Desulfotalea psychrophila LSv54 uid58153

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|51244119|ref|YP_064003.1| hypothetical protein DP0267 [Desulfotalea psychrophila LSv54]
    MVQSVPLWEQPLLRLAAGDTLRPGGFTITDRAADFVGLAPGWPVLDVGSGLGATVERLRARYGAMAHGVEPSWTQLKRGR
    GTGQVQAWGDDLPFLSSSFRALFCECVLSLFPDAEQGLAEFNRVLQPGAFLLLSDLCGHGDPAGGTS
    CAVRALPRAQTEA
    IVEAAGFRLLLVEDHSRLLHQLAARLLFAGGEEQACNCGQPQLGYYLLVGQKKEE

    >gi|51244155|ref|YP_064039.1| dihydrolipoamide dehydrogenase, E3 component [Desulfotalea psychrophila LSv54]
    MGTTEMKVKIVVLGAGPGGYVAAIRAAQLGGDVTVIEKENVGGTCLNWGCIPSKIYKQSADTLNSIKDSASFCIDGISEG
    KLNLERLQERTKGIIASQSKGIHGLLAKNSISYIGGEAKMSGSHSLSVTRKDGETEEVQFDKLIIATGSTPMALPFLPFD
    GDRILSSDHIFSLKEIPESITIIGGGVIGCEFACILQSFGVEVTLVEGLERLLPLPSVEEECSKLLLREMKKKKIKVELK
    TTLASASQKNGMVQLNLVSQGKNGTEKAKQIESEKVLVCIGRRASSASLDLDQAGVETTKRGWISTGANLQTTVPHIYAI
    GDVLGPERIMLAHTASTEAEIAAENCFGGAEEMNWQVMPSAIFTMPEIGCVGLSEAQAAELYGKENIRAESSLFRTLGKA
    QVIGELAGVTKIVCAKEDGKILGIHIAGAHATDLLGEATLAVSNGITAKQLTKTIHAHPTLAEILLETAFKIEDMPLHG

    >gi|51244167|ref|YP_064051.1| peptide methionine sulfoxide reductase [Desulfotalea psychrophila LSv54]
    MKLTAFLLLILSLSSASQVMAKSTVLAGGCFWCMESDFEKLDGVSGVVSGFSGGILKNPTYNGRHTGHVEAVQISYDPQK
    ISYRELLEHYWFNIDPFDDKGQFCDKGPSYLAAIFVASKEERHIAEESKRAIEKRFPNRRVITPILKATTFYPIKGHESY
    HQDYYKKSAIRYKLYRWNCGRDRRLQEIWGDRQD

    >gi|51244356|ref|YP_064240.1| mercuric reductase [Desulfotalea psychrophila LSv54]
    MKKYLIVGTVIALVSAYYFFGLDSYLSLQAIKTRQVQLESWRNAEPILAGLSFFGLYAVVASLSLPGAGVLTVAAGAIFG
    LIWGVLIVSFASTLGASLAFLLSRFLLREIVQSRFQDRLHAVNRGMEEEGAFYLFTLRLVPIFPFFVINLLMGLTSIRLR
    TFAWVSQLGMLVGTIVYVNAGTQLAQVESLGGILSTRLLFSFALLGIFPLICKRGIAWFKGRRLYAKWLRPARFDRNLIV
    IGAGAAGLVSAYIATTLKAKVTLVEAAEMGGD
    CLNYGCVPSKALIKSAKVAHHIRNGDKYGLDAVELSFSFRRVMARVHR
    IIATIEPHDSVERYTDLGVEVLCGYARLLDPWTVEVKLKSGETRRLTSRAVIIATGAGPFIPPLPGLDAVDYLTNETLWN
    AFANLDEAPRRLLVLGGGPIGCELSQALARLGSEVWQIQRGARLLPREDADAAAIVEASLGADGVHVLTGHTALRCERAG
    EEKYIVVEHEGQELRLAFDALICAVGRVARLKGYGLEELGIPVKRTVLTNEYLQTLYPNIFAAGDVAGPYQFTHTAAHQA
    WYAVVNALFGGIKKFKVDYSVIPWTTFVDPEVARVGLNEQEAAERGVDVEVTRYDLDDLDRAITDGVREGFIKILTVPNK
    DRILGVTIVGEHAGDLLAEFVLAMKHGLGLNKILSTIHTYPTLAEANKYAAGGWKRKHLPRRLLAWAERYHSWRRL

    >gi|51244384|ref|YP_064268.1| glutathione peroxidase [Desulfotalea psychrophila LSv54]
    MNTLKNQTLPLRIIMKRDFYQFSATNLQGQKIAMKEYRGKVMLVVNTASKCALSSQLRGLEILYKKYAPLGFVVLGFPCN
    QFTPQESRDAQNIAEEYLLNYGASFPLFTKTEVVGKGAHPLFSYLENRLEGIMGPDIKWNFTKFLIDHRGDPVKRFAPIT
    APAIIAPDIEILLSAQSTAGEQ

    >gi|51244402|ref|YP_064286.1| NADH oxidase [Desulfotalea psychrophila LSv54]
    MAQRVLIIGAVALGPKVACRLRRIDPDAEITVLDRDKLISYGGCGIPYYVGGDVSDIEGLRSTQSHTIRDSKFFGEVKGI
    DVRTQIEAIEILRKEKQVRIRDLRDNSEELLSYDKLVFATGASPIRPPFPGADLPNVSIVSNLHHAEAIKKRLAQGKIGK
    AVVIGAGAIGIEMAEALTDLWGVETTIIEMADQVLPQAIGGNLATVVQRHLEESNVEVLVSERVSGITKADDSDTLTVSI
    TDRTIDCDIVILSTGIRPNTELAKAAGLAVGQFGGLLVDRRMRTSDPHIYAGGDCVEVRNLVSGANQMMPLGSLANRQGR
    IIATNINGGSAHFPGTVGTFCIKVFELGVATAGLTARQAKAAGFDPVVSIVTQADRAHFYPTYQAMYIALIADRNSRKVL
    GIEAVGKGGDAVKARVDAVASLLHLGVDVAEISNLEAGYAPPFASAMDIVNNAGNVLDNILNGFNKTVDPDEFLKELAET
    DIRVIDVRGAIQAKPYQEKFGERWLHFPQDDLRTRYTEIPTDEAFFVV
    CDTGTRSYEGQVVLAAKGITNTRNIQGGLALV
    KAIAPEFI

    >gi|51244626|ref|YP_064510.1| Na-translocating NADH-quinone reductase, Nqr5 subunit [Desulfotalea psychrophila LSv54]
    MMKFSLRSFVCAVLLALLLPAVGYGQDLIKEQSFGKDDSIVLDFALPVDQVAAAKVSNYTVFEENDPDIRLAIKSADVLQ
    GGSQVVLNFAEPLNTTQAHIVQITNLADDRLTTRVSKSYLAYLFSILISALLINNFVFTKYLGLCVFFGTSKRKSTAKGM
    GVVFTIVMVVSACMSWFFYQYFLIPYDLNFLQILVFIGLVSLTVQAVDTVLRKVNPVLFNSFGVYLVLVIAN
    CVIIAVPL
    IVANNNYNIFETIMLSLGAGGGFLLALYLMSSVSERLALAKIPPSFKGLPVAFIVAGQFAMAFLGFSGLQIF

    >gi|51244661|ref|YP_064545.1| thioredoxin reductase [Desulfotalea psychrophila LSv54]
    MEQTTHYELVILGGGPAGLSAGLYAARARLNHVLIERGAHGGQVLLTDWIDNYPGFPDGISGFDLIEKMSAQAKRFDLNS
    LMAEVLSVNLDDPKKKSLKLDNGQTITFDTLVICTGARANSLKVPGEEEMRGKGVSY
    CGTCDAPFYRNMEVAVVGGGNTA
    IQEAEYLTKFASKVTVIHRREELRATKVLQESALANEKLEFIWNSQVTAIEGENGVERIQLIDKDGNKSTLNAHGIFIFV
    GITPLNSCLPLEKLQADKWGFIPVDIETRTSVPGVMAAGDIISKDVRQVINAAGEGAVAVLAAEEYLNNLK

    >gi|51244662|ref|YP_064546.1| thioredoxin [Desulfotalea psychrophila LSv54]
    MASEKVQQVNDGDFDTLISSGQPTLVDFWAPWCGPCKAIGPVIEDLANEFDGKVTIAKMNVDDNPNTPGKYGIRAIPTII
    LFKDGEAIDQLTGAVGKTQLVDLCNKAL

    >gi|51244696|ref|YP_064580.1| hypothetical protein DP0844 [Desulfotalea psychrophila LSv54]
    MFSLLIITLRAVGMTKKVLFFLLFLGCSLTEGYAMGIDYSVEEAHALIGDDAIVWLDIREKGELVSLPKLDVARHLPLSH
    FKAGFARLNIDRETRIFLI
    CRSGNRSKRLQKTLLKEGYINTVNILGGMRAWRKKYPRN

    >gi|51244772|ref|YP_064656.1| methylated-DNA-protein-cysteine methyltransferase [Desulfotalea psychrophila LSv54]
    MEKQQIYFDQVHSPLGSIVIAASSHGLHHLFFEERGRLEEGWQYSPERLQEVTQQLAEYFKGKRKQFDLLLAPTGTAFQM
    RVWQELCRIPYGKTISYKEMAHRIDKPKAYRAVGGANGKNPISIIQP
    CHRVIAADGSLGGFSSGLERKEFLLQLEGQDNK
    KPCS

    >gi|51244798|ref|YP_064682.1| hypothetical protein DP0946 [Desulfotalea psychrophila LSv54]
    MKIQILGPGCPKCKQLEEAAEVAAQEFGADYQIEKVSDINEIMSFGVMMTPAIAVDGEVKSVGKVLSKDEIIAFLK

    >gi|51244800|ref|YP_064684.1| thioredoxin [Desulfotalea psychrophila LSv54]
    MLCLSVPSLSFAEGMDSKQIPVPGMVTMVDIGAKKCIPCKMMAPIIEELQVEYKDRVAVIFIDVWQNPEKGRRFAINTIP
    TQIFYDDKGKEVRRHVGFLDKKSIVAIYDELGVK

    >gi|51244840|ref|YP_064724.1| hypothetical protein DP0988 [Desulfotalea psychrophila LSv54]
    MWLLLLLGCRPLRKAEEPYRDEVYYTPVHCPKGQNGKMIIDKNKEKIMLTVTPFAIENLKKYMTDNKIESALRIALMNGG
    CSGNVLGLALDKEGEKDQILTEGGITFLVEEGLAQQCGAITLDYLDQGARSGFAISSENPVAGGGGCSSGSCGSCGQ

    >gi|51244862|ref|YP_064746.1| heterodisulfide reductase, subunit A [Desulfotalea psychrophila LSv54]
    MLDKKKVGSVMIVGGGVTGMQSALDLADAGYFVYLIEKSGAIGGAMAQLDKTFPTNDCSMCIIAPKLVECGRHLNIKLMT
    LSEVTNIAGSAGDFTVTVKESPRYVDMDKCIACGACTDKCPKKVDSEYDEKTGKRKAIFVKYAQAVPLKYQIDPLNCLRL
    TAMRNGKEKLPCGFCEQVCDAGAINYNDTEKTHELNVGAVVLAPGFESHDPTGDGVWGYGVYPNVITAMQLERYLSASGP
    TEGHIVRPSDGQKARKIAFLQCVGSRDQNLCDNGYCSSVCCMYAIKEAVMAKEHVAGLETDIFYMDMRTHGKEFDKYMEK
    AKEKSGVRFVRSRVNGVEPQGEAGDLRLKYMNENGHQIEECYDMVVLSVGLQTPKHVLELAKTAGIEITKDNFAKTPDFA
    PVQTSREGVFTCGAFAGPKDIPQSVVEGSAAAAAVAELLAPSRNQFTHSVTWPAERDIREEEPKVGVFICHCGSNIAGVV
    DVAAVEEYAATLPHVAYVERNLFSCSQDAQEKIAATIKEQGLNRIVIAACTPRTHEPLFRETLKAAGLNEYLVEMANIRN
    HDSWVHSDNPKMATIKAKDLIRMAAAKVVFGESLKPISVPINQTALIIGGGVAGMTSALNLAEQGFNVNLVEKSDTLGGA
    ALKIKHTWSGEDVASQVATLVDKITWNDKVTVFKESEVVASEGFVGNFKSTILHGGEDYNVIKHGVGIVAIGGVEYKPNE
    YGYGEIAGVKTSTEFDNTPLSPSAKTFVFIQCVGSREGDNMYCSKVCCTHSVQSAIELKEADPARNVYILYREMRTYGQR
    EALYQKARKLGVIFINYESHGKPVVSTVDGAIRVDVWDHVLNCPLKIMADNLILATAVRPSTDAGAISKLYKVPVDADGF
    FLEAHAKLRPVDFSTDGMYVAGMAHYPKPIEESVAQALAAAARAATVLSKTEVTLDAVKATVDPDFCDGCALCVDVCPYG
    AITLGSRSDDLPSRIISVNEAKCKGCGLCQATCPKRGVYVAGFTMQQISSQIAAALEV

    >gi|51244869|ref|YP_064753.1| hypothetical protein DP1017 [Desulfotalea psychrophila LSv54]
    MNIKVSALVFALCLAVAGNCFAFGSSKFKKEVEKETGAVKLVREVQRGGYDLLTTDELKKMIDGGQKMVIVDTMPYESSY
    KKAHLPGAVQFLFPIPDMNIWDSAETAGKTEADYKALLGSDLDATIVVY
    CGFVKCTRSHNGAVWAKKLGYKNVYRYSGGI
    YAWKGAGCSVAKVK

    >gi|51244916|ref|YP_064800.1| hypothetical protein DP1064 [Desulfotalea psychrophila LSv54]
    MKQLDDVYRSCTLEYFESGKYRIMMPEFLALKKEDKAMMLDLRSKEEAELVSLSFAHNIPIAELPDRLAELPRDKVIVTF
    CASSVRAVMAFVYLQAAGFKNVKILTDKLQDLTANFMPPFVAKNYDILKK

    >gi|51244958|ref|YP_064842.1| heterodisulfide reductase, subunit A (HdrA) [Desulfotalea psychrophila LSv54]
    MVSVGVLWLNLVPIVNILRVIGRYGMTDEQGTSGAVLVVGGGISGLTAALETAEVGNDVFLIEKSPCFGGRVSQLNQYFP
    KLCPPS
    CGLEINFRRVKENRGIRTYSMTTVKSVTGEAGNYEVTLEIAPRYVNSNCTACGACSAACPDEVANEFNFGMDMR
    KAAYLPHEMAFPRRYVIDKDALSPAGAEAVVAACKYGAVDLDMQPETVVIQVGSIIWATGWNPYDPAKMDNLKYGQSDAI
    VTNMMIERMASPNGPTSGKILRPGDNKEPESIAFVQCAGSRDENHLEYCSSVCCMATFKHMTYVREQYPDAQIYVFYIDL
    RTPGKYEKFREQRMADEKATFIKGKVADIIIEADGGVTVVAEDALTGNKKNQKVDMVVLATGMQPSFATGAPVGLEVDSN
    GFIISDFNKGMIAAGCAKKPVDVVTTTQSSTAAALKAIQISRRSN

    >gi|51245079|ref|YP_064963.1| bifunctional methionine sulfoxide reductase A/B protein [Desulfotalea psychrophila LSv54]
    MSDPIFAKRLRACPLIGAGVICFFATIFCLAESNAAESIMKNREDLSITTLAGGCFWCLEADLEKLPGIVDVVSGYSGGD
    QKNPSYEEVSTGRTGHLEAVQIRFDPEVISYEEILQRFFRLHDPTDAGGSFVDRGRQYSSAIFYHDEVQKEIAERVRDEL
    APTFSRPIVTELISFRAFYPAEDYHQNYSLKSPQAYARYRSLSGRDSFIEAIWGSAGEMNYEKMSDDQLRKRLTALQYEV
    VREDGTEPPYDNAYWDNKRAGIYVDIVSGEPLFSSRDKYKSGTGWPSFIRPLVAENVVELKDNSFFLRRTELRSLHADSH
    LGHLFTDGPAPTGLRY
    CINSASLRFIPREVMQAEGYGEYLSSFLHN

    >gi|51245292|ref|YP_065176.1| hypothetical protein DP1440 [Desulfotalea psychrophila LSv54]
    MESFKGDGMRKFSPSILVLDASTDGYDIVKEQAAKTDYNALIKHVKNFPEFCEVFADGSWNVVVTQYQVDSLTAYDVLDY
    IGKSGKEASMVILSEDIPEDESYDIIYAGACDFVYKDSPERLMPVIYREIRSHIKKLHHERLQRAVDSFSTSLRLANPDK
    YNYFHSLMEVGDKNLINTFDYQEALGFLQESGDVQNEHYEIIRQADFMRHIPIHQAEKAFNAFEEKAVKAGEILMQMGKP
    VDYFHIIVGGEAQLTQIDMETGDLDSSAILKVGEAFGEKTILQGGQAERGVKMLTDGIILRLAADVFQKLVAAPLVSDVE
    VPIAKAMLDNSYKLIDVRLEEEYEMGHIPGAILIPLHELQDRMDEIDTSYRYVVC
    CRSGSRSAAATFILAQAGFNVRNME
    GGMLAWNYETVSEYVS

    >gi|51245323|ref|YP_065207.1| heavy-metal transporting ATPase [Desulfotalea psychrophila LSv54]
    MAKYSIVGMHCAACSSRIERALAKVEGVCRAEVNLADESVELEFDERISIKDIGDRLKGLGFELVIPSSVVGKDYQFRIT
    GMH
    CAACSSRIERVLAQTPGVLAVEVNLPAETAHIQATTSVRRIKAAVAKLGFGAELVSDLVAEDQLRQERGRKALADQK
    HSLLLMIFFALPLLYVTMGEMIGLPLPLALAPEHSPAIYASLQFFLALPIVYLGRRFYLRGIPALLRGGPNMDSLIAIGT
    GAAFIYSCANLLGILLGQDAQVRVMDLYFESGAVLLTLVSLGKFLEAGAKYKTGGAINALIKLTPKTARLIDSDGSHQEI
    ALEEIEVGDLLLVRPGERLPVDGRVVSGAGSVDESMLTGESMSVTKREGDPVFGGTLNATGALQIETEQTGAGTVLAGII
    AMVQRAQGSKPPIAALADKISLYFVPAVLVIAFITAGLWFFVGAVPLHEALRYFIAVLVIACPCAMGLATPTSIMVGTGR
    GAQLGVLIRNGEALQRAEKVDLVAFDKTGTITYGRQRLVKIINRSSMPEQEILSLAASIEKNSEHSLAQAIVLAAEEASA
    PLLPVQDFQAVVGHGVEARAGGLSLRFGNIQYMEGSGVTGLPEAEEMNRFACLGQTVLYFAIDESLAALFIVEDSLREEV
    PALIKDLTRMKVLSVMLTGDQKITAKAIAVQAGIGKVVAEILPDEKAVRVERLRKNGHCVAMVGDGINDAPALASADVGV
    VMGAGTDVAIEAADIVLMGNRIEHIVTAIGLSRAVMRNIRQNLFWAFIFNIIGIPVAAGILVPFGGPSLNPMLAGTAMAL
    SSVTVVSNALRLRRYK

    >gi|51245402|ref|YP_065286.1| NADH oxidase [Desulfotalea psychrophila LSv54]
    MEKSMKKSDIIIIGGGAAGIVAVNTIHALNPGLSLTLIKDEEALVNRCSIPYGMGREKGIENYIVPNSHITATGADLVIG
    RVEEIDTRKKEVILQTGESYAYGQLLLATGSRPILPQLPGIESERILVVRSLGDLERLRVSVRSGRRALVVGGGYVGVEL
    ATELQQLGLRVSLVEMRERILLATTEPEFITEVEQMLEGRGIHLMTGRQVTAFEDDGRERVGVRLDDGTVLEVDLVVFSA
    GVVPNMELAQRAGIATSSLGIITDKSLRTSVRDVFAAGDCAEKQAFVTGQPTRGDFGTNAVFMGSVAGQNMAGMAASFMG
    TINANVSMVYDTSFGSAGLTEAGARQAGIDVVVGFSETLDKYPMIDGAAPLRTKLIFTRSNGVLIGGSVMKEGRGVAPHI
    DLISLAIQKRTTIEEFLCHQYATHPQLAAVPTENSCLLATMAAMASR

    >gi|51245459|ref|YP_065343.1| 27kDa outer membrane protein [Desulfotalea psychrophila LSv54]
    MKFSKLTILAAGAISLLMASTFIQAGEKTSQGQEGKVEWTLAQNWKAPAGVLDFAHSLDDKYVYFLTKEHKVMVYSREGK
    LQGFIPVAPGVSSIDIAPQGEIIYLLDSTNNVFSAVRTDFVVEFNTKGSPFKGKADAPVTIAVFTDFE
    CPYCSKLVPLID
    QIYEANSKNVKIVFKNMPLNFHKAAEPAARAGLAAEAQGKFWPYHDKIFAIKNLKRSDLIKTAKELELDIPLFKKDMDSN
    AVRAQVRQDIIDAKSAGVTGTPTVFINGHKLKQREQRTFQTMIDAELRKAGLL

    >gi|51245537|ref|YP_065421.1| thiamin biosynthesis protein (ThiF) [Desulfotalea psychrophila LSv54]
    MGLISGEVKFFIALTITFEGKIFHPKYKFDDKRIFQGFSMLTPEQLSRYSRNILLPDIGLDGQEKLLAARVLLVGLGGLG
    SPIALYLAAAGVGTLGLVDNDSVDLSNLQRQVLYDSSSLGGAKVDATAARIASLNMDVTVHRYPVLFAEENGASLVADYD
    FVIDATDSIGTKFLINDICVRAGVPFCHGGVLEFIGQVMTVIPGKTACYRCFFKNPPVGDGAKR
    CSHGGILGSVAGIIGS
    LQATEALKFITGVGDLLTDSLFICDPSVNMFRTLPISSRDDCEACASLKV

    >gi|51245581|ref|YP_065465.1| hypothetical protein DP1729 [Desulfotalea psychrophila LSv54]
    MVKVKLYALAKCSYSQSIKKIFSEFQVDYSCIEIDRLPVVELKQVLAAMRLLNSQVIFPIVVVGNQVIAGHNLQAIRDAL
    GIRTEIAQLRDRLAVLAGKKGYCLNANREKTLRLLHALLLNRDRYGYMACPCRAASGRRERDLDIICPCLYRWADIAEYG
    SCYCGLYVAQEWDGVELEQIHVPERRVVECQ

    >gi|51245620|ref|YP_065504.1| formate dehydrogenase, beta subunit (iron-sulfur subunit) [Desulfotalea psychrophila LSv54]
    MARMKFLCDVERCIDCSGCIVACKEGNHVPVGVNRRRVVTLDQGKPGEKSISISCMHCADAPCIAVCPVDAIYQRDDGIV
    LADKKKCIGCGYCFMACPFGAPQFPKGAVFGARGAMDKCTFCAGGPEETFSDEEKRLYGQNRIAEGKPPLCSGMCATKAL
    LAGDADIIADVYRKRVFQRGSGAGAWGWDRAYKKDDK

    >gi|51245650|ref|YP_065534.1| thiol peroxidase [Desulfotalea psychrophila LSv54]
    MTQVSLNGTIIETIGDLPEVGDMAADFSLTASDLSTKTLDDYTGNTVVLNIFPSIDTPVCAMSVRKFNSDAAGKKNTKVL
    CISADLPFAHARFCDGEGLKNVIPLSAFRSPNFGKDYGQTIITGPLTGLLARAVVIISPAGKILYTEQVPEITQEPNYSK
    ALLLLAE

    >gi|51245657|ref|YP_065541.1| Na(+)-translocating NADH-quinone reductase subunit D [Desulfotalea psychrophila LSv54]
    MADTNRELLLRSIFKRNPIALLVLGVCSALAVTGQMTTALVMAVCVTLVVAFSSLIISLVRFQIPNSVRIGIQITVIATL
    VILVDQFLKAFYYDLSKQLSIYVGLIITN
    CIVMGRAEGYAMHNPPIASFVDGIGNGLGYGFILMSVAFFRELLGSGSLFG
    ITVLPLTTDGGWYQRNGLLVLPASAFFLIALLIWLFRTIDPSQQEKE

    >gi|51245658|ref|YP_065542.1| Na(+)-translocating NADH-quinone reductase subunit E [Desulfotalea psychrophila LSv54]
    MAHYLDIIVRAIFIENLPLSFFLGMCTFLAISKQVKTAMGLGFAVLVLQIITVPINNLLLTHVLKPGALAWLGQPDLDLR
    FLGLLTYISIIAAVVQVLEMVLDRFIPALYNSLGIFLPLLTVN
    CAILGASLFMVERNYTFAESAAYGVGAGGGFFLAVVC
    LAGIRERLEYANPPAGLKGLGLTFITTGLIAIAFMGFAGMEI

    >gi|51245725|ref|YP_065609.1| hypothetical protein DP1873 [Desulfotalea psychrophila LSv54]
    MENRQVDADQAQQWVHSGEAVLIDIRTMPEVMALEIAHSLYMPLSLVSAKRIEQLQLTEDKKIVFFCRSGNRSASLLEAQ
    PNLHGGNIWSLQGGLLSWQRRGLPVATKGQQAISLERQTHITVGSLILLTAFLGATINPSFFGATAFFGAGLLFAGLSGT
    CMMAKMLMKLPWNRAA

    >gi|51245773|ref|YP_065657.1| hypothetical protein DP1921 [Desulfotalea psychrophila LSv54]
    MVKPIGVSTQFVILDGIVWNLLDERVVVENSAHKSGYSSPNAYLNKSGGKYAKNIVHPLNYSFVFVLAMIVGAFVARKMQ
    HREEKAKIITVPTVCLRRFGSSSPKRYLVTFLGGLFVLFGSRLAGG
    CTSGHMMSGMMQTSLSGYLFALGAFAVAIPMAIL
    IYGREE

    >gi|51245905|ref|YP_065789.1| hypothetical protein DP2053 [Desulfotalea psychrophila LSv54]
    MIDWQGEQGELYQAHYNKTYESGVLDTKTKRLMAMGAAIVMGCKGCILGQTQKAIDAGATLNELMETCSVMLSLGGTIER
    DWYD

    >gi|51245969|ref|YP_065853.1| thiosulfate sulfurtransferase [Desulfotalea psychrophila LSv54]
    MKKIATMVLLLSIFTFAGQSRAELKMLDSQEIIAIQNNPDWLIVDTRLSDAFNGWKLDGVERGGHIEGAVNFSANWLHLK
    KKNLKEELLEILKAKGISPDRHIVLYDANGLDAKAVAGFLREENYSRLYGYDIRGWAADTNLAMQRYKNYQRIVPAVIVR
    AALAGKSPETFTGSKKIKVVEASWGEEKTSYSKGHIPGAFHVNTDRIEPPTTSEPVMWLLADSPTLKRFALEFGFQKDDT
    IIVASQEPMAAYRLATVLRYIGVDDVRVLNGGTDSWLLAGYPLETESHSPRPVTDFAGIVPGNSDIMDSMSETKAGLDRA
    QGFTLVDNRTWQEHIGETSGYSYHKKRGRIPGAIFGYAGTSGAYGLEYYRNPDKTMRSADEFLALWQEQGINTNNHLSFM
    CGSGWRAAEIYYYADVYGLRDIAIFSDGWIGWSNDEKNLTETGIPTR

    >gi|51245982|ref|YP_065866.1| hypothetical protein DP2130 [Desulfotalea psychrophila LSv54]
    MDLQFFAEGKHGVTLNMAADCLENSEDAVFLDVRTEEEAGFVRFKNVLHIPLNQLPDRLGELPQNQPIIVFCTSVVRASM
    AAFYLRAEGITAVRTLLASSEEMVKLFSSSRVFSRKTSTNQQQCN

    >gi|51246007|ref|YP_065891.1| ferredoxin-thioredoxin reductase [Desulfotalea psychrophila LSv54]
    MTDKKIVLYSLTTCGFCQAIKKMFDDLAVGHLCIQADELTGEEKKQALRDLRKVNPKCSFPTVVIDETVVVGPKIQEIKE
    KIGIRTEVDELYEVLKKKNEPKGYYLNGDREKTFELIRGLLTNKKRYGYMACPCRLASGDRNNDRDIICPCLYREPDVKE
    FGSCYCTLYVSADWYTGKIERQEVAERRPPEHYELD

    >gi|51246364|ref|YP_066248.1| hypothetical protein DP2512 [Desulfotalea psychrophila LSv54]
    MNNFNQVLQEMDFDFLGAGKHSMSVEAMRKALGNDHFLFLDVRTESERDYLRLPFASHIPLSELPTRLKELPQEKCIVPF
    CSSIFRGAVAYTYLRGNGFKEVKILTASMEDIVSAFKPGPLAKMLA

    >gi|51246742|ref|YP_066626.1| NADH oxidase [Desulfotalea psychrophila LSv54]
    MLLLAGAFRAWAMMLVSIGIIIKILLEKRMGERIVIIGGVAAGPKAACRIKRLSPRAEVVVIDQDALISYGGCGIPYYVS
    GDVADEKELRSTSFHMLRDEFFFDKAKRVTAMTSTRAISIDRAEKTVLLQDVKTGAEETVSYDKLLLATGSQPFILPIPG
    VDLDGVFTVTDMHKAIEIKARIAKGQVGKAVVIGGGAIGIEMAEALKDLWGVETSLVEFQKQLLPNILDWPMAAMLAQHM
    DDKDVHLYLGESAAEIVAGDADHVAGVRLSSGKTLDCDMVIMATGVRPRSELAKEAGLHVSSKGGIVVNERMQTSDPTIY
    AAGDCVEIPHLVSGRSFYAPLGSLANKEGRVAADNIVGIPTIFKGAIGSFILKAFDFSAASTGLSLESALAEGFDADVSL
    TSSSDRAHFFPTQQVLCLQLVFDRRTRRVLGLQGIGGASDALLARIDAAAVAITAGATVDDFGNIEMAYAPPFSTAIDAI
    NAAGYVAENLIDGRMRQMRLELFYAWMENVTSQPDWLVLDVRHPKQAKPFMEKYGDLWLNLPYEQVRDRYAELPTDKTLV
    IF
    CNAGSRSFEIQRLLDSVGLENNIVLAGGYNFIKRMGADWLPV

    >gi|51246873|ref|YP_066757.1| hypothetical protein DP3021 [Desulfotalea psychrophila LSv54]
    MMNFSNSYRQLGSDFYEESLPTPVLAPRLLLWNAPLAEQLMIPEELGQAALAQIFSGNQLLPGSEPIAMAYAGHQFGSFV
    PQLGDGRAHLLGEVFDKSGQRWDIQLKGSGPTQFSRGGDGRCAVGPALREFIMSEAMYALGVPTSRCLAVVTSGEDVYRR
    SILPGAIVTRIASSHLRVGTFEFFAARGEHEALKRLCDYTIDRHFPELQGATDQYIRFLDRVIGRQIQLITEWMRVGFIH
    GVMNTDNTSLAGETIDYGPCAMLGAYDPHTVYSSIDIKKRYAFGNQSAISQWNMTRLAECLLPLINADRNRAIDQLNPLL
    IAYTDRFNRVYIKMMGKKLGLTSLQAKDEKLIISLLDQLKIGKMDYTLTFDLLTKSLSSEPIASQMRGQLGNYFDLWQRR
    LKEQGTDLQEVQTLMRQQNPLLIPRNHHIEAAIAECEQTGRVNLAEKLLHVLRAPYEELTETHLYQDPPSDGDKNYQTF
    C
    GT

    >gi|51246935|ref|YP_066819.1| cytochrome c biogenesis protein (TlpA) [Desulfotalea psychrophila LSv54]
    MMKKKHIRLQGQFLFVALMFFFLVAGPAQANVKMPSFSLQSAVDNSLVESKAFTGNVLLVTFFATWCPPCIQEVDSLIKL
    QKNFVEKGFSVVALSVDQVGVSKVKDFVSSKGINYPVLMADQQVMRDFGGIYGIPVGFLVNRLGNVVKRYTGYVPEEQLE
    KDIIPLL

    >gi|51245322|ref|YP_065206.1| mercuric ion-binding protein [Desulfotalea psychrophila LSv54]
    MITIKIEGMSCAHCVASVKEALAGLKGPAEVEVDLQAGEARITGDIKREDACRLIEEQGFETK

    >gi|51246684|ref|YP_066568.1| thioredoxin/glutaredoxin [Desulfotalea psychrophila LSv54]
    MKITFYGSRFCPRCRQAKKHLVQLQREFPQLEIEYIEVTTAPIKTVRAGVFMIPSIQGRSGTLSGIFLPEEKIHAFLKEE
    YRYNQ