEQVVVSGGGLVSLKGAYAL
    RQRGVQKVSVVVKSPHLLTRQLDEVSAAMIEKELTGMGIEFIFGLNQTGFEERKGTGKVAAVVLEDGSDLPAGLVLVGKG
    VTPNAGLLKNAGGQVNRGIVVNEFMETSIAGVYAAGDCIEVTDRLSGQRVSSALWTLAVEQGRCAAYNMLDIKRIYPNPL
    TALNSAQFGDIPFVSVGNALGSEESEIFTAQTGSRYCRLVLERDRLVGFILAGCIERAGVYTALVRKGSPVTNSLKSKLL
    NGTVCAADLMLF

    >gi|258515729|ref|YP_003191951.1| methylated-DNA/protein-cysteinemethyltransferase [Desulfotomaculum acetoxidans DSM 771]
    MRSIFFYQTDIGEIRIAENGTAITNLYFQEENIAEDFVVQETNLLKEAAEQLRSYLAGKRKKFALPIAPNSTEFMLSVWE
    ALRTIPYGETRSYGEIAQSVGKPKASRAVGLANNKNPIPIFIP
    CHRVIGANGKLVGYLGGLQIKEYLLELERLYGNF

    >gi|258515753|ref|YP_003191975.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
    MNKNDIKDMVRNKYSQVVKSPSGCCSGSNCCIPGNNINDVLNISKKLGYSDEQLKLGLGEANLGLGCGNPLAIEELKNGE
    VVLDLGSGAGFDVFLAARKVGPSGNVIGVDMTPEMISKARHNAASMGFSNVEFRLGEIEHLPVADSSVDVIISNCVINLS
    PDKQAVFNEAFRVLKPGGKIVISDVVRVDELPEEIRNNNEAYCG
    CISGAILQNELVSILNKAGFKNILVKNKANSEEIIN
    SWNFGQNIEKVVVSADIRAIKPI

    >gi|258515790|ref|YP_003192012.1| glutamate synthase (NADPH), homotetrameric [Desulfotomaculum acetoxidans DSM 771]
    MTEEKKSKKVVPTKYPMPHQDAAVRARNFEEVALGLDEETAVLEAQRCLQCKKEPCRKGCPVEVLIPDFIKLVAERDFAG
    AIKKLKEKNALPAVCGRVCPQENQCESYCTVGKKNEPVAIGRLERFCADWERTQGIEVPEIAPSTGKKVAIIGSGPGGLT
    CAADLAKLGHKVTIFEALHVAGGVLMYGIPQFRLPKEIVQAEIETLRKMGVEIEVNAVVGKFATIDELMKEEGFDAVYIG
    TGAGLPYFMEIPGENA
    CGVYSANEFLTRTNLMKGYKFPEYDTPIKVGSKVAVLGGGNVAMDAARTALRLGASESWIVYRR
    SKEELPARHEEAEHAEEEGVKFAFLTSPVRVISNDEGWVTGMECVKYELGEPDASGRRRPIAIKGSEFIMDVDTVVVAIG
    QGPNPLVPKTTEGLETNKRGNIVADPATGATSKPGVYAGGDVVTGAATVILAMGAGRVAAKSMHEYLSK

    >gi|258515871|ref|YP_003192093.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum acetoxidans DSM 771]
    MSKKIVIVGGVAAGPKVAARARRVMPDAEITVIEKSNIISYAGCGMPLYVSGHVRKLDELVSTSYGAIRNKDFFLNEKGV
    KVLTGTEALSIDRENKKVLMKDLATGVESYIEYDQLVLATGSTPINPPIEGLNLKKVFKLYHPDDAVALKEFLENADVEM
    PVIIGSGLIGMETADALVGKKLFPTVVELREQLLPGILDPEMAASLKTKLEDMGMEFALEHTVQKLEGDEDGNVTGIVTD
    KGTIDADMVLVAVGVRPNVELARKAGLTIGETGAIAVNEFMQTSDPDIYSAGDCVENTNIITGRKVFVPLASTANKQGRI
    VADNIAGKKSRFKGILGTAVLEIGGINIGRTGLSEQQALDAGFEIATAANANHDRTHYHNKHGQMILKIISDAKTGRLLG
    AQGLGKGDVIKRIDVLAAAITFGATLEDFYNIDLGYAPPFSTPIDMAAHTANTVRNKIDGLTASVSARELKEKLERGDDF
    VLLDVRTQQGYQSRHIEDKRGMLIPLHELRYRLSEIPKDKEIVVL
    CAMGGRSYEAACTLKGAGYNDVKYLETGFEGWPYD
    YD

    >gi|258515972|ref|YP_003192194.1| Peroxiredoxin [Desulfotomaculum acetoxidans DSM 771]
    MLVTKNAPAFTAKAFHQGQVKQVSLEEYQGKWVVLCFYPGDFTFVCPTEISHIAVGYDGLKSLNVEVLSISTDSVFSHKV
    WNETELSKMVEGGIPFPMLSDQTGKIGKLYGVYDEDAGVNIRGRFLIDPEGVIQAAEILSPPVGRNPEELIRQIKAYQHH
    KKTGEVMPSGWLEGDTTLKPSTQMAGRVWEVWQPPKK

    >gi|258516092|ref|YP_003192314.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfotomaculum acetoxidans DSM 771]
    MSIIMKYVILGASAAGINAAKTIRELDPNGEITIVSKDKAIYSRCMLHHVISQGRQPREINFAEENFFEKYNINWLAGQE
    VLGLNTEEKTVLLTGDLKISYDRLLIATGSSSFIPPIKNLAAAKQIFGLRNIEDAVAVNLAAENTGAAVVIGAGLIGMDA
    AYALADRGLEVTVIETAEHILPLQLDKTAAQKYEKLFRQNAVNFFFKETTVEIKLDQDNNVRGVVLQSGAFVHCGLVIVA
    AGVRSNIEFLKNTNVKIGRGIQVNSYQETSVPNIYAAGDVCESTETFTGQVSLTPIWPSAILQGRTAGSNMAAIPRQLEI
    NFAFKNSMTFYGLHTISFGLTGQADSDSKELIYQDAGNYKKIIFKDGVIKGAILQGDISNSGLIGKLVQDKTKISHPEQI
    FNMTYANFFAQKENGEFCFACNDNCH

    >gi|258516229|ref|YP_003192451.1| selenide, water dikinase [Desulfotomaculum acetoxidans DSM 771]
    MSNISPRLTQMTKTSGCAAKLGPEALSQVLRHIPFMTDPNLLVGTETADDAAVYRLNETTALILTTDFFTPVVDDPFIFG
    QIAATNALSDIYAMGGQPLLALNIVCFPNCLSTDILGLILQGGASKVIEAGAVIAGGHTVQDDEPKYGLAVAGLIHPDKV
    LTNAKARIGDVLILTKPLGTGIINTAIKGELAAPEAEKKAVETMTELNKAAAQAMQATGVHACTDITGFGLLGHAAEMAR
    GSGLSIQIDSSSVLFLPEVKNLASMGMIPAGAYHNKNYLAEDVYIKPSVDDITGFALYDPQTSGGLLIAVEEEKKDLLME
    NLSRNGVQEFAAIGKVVDRKDCLISVA

    >gi|258516494|ref|YP_003192716.1| methylated-DNA/protein-cysteinemethyltransferase [Desulfotomaculum acetoxidans DSM 771]
    MFYLSMETAWGWVCAAWSAEGLAAVTLPEKNPSESHEFLTNKMAVRKFLKGEELSRPAILFENMPVEALASVQTDLTGVF
    QLKNWLTGYFSGQRFQPDIKIDWTGYTLFQKQVLEALRQIPCGQVLSYCQLAEKIGRPRAARAVGNALSANRHLLVLP
    CH
    RVIRQDGSLGGFAGRPEYKKRLLAWESEELRKSL

    >gi|258516509|ref|YP_003192731.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MKSVMVVGAGLAGTKIAIDLAEVGFEVYLVEKSASTGGTMQKLDKMFPTHDCSLCTLAPDTMDFGCKLSSVNSHPNIKTI
    VNAEILDFAGIPNNFEVTIRGTLHTPEERPVSCDKDFNLSVIKINIDFVILSTGFKTTDPSEQSYYGYGKYPNVITSLEF
    EALLKEARIFHTKIFRPGDRKKVEKIAWLQCVGSRNERIGRPYCSSICCMVAVKEAIMAREISSDTKTNIFLMDIRSHGK
    GYHDYQQKAEKDFQVGFIYSRIYGVSKDPTGNLVIRYATENGNIITEDFDLVVLSTGIEQPEDIKDLAEKFGIMLDEYNF
    ALTQAFSGVCSSRPGIFIAGAFAGPMDIQESLTLASACVAEIISSSGINEKRIGKKPFNNHTSRQLAISEEPNIGVFLCS
    CNSRLDNILDFPKLTGELKNNQVHIFSDLCSLSGKEAAQKIILQKRLNRIVIAACSSKINSSIMKKLVAECGLSENMLQI
    VNIREQCAWVHMDKPKKATYKALEQIRMAVIKLSLSTDFTQHTSQITQEALIVGGGLAGLTSALYLAKLGCKVHLVEKTA
    ALGGLAAQTMLSSDTNDENISKHLNLLINETTGRSEVNIYLNTEVKSCTGYVGNFISRLSDSTVLNHAVTIIAAGGQEAG
    HNNDGSAKEYLYGKSKLVYTQMELEALISLNDPLLNKARNIVMIQCVGSREKSYRHYCSRICCTQSIKQALRLKERDPHK
    NIFILYRDITTYGSLEKYYTEARSKGIIFIRYNINNKPTAEEISIPNKKFIKILVDDHILGNTIELETDILCLATGIEAS
    PDNPKIASVFNVSLDDNNFFKERHIKLKPVDLNNDGIFACGLSHAPKSAEETITQAKAAVGRACTILCKGILQAHKTVAV
    NTGDCAACLTCLRTCPYSVPKIVEHKVFINPVQCRGCGICTSECPLNALELQNLSNEIMDAMIESLF

    >gi|258516561|ref|YP_003192783.1| Methyltransferase type 11 [Desulfotomaculum acetoxidans DSM 771]
    MISLQSDRLYETKQIHDVCGDTVRPGGLTLSERALAYCKFSPQAKLMDVGCGYGATVEYLLARGYVNSRGIDPSPVMLKN
    ALERNPCLPLLQSTAENLPCRDGELDGIFCECVLTLVADAGKVLKEFHRALGKGGLLVLSDMYDRSGGGSSRQGLPVQC
    C
    LNGAVSRQATAGRLAAAGFELLLWEDHTKALKELAGQIIFTYGSLENFPGLSCNKNNGSECGTGYASKPGYFLAVARKGV
    LNDG

    >gi|258516653|ref|YP_003192875.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfotomaculum acetoxidans DSM 771]
    MNPKIITIVIVFLLLALGFGLTHQTANESEIPGIAGDVSITAPSGVKEKLSPGQPPSFFITRDKKTTTLSSLKGKYIFIN
    FWNTW
    CSPCKGEMPDLNRLYLDYSKKNVEFIFINIAAQEKKISDVPAFLKQNNLQIPVYLDKNAEVAATYGINAIPTTII
    INPEEKVIYAAEGPISYEQASQLFKQ

    >gi|258516688|ref|YP_003192910.1| methyl-viologen-reducing hydrogenase delta subunit [Desulfotomaculum acetoxidans DSM 771]
    MAKKIGVYICTGCGIGEAVDVNALTKVATKEHKAGICKTDAFLCGQDGINLIKSDIQGEGVNAVVIAACPARIKYDVFNF
    GPEVMVERINLREQVVWTHEAGDEDTTMMAEDYMRMGMVKAKAAEIPEPYKLEDTAKSILVVGAGLAGMTSAIEAAKAGY
    QVILVEKEAVLGGYVAGMYKQAPIKAPFDGIKDN
    CIPALAAEIQSNSNIKVYTSAKVLKTAGAPGMFDITIEQGGQEILE
    KAGAVILASGATPYDPAKLGHLGYGSCKNVITQAQFEELAKKGAVNRPSDGKAVERVAFIQCAGSRDAEHLAYCSAACCV
    ESLKQAATLKELNPDAQSIFFYKDIRSSGQYEHLYKQVQSDGAIFVKSEIVNVTADSSSSVTIEVQDLILGENVITDEID
    LVVLANGMVPSTANVAQPAAPPAPGEQVEEVAEEKDTILNLAYRQGPELLNLKYGFPDSHFICFPYETRRTGIFATGSVR
    APLDLAATVEDATGAALKAIQCVEATAFGAAIHPRSGDMSYPEFNMNRCTQCKRCTEECPFGAINEDEKGNPLPNPTRCR
    RCGTCMGACPERIISFKNYSVPMIGNMVKAVEVPEEADEKPRILILACENDAIPALDMAGHSRLNYNAWVRIIPLRCLGS
    LNLVWVADAMSGGWDGILLLG
    CKHGDDYQCHFMKGSELAEIRLSKVSETLDRLGLESDRVRFRQINIMEYKEVATIIDEF
    AKDIEKFGPNPMKDFA

    >gi|258516689|ref|YP_003192911.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfotomaculum acetoxidans DSM 771]
    MANKSILVVGGGISGLTTAVEAAEVGYEVYIVEQKPYLGGKVAQINQYFPKLCPPNCGLEINFQRIRKNPNITFYTMAEV
    EAITGQEGNFTVTVKQNPRFVNENCTGCNKCTEACPADRANTFNYGIDKTKAIYLPHEFSFPQQYVIDAEACLGKGCTKC
    VEACAYNAIDVNMQAKSFELNVGAIVYATGWNSYDVTKLAYYGGGQYANVITNTVMERMAATNGPTQGKIVRPSDGKEIN
    SIAFIQCAGSRDENHLSACSTVCCMASLKQATYVRDQYPDAKISIFYIDIRTRGRHEDFFNKVQNEANVTLVKGKAGELE
    EDPETKDITVIAEDQMSQQLMQEKFDLVVLATGMYPATADTKIPFAVDYDKDGFVASNTPGIYGAGCVKSPMDVSASVKD
    ATAAALKAIQSTVRG

    >gi|258517350|ref|YP_003193572.1| redox-active disulfide protein 2 [Desulfotomaculum acetoxidans DSM 771]
    MSLFNFGKKKKEASSCCCGGSCDAESMAKAENAKTQGAIVKVLGSGCAKCNQLEAATKAALEQLGMDTVIDHVTDFSQIA
    AYGVLTTPALVVDGKVVSCGKVLKTEEVIKILQKVK

    >gi|258513931|ref|YP_003190153.1| protein of unknown function DUF362 [Desulfotomaculum acetoxidans DSM 771]
    MNNHHVYVAVAKCPAYERDYVNTSVKNLIDFLGGIENYVLPEQKVAVKPNLIAKKSPEEAATTHPLVVEAVVRLVQEAGG
    NPFIVDSPGGPSNKGLLSAVYRATGMEAVAKRTGCRLNWDMGEIELNHPRGRVVKKLTLLKALAEADVIISLPKLKTHGM
    TKYTGAVKLMYGAIPGLKKAQYHFNMQKLEEFSQLLIDINTLLPASLNIMDGIIGMEGDGPTAGSPRELGFLLASQSPFA
    LDHICAGLIGLDPAILVFLKLAAEQGLYPPASSIKI
    CGDKLPESIVAFKIPGHKQIDFNLPGPLKKIVGRLQPKPVFNLQ
    ACRGCGECQKCCPAQAITMLNNKPLLTLSECIRCYCCQELCPHKAVHIQQHWLGKKLMR

    >gi|258515466|ref|YP_003191688.1| L-aspartate oxidase [Desulfotomaculum acetoxidans DSM 771]
    MLGYFTERDVNKLSTIIVDYIVIGTGIAGLSCALGASKHGNVALLTKGDFFAGNTPLAQGGIACALAPGDSPEYHYQDTL
    TAGAGGCNQDTVNILVHEGIDRVLELKNMGVPFDCKDDGSLDLAKEGAHSKSRVVSAMGDSTGRAIAETLVKEVKQISNI
    KVYEYTMVTKLLVKNKECFGVAAVNQFNQQFTFLAKATVLAAGGCGQVYLHTTNSKTCTGDGFALAYQAGAELVDMEFVQ
    FHPTGLALIENPRILISEAVRGEGALLINSKGRRFMQQHHPMAELAPRDVVARGIFEELAADEKVFLDTTPIGQHFVKRF
    PYITAACRARGLDPVNNYIPVTPVAHFMMGGVKTDHNGQTCIKRLFACGEVACTGVHGANRLASNSLLEGVVFGHRVARS
    LINYDTLTAISLFNIDKSDTDYAGNSFIPVNEQVNNQTYNRFSKPHSSVYRNKLRSVMWQKVGLVRTEKQLSDALKLITK
    LEKQLPHDDYETYNMVLTAKLITEAALKRQESRGSHYRKDFPYALPEKLYHQVLL