Desulfomicrobium baculatum DSM 4028 uid59217

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|256827896|ref|YP_003156624.1| glutaredoxin [Desulfomicrobium baculatum DSM 4028]
    MPDKAITLYALSTCIHCKKTKEYLDDCGAKYDCVFVDKLEGDERKQIIEAIKKINPKLSFPTLLVDEEAIVGFKQDQIKE
    ALER

    >gi|256828121|ref|YP_003156849.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
    MEKIHAVCPNCRTINAVLTERIRQNPVCAKCATPLLPAHPIELTDQTFERFVSRSALPVLVDFWAPWCGPCKMMAPAFTE
    AAAALQGQVILAKMDTEAQRAVPSRFNIQSVPSLVLFRHGKETARTAGAMPAGQIQAWVRQQL

    >gi|256828156|ref|YP_003156884.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfomicrobium baculatum DSM 4028]
    MSEKSGHSTTIEPWDVHNKTLVSHVRPSQWPNPRPQPRYNLVVIGAGTAGLVCAAGAAGLGAKVALIERDFLGGDCLNFG
    CVPSKALLRAGRAAAAVRDAGEFGVHVPDGTRVDFGQVMERMRRLRASIAPNDSAQRFRDLGVDVFLGAGRFVDAHTVEV
    GGERLNFVKAVIATGARAAAPPMEGLEQVRYLTNETVFSLTELPRRLAVVGTGPIGCEMAQAFARFGSEVLLIESSRGLL
    PKEDRDAAEFVRQALLKDGVKFLCCGKEVKVSAAEGGRIRLVAGSKAGSYDEVVDELLIAVGRKPNVEGLGLEEAGVTYS
    AKGVQVDDNLRTTNPDVFAAGDICSPFQFTHAADFMARTVLRNALFKGRAKASALTIPWCTYTEPEIAHVGLTEKDAVEK
    GIAVDTFTRELREVDRAILEGHTDGLVRVHVRKGTDTIVGATVVAGNAGDMISEISLAMTSGLGLGKIASTIHPYPTQGE
    AIRQVADAYNRSRLTPLVKTLFKYWLSWQRRGK

    >gi|256828193|ref|YP_003156921.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MRWKQFLTPVQSMDVDEVRAYLSGKTLQEVTILDVRQPGEYEEGHIPGARLVPLAALTDSLDEIDPSRPVVVYCAIGGRS
    RVAAQTLAGKGYDQVINMSGGYKAWNGQAAYGAEEAGVDIFSELDSAEAILASAYSLEEGLRDFYLRMLERVSDEKVKSV
    FRLLADIEIKHKDRLFAEYTRITGKDDRGDFECRFVTPLMEGGMTTEEYMDRFKPDFDSPVDVISLAMSIEAQALDLYIR
    SAVWTQNAENRAILEQIASEEKTHLERLGQLLDELVGSGSGATN

    >gi|256828197|ref|YP_003156925.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MKPPISFGIKTAIILAISVGLALAFNATRPDRLPLVHDPDSAAQAAAQRGEISLDEAALLFESGKAVFVDAREAGEYALG
    HIEGALSLDPVLFGQEFPALREHLEEATTIVTY
    CDGEFCELSHELAQQLLGMGLQDVRVLKNGWTLWRDQGLPTATGSQT
    TEPPQAPQAEEASVNASTGETPHATEPSEPESDQPAPAQTGPSDQQLQPAPPKEAPADSFAPESAPLGQPLEPDPQETLA
    PNPAPPEPEAETPSAKPAPPASPSLDPETLGEKS

    >gi|256828374|ref|YP_003157102.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfomicrobium baculatum DSM 4028]
    MSHFDIIVIGAGPGGYAAALLASQRGKTVALIEKEHLGGTCLNWGCIPTKLYLGATAHLEGLHAQSRLRLCSGSVQMDMG
    ALKKRKNAFVAATHKAMGCCLEKHGVALVQGQASLIDKNTVRVVSEAEQTLSFTTLIIASGSSTNWFPGLEPDHARILDS
    TDLLDLDEAPASLAVIGAGAIGLEMADFWHRLGTAIHIIEAAPRIAPAEDEEIAQTLHGMLKRKKWNIVTGKRVAEFVNE
    GESVLVRLEDGTQIRVEKALVAVGRKPNTPGLGLDNAGVAMTGAGWVTTDDFLRATPNIYAIGDVNGRTLLAHAAEHQGR
    YAVLHALGETTAAYTPGPIPGCIYGSIEVMRAGHTAAELAAQGKTVTVSRASLGANPISQAHGQAQGLVKVAWVDGVVHG
    VTAVGHGASHLVTLAEIMVRDRWTAHTAHEHIFAHPTLDEALRDALIAPQEEK

    >gi|256828656|ref|YP_003157384.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfomicrobium baculatum DSM 4028]
    MRIGVFICHCGSNIAGTVDCPSVAATALTYPDVVFSTDTMYACSEPGQDAIIQAIKDKNLDGVVVASCTPRMHEPTFRRT
    VERAGLNRYMFEMANIREHVSWIGKSKDLNTGKAAELVRMAVEKLRRDKPLIPKRFETVKRVLVIGGGVAGIQAALDCAD
    GGQEVIMVEREQTIGGKMAKLDKTFPTVDCSS
    CVLGPKMVDIAQHPNITLYACSEIEAVGGYVGNFQITIRKKATYVNWK
    DCTGCGLCVEKCPSRKFPDKFNENLCNAPSINIPFPQAIPKKAAINAESCLMLTKGKCGLCAKVCPVKCIDFEQQDELIN
    VDVGAIVVATGYDLFDWHKYPQYGEGRYPDVVTSMQYERMLSASGPTGGHVKRPSDGKEPKNVVFIQCVGSRDKSVDRPY
    CSGFCCMYTAKQTILTKDHIPDSQSYVFYMDIRSPGKLYDEFVRRAMEEYGAQYVRGRVAMIYPKGDKLIVRGADTLAGT
    QVEVPADLVVLAVGAESAKGAVQLGEKLRVAPDQYGFFVESHPKLKPVETNTAGVFLAGACQGPKDIPASVSQGSAAASK
    VLGLLSKKELESDPAVSRVNPARCVGCGKCIQTCPFGAIKEVQDRFGNPKAEVIDTVCQGCGICTVTCPQGAIQLEHFTD
    NQILAEVNALCPPKMFANYE

    >gi|256828715|ref|YP_003157443.1| Thioredoxin-disulfide reductase [Desulfomicrobium baculatum DSM 4028]
    MESVDILIIGQGPAGLSSAIYTARAGMRTLILGCAPKVAGDYEIDNYFGFTETITGKELIERGKAQAAKFGADIRCDRVL
    GIHQNDTGAFVAKTEDEEIEAASIILATGVSRIRPGISNLGDYEGKGVSY
    CVSCDGFFMRGKPVLVVGEGNFAANQALEL
    LQYTPNVTICSQGKELAISEDFLYRLEENKIPVLEGKIVTLAGEIGLETAQLESGQQIDAQGLFIAMGQASSSDFAYSLG
    LIRNGQFIETDREQRTNVPGIFAAGDCVGRFLQISVAVGEGALAGRAAISHVKERRRTLLDKEAK

    >gi|256828760|ref|YP_003157488.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MKPAAMPAGLAGCVKAQKNIDYCYVGFQPHTFNFALANGQIMEYSKIYRFFVFFFGAFFIVSGIASASEHVLPPLEAQKL
    IEANKDNPQFIIIDLRTKAEFDDAHIEGAKLVPYYATNFKRIISQMDRESKILLY
    CQKGRQSPLALKALEKLRFSDMYIL
    DGGFDEWINAGLPTAYTSF

    >gi|256828771|ref|YP_003157499.1| Heavy metal transport/detoxification protein [Desulfomicrobium baculatum DSM 4028]
    MPVIKISGMSCAHCTGSVTRLLEATPGISNITVTLTPGQASFDAAPEINLDQVKEAIRKIGFDPQD

    >gi|256828780|ref|YP_003157508.1| Redoxin domain protein [Desulfomicrobium baculatum DSM 4028]
    MTGFIRIALCLFLFFAAQPALAAPPATGDTMPELILPVPFDPAGQEMLGLQGKSTFTLADLDAELIFIEIIGVYCPQCVK
    QSPGFKTLFNRLGKGKLKGRVAMFGLAAGGTDAEVKQLLATGQYLFPVVSDPDYVAHKVLGEPLTPYTIICRPDGSVVYD
    HLGVIQDIDALYQQIKTLLD

    >gi|256828860|ref|YP_003157588.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MNRRPTRGVAMRFAVVAALSIMLLFSAACRAQDERLLEPSAAADLMRVNRDNPDFLILDVRTAQEFGQGSIEGAVLLDYY
    ASDFRERFAQLDRDATILTY
    CRSGNRSSHVLKMADDLGFKNVYDLRGGILAWREAGLPLIK

    >gi|256828930|ref|YP_003157658.1| thioredoxin [Desulfomicrobium baculatum DSM 4028]
    MAAQVNDAGFEAEVLKGDLPVLVDFWAPWCGPCRAIAPVIEELTQEFEGKVKIVKMNVDENPGTPSKYGIRAIPTLILFK
    NGEVVEQVTGAVSKASLKQMLSDKVL

    >gi|256828935|ref|YP_003157663.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfomicrobium baculatum DSM 4028]
    MSVLVTKQAPDFTAPAVNPGGCIEDFTLSSLRGKYVVLFFWPLDFTFVCPTEIIAHDRRLQEFRDRGVEVVGVSIDSQFT
    HFAWRSTPVDQGGIGPVGFSMVADVKHEIAKAYGIEHPEAGVALRASFLIDRDGVVQHQVVNNLPLGRNVDEMLRLVDAL
    QFTEKHGEVCPAGWQKGDTGMKPDAHGVADFLSKNAEKL

    >gi|256828959|ref|YP_003157687.1| beta-lactamase domain protein [Desulfomicrobium baculatum DSM 4028]
    MSLIFERIHTDGIAELSYLIGDDSEGVAAVFDPRPDVDCYLRLAREKQVSITHIFETHIHVDFVSGSRELCARAKSAKIY
    LSHEGGARYGFEHEGIADGDVFELGSALITARHTPGHSPEHMAYLLSEKDRPGAPWGVLTGDSLFVNSAGRSDLLGSSRA
    KELAEQLFHTLHDFYLTLDDGVLIYPAHGQGSPCGEDIGDRLSSTIGYERRFNAFLQFNNATSFTKHTLTDAAPIPTYYP
    LMGTLNTRGPTVLGNLPPVPGLPPKFFQEAIENSDNVLIDTRMMLAFGGGHIKGALSIGGLPVLSIWAGWLQDSDQPILL
    VLDSDDMLETIVRYFVRTGYTKFAGYLVGGMAAWNNAGLPLESVGQMTVHKIKRSGEKLQVLDVRAPDEWKDGHIPNAQH
    IFLGELREQLGKLDKDKPTAVY
    CDSGYRATIATSILQQQGFSRVCNIPGSWQAWKNAGYPVEKEIEKERK

    >gi|256828960|ref|YP_003157688.1| protein of unknown function DUF395 YeeE/YedE [Desulfomicrobium baculatum DSM 4028]
    MDALDYPGPAWSPYLVGAGIGVLSWLTLYFSDKTIGASSFYAFLAGFLGKRIAPGHTASLTYFKDNPPHVSWGFVFVGAI
    IVGGAIAALTGGEFANEWLSPMWVARFGDDIALRAAVAFSGGMLMAFGARLAGG
    CTSGHGISGTLQLNLASWITVLCIFV
    GGVAVALPLFKL

    >gi|256829104|ref|YP_003157832.1| UBA/THIF-type NAD/FAD binding protein [Desulfomicrobium baculatum DSM 4028]
    MAKGSFLPFFPEIYYKAAGGIGRHLNRLVGDIEELSLVEIQERTSTKGVFAKGWSFPFNVDDHKVILGIFLRNCFPLSPP
    DVYLLEPHEKMAIQYPHVELSGRLCLLGPQDNAYPALNDAMCRDLCDHLLAATAVLLRDNFSRKNADHFVQEFLSYWANF
    CRLKQTPMKPRWSLLKISIKRSRVVSHLTLTGDKKAGYLLAENQEDGVAWAKNVFGPDVKVYTQPAAFLWLKEGLMPGLY
    PLRNKHLRALLSLADDAAAEVLLACTPTKRQKAIRKVAKGRRNDLPICFGFDTEHGPALAGLLALPPSRNQGPKTSSGYW
    QPGMSNLIQRQFFGLGGEILPFNITRVDGDWLGFRGGDDSASEKKQVLSESHVVLIGAGSLGSRVAEMLCAAGVGQLTIL
    DHDDMEAGNIGRHLLGVDTIRGNKARETSRALLRRFPHLSLNGIPLKWEEALNIPKHKEELLGADLILSTTGELQSNLFL
    NRVLVSYSRKRPVPDTIFAWAEAYCCAGKAVLVDFASGCLECGIEVGRTVKSEACTFPRERLLKTLVPA
    CGDSFMPYGAL
    EMNPIASMTAKFSIEVLLGEVESPSQRVYVAAASIISAHDGRESDWAADFLPPRHEGTFFTAPWDQDKGCHVCRS

    >gi|256829160|ref|YP_003157888.1| Redoxin domain protein [Desulfomicrobium baculatum DSM 4028]
    MNFLKTFVLLLLLSFLPSNALSQDIHKAGIHDFKNIVESNKGKVLIINFWATWCSPCVKEFPGLMNMRQEFSEDELTIIG
    ISMDYGMRPVENFVKLNKVNFPILLDDESIGSMLDIKSIPRTLIYNRAGEKILDHLGFISEESFRHVIERLLKMP

    >gi|256829184|ref|YP_003157912.1| Redoxin domain protein [Desulfomicrobium baculatum DSM 4028]
    MNSIATKPITGFLCAVLLLLLLEAGAAMLLVSSVGSADDAQALPPMTRLHDLQATFSDLGGQSFTLADLRGKVVVINLWA
    TW
    CPPCRAEMPFLEGLWKKFQDNDQVQVLCISKETLAEVRQDPLAKSLTMPLYVFTSPAPPELDPEGLPTTYIFNRQGKV
    VFAHTGIAQWDAPEIVAYLDALAKATSN

    >gi|256829266|ref|YP_003157994.1| HesB/YadR/YfhF-family protein [Desulfomicrobium baculatum DSM 4028]
    MFELTKAAKEQLDMHFAGKEVSPIRVYMAAGCGGPRLALALDEQKDNDVVHEIDGYKFLVETALMDESKPISVEFHPHMG
    FNIKSGLKASSSGSGCSSCTSCG

    >gi|256829280|ref|YP_003158008.1| methionine-R-sulfoxide reductase [Desulfomicrobium baculatum DSM 4028]
    MRTCSKTTRLLLILALIIVWPTGGYSMDKIIKTDAEWREILSPEQYHVLREKGTEPAFSGELNDHHQTGTYVCAGCQTPL
    FHSDAKFDSGTGWPSFFKPVDETHIAKHEDKSWFMVRTEVLCAVCDGHLGHVFPDGPEPTGLRY
    CINSLALRFEPQDTK

    >gi|256829457|ref|YP_003158185.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MKKIATLALTLCCLLLASPSFALFDSKFEAETTKETEAVKLFRDTTAGGYDLVTAAELKKMIDAGKDMLIIDTMPYEDSY
    KKEHVPGALQFLFPIPDMKGWDDKETGGKSQADFEAMLGPDKDKTIVVY
    CGFVKCTRSHNGAVWAKKLGYKNVYRFPGGI
    FGWKGAGFPVGTLK

    >gi|256829509|ref|YP_003158237.1| cytochrome c biogenesis protein transmembrane region [Desulfomicrobium baculatum DSM 4028]
    MIFQPRFFLTCLMFLALAFPAATWADEPYRITLQAFRTSSADAPILAVLTLTPSPDWHAYGYIQGPSGFPTEVRATRDGK
    ALSPLYPQPTPGPDPLDPSLTVELYDGPTPFFVPLADGSSKVVVQIKALLCSSTTCQPVKEELELVITQTDALPPAEQQD
    WWPRFLQATPGPAPDLDVEPVISVEETQTAAVRTFTPRYFAPGLEVHTLSKAAALAFLAGLILNFMPCVLPVITLKLRSF
    IPAADSVPKSQRHAFRTHNLFFALGMMLYFLVLAGIIAVTGMAWGQIFQEPAAIITLTAIVFALSLSLFGVYDLPLIDLK
    GKAKGVVHHPRLESFTTGILATILATPCSGPFLGGVLAWALIQPPDIIALVLSCIGLGMASPYLAMSLFPGLYRFLPKPG
    AWTLHLERILGFLLAATCVYLFGLLPTSQYVSVLILLWIIALGAWIWGKWTDLNQSRIRRWFVRGIAIGMVALAAVFLFR
    PAGHPDPWENFDMGQFDALRGQQNLILDFTADW
    CPNCKFLEKTVLTPEKSAAFAAEHNAVLMRVDLTRHDPQLMALLESL
    GSKSIPILAIFSKNNPGSPLVLRDMFTSGQLKEALEQELP

    >gi|256829533|ref|YP_003158261.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfomicrobium baculatum DSM 4028]
    MTKASNKDEWFLPEDQRKALASYLKDFKEVVPVHLFVTPGQNDAYADFARNLMKDLVRLTDKVTLNLHSADEKANEKFGV
    ERFPTLLIAPEKYSIRFTGAPAGEEGQAFLHALMMASTGNSFLSARSKELLQELEEPRQVKVFVSPT
    CPYCPGQCVNAIK
    AAIEKPLLVSVECVETGENPEYAEEYSVGSIPHTVYDDEKLSTVGMESELAFVLQLVTLKAAKDMAEERSGKDSADASYH
    DVVIIGSGPAGLTAGIYAKRAGLDAVVLEKGIVGGLVSITPEVENYPGFINIGGKMLMDMIHEQAKQYVDVITGQTVEEI
    KVGRKLEVLTQDLVYVADAVIYAAGASWKKLDVPGEDRFMSKGVSF
    CASCDGFMFKGKKVAVVGGGNTALTDALHLKNLG
    VDVFIVHRRDSFRAEQHLVDSVLREEIPVHWNSVVEEIGGKETLTFISVRHVKTGETERIPVDGVFLAIGIVPNVEAVSH
    LGLAQEPGGYIRVDRLGRTSIPRIYAAGDITGGVQQIVTAVSEGASAAMAVFEDLTRRKTEAAARKA

    >gi|256829564|ref|YP_003158292.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MTRQVIDIFPDELEEFKNKTRERDYLLIDVRQPSEFAEVHIPGAQLIPLPEIENRIAELDGEKNLVLYCRTGGRSSVAAA
    LIKDAGARQGAIYNLVGGIAGWEGKGLKDIPHLELFPRDMALNQTLYRAMNMEKGAWLFYNDLAQEYKGTELGDMIEDIG
    GMEEVHARSIFTYWKKNNPASITDSFDETFERLDGRIMEGGKPISAWMARLGKDPKDRMLRLLELACEIEYYAYDLYRGL
    AKRDRDTEAVQTYLLLAEQEKAHIRVITKALDRFFGD

    >gi|256829646|ref|YP_003158374.1| protein of unknown function DUF395 YeeE/YedE [Desulfomicrobium baculatum DSM 4028]
    MGNDQILGLVTGILFGFLLQKGRVLRFEKQIGAMLLKDMTILKFMLSAIIVGMVGIEVLSSAGVITMSHKPMNVGAILVG
    GALFGAGWAVMGY
    CPGTSVGALGEGRWHAIFAIAGMVTGAAIYAELYPFFKTTVLAWADFGKIGLPEALGVSPWVVIIVF
    ICVVLGLFRWFESKGL

    >gi|256829647|ref|YP_003158375.1| protein of unknown function DUF395 YeeE/YedE [Desulfomicrobium baculatum DSM 4028]
    MRMKKQDSGGWNPYLAGALVGVLAILSAYATTAWLGKTSYLGASTTFVRGAGVIEQQIVPERVQANEYFTQQKIKIDWQF
    MLVLGIFVGSLIASGTDKSFKLESVPPIWEKRFGPSVGKRAIGAFLGGIVAMIGARMADG
    CPSGHGLSGMMQLSVSGMVA
    LTMFFVVGIIVAAFIYGRRS

    >gi|256829664|ref|YP_003158392.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfomicrobium baculatum DSM 4028]
    MKTRKFDVIVLGSGVAGGHVATRCHKAGLSVALVESHGFGGTCPLHGCEPKKVMADAAETVERFNNASGSGPVGSAKLDW
    VELMRFKRTFTDDLPDKIQKHYEKLGIHTFTAAGIFAGPNTIVSGNSRLEASHICIATGSTPRELHIPGSSLLSSSNDFL
    AMPTLPERIAFIGGGFIAFEMAHIAAAAGAHVTIVHRSQRFLKKFDADLVKRLAEHLEKMGVKFYQNCPPHSIEKDGSAL
    VLKAGEDGSQSFAADAIFNAAGRIPNLADLDLPTGNIDTHKGGVAVNACMQSLSNPSVFAAGDVIAETMPLTPVASVEAE
    VVAKNIIEGPIHEISKDVTPFALFTYPPLAGVGMLEEEAHEQGLGFDVIHGDSAGWSEYQRIGQQCAGFKLLVDKETRQL
    LGAHVLGDAAEETINLFALAMRKKVDVDELRSMLWAYPSFGYAIKYMFR

    >gi|256829681|ref|YP_003158409.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MEDFLRSMTMKDIGTSLISADQFVTLFNGGETVLLDIRFPFETRLWGMSFAVAIPLNELPDRLAELPRDKTIVCACPLDI
    RSNIACQFLLQQGFTAKILVGGLLALADRLRGGAANDLKLDRA

    >gi|256829682|ref|YP_003158410.1| redox-active disulfide protein 2 [Desulfomicrobium baculatum DSM 4028]
    MKIQILGTGCPKCVKLTEAVKTAADALGLAYEIEKVTDVNKIMAYGVMMTPGLVVDGEVKLVGKVPTVDELKKILAK

    >gi|256829686|ref|YP_003158414.1| redox-active disulfide protein 2 [Desulfomicrobium baculatum DSM 4028]
    MKKVHVMGPGCPKCTETFKIVEAAIAETGVEATLEKVTDFTEISKFGVFTTPAVAVDGTVKVMGKVPKKADVVAWLTA

    >gi|256829687|ref|YP_003158415.1| Thioredoxin domain protein [Desulfomicrobium baculatum DSM 4028]
    MKILRLLLALIFLAAASPALAAPSPLISGDPQEVPIKGMVTMVDVGAKACIPCKMMIPVIESLSEEYEGRAAIVFIDVWK
    NPDETPKFGLRAIPTQIFYDKDGNEVMRHEGYFSKEEIIKVLTKLGVE

    >gi|256829732|ref|YP_003158460.1| electron transport complex, RnfABCDGE type, A subunit [Desulfomicrobium baculatum DSM 4028]
    MDIFLLFISAIFVNNIVLAQYLGNCPYLGCSKEKSVSIGMGAAVIFVTIMATLFTFLIQKHVLLPFNLGYLQTIVFILVI
    AALVQFVEMFLKKMVPPLYKALGIFLPLITTN
    CAVLGVAILVQRKEYDFVTSLLYAVAAGTGFMLALVVLAGIRERFEIT
    RIPRAMRGVPIGLIMAGIMSLAFMAFKGMIA

    >gi|256829733|ref|YP_003158461.1| electron transport complex, RnfABCDGE type, E subunit [Desulfomicrobium baculatum DSM 4028]
    MASMMKEFTKGLWNELPPFRLVLGLCPVLAVTTTANNGLGMGAAVIFVLSLSNVIISLVRNIIPKKVRIVCFIAIAASLV
    VTVEMLMQAFAYPLYQQLGIFVPLIVVN
    CIILGRAEAFAAKNPPLLALADGLGMGIGFTLSLTFLGSLREIFGSGTWFGM
    SLFGPDFHPFTFMVQAPGAFVCLGLILAGMNFLNVWQAKRKGVELDPNFDAGCAGCAACKGLEKIVNQKKLERLEAAKG

    >gi|256829861|ref|YP_003158589.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfomicrobium baculatum DSM 4028]
    MSLKVVVIGGVALGPKAACRIKRVAPDAEVTLVDASKLISYGGCGIPYYVSGDVSDHQQLQETSFHMVRDEQFFQDCKDF
    KVMTETRALSIDRKAKTVLVQAKDGTQTTLPYDKLVLGMGSTPRKLPIPGRELDNVFTVSTLGEAIRIKEKVASGSVGSA
    VIVGGGFIGLEMAESFADMWGIETTVIEVADQIMPGFMSKAMATIAEKHLAESDVTVRTSEMVQAIEGEDGKVTRVVTNK
    GAIDADLVILAVGVIPNDILAREAGLSCSERGGIIVSKTMQTSDPDIYAGGDCVVVENIVTGKIGYFPLGSLANSQGRII
    GTNVAGGRETFDGVVGTYIIKLFDLAFSGTGLSLPVALREGFDAFSAHVIMSDHSHFYPKRDMVSLEIVVERRSGRVLGL
    QGACQNGDSLKGRIDTMAAILKFRPTLRDVSSLEMAYAPPFGSAMDVLNAAANTAENMLVGRNVSIQPTEFAKLWENRAS
    ENLLCIDTREWGNAEPFVNKHPDFWKNIPQGQIRGRLDEIPRDKKIVLL
    CNTGGRSYESQVILRHAGFLEPVNLQGGMGF
    IKQLGFDPSQEE

    >gi|256830030|ref|YP_003158758.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfomicrobium baculatum DSM 4028]
    MRIRTIFTFLFFLLLSGSAVAMEASDNANSHPLPVGAAMPDLLLRGELSAEHLAHLGLKGPAPRHLSEINAKTVILVAFS
    MY
    CPHCQREAPALNDLNALIASRGLSEEVKLIGVGIGNSDFEVQVFRDKYATTFPLFSDPDFRVNKELGEVGTPFFYVLA
    MNPEKKEIRVVKTLLGRMESAESFFDQAMKACE

    >gi|256830031|ref|YP_003158759.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfomicrobium baculatum DSM 4028]
    MTPTLPASLFFVALLLFLPAQLPAQEASIPPDRIYETGQLKPVDSTLKVKVGDQAPDFSLPTISGETVTLAQFRGNKNVV
    LSFIPAAWTPV
    CSGQWPGYNIVQDMFEQTDTQLIGISADNVPTLHAWVQEMGGVWFTVASDFYPHGQLADSLGILRSTGE
    TERALFLIDKEGIIRYIDVHDINSRPDLGPLIKAMQSLK

    >gi|256830103|ref|YP_003158831.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MRRHSSILHVLVVALLLGLLAGCSGARGHKGAAVQLDPAKVPTPYHTLVDIEYVKPLVFEAMLGQDPSPKAMIIDARPKQ
    PRYDKGHIPTAVSMPDSQFDKMAAEVLPADKNTLLVFY
    CGGLACPLSHQSAWKAEALGYTNVKVYPAGDPEWQSLGYEVW
    TARDVRTPLPVLDPAKVTRPFHRLLTLDQFKPYVAAALLSTTPAEDVIIIDSRPKQPRYDKGHIPTAISLPDSQFDKMAA
    EVLPADKTAKLIFY
    CGGVECPLSHQSAWKAEALGYTNVAVYPAGDPEWVAKGLKVWTAEGASQEVAPAPAKAKAAASAGA
    LKAGASEGSIDNAVFTELARNNVDSIRLIDARSPAEYAIAHIPGSENMTVDMIEKRIDEFTAEKPIVFI
    CTTGARSGEAF
    YMFQAMRPDLKDVYYVDANVSFAPDGSFTIKK

    >gi|256830113|ref|YP_003158841.1| response regulator receiver protein [Desulfomicrobium baculatum DSM 4028]
    MRKQYGALVVGAGIAGIRAALDLAVTGHKVALIDKRPSHGGILSQLDYQFPSDHCGMCRMLPLMSRDASSQFCLRKGMFH
    ENIDLMLSTELASLEGEPGKFFVSLSRRSPLVDPHKCVSCGKCSEVCPVKVPSEFNAGLTQRSAVYLPVPHAIPNHYVLD
    LDNCIRCWKCHEACPTGAIDLKFEERAQFGILVADEDEQTRLTVRQSLEHLHFPVFEAASGQEALDLLESDAQINFVLVG
    LNLQGVDAQRVMARAKELYPGMPVAVLTAAGEEEAAAELIRRGARDQFMKPLSSKKFVPWLDKHYMRIMSDTTEELQVSA
    VILAGGFDCYNPDMNPNGGRDIWGYGHPAVLTAVEFERLLSGTGPTGGKLNRPGDNKPVRRIAWIQCVGSRDVGKNANYC
    SSVCCMFSMKEAMLAKKITNGAVDATIFYMDMRTFGKGWDDYRLRAVEQGVHFVRNRPHSVLPAAEGGGVVLESLNDDGT
    RRSEEFDMVVLAVGARPPKGMDTFAATVGIETNEWGFCKTQPYAPERTSRVGVFAAGSFGEPRDISESVMQAGAASEAAA
    RMINIYDVLGPAPAPPEPEYPDVSREPVRTLVAMCTSCPTLGKAVNLEELARTVGRVHSVGTVLPVFQACTEAGWKQILE
    TVKQKKPNRILIGACMPYAYIPRLKEMARTVGLNPALMDVVDVHTPTFNGQDAVDVAREIFSSLSMAVAKLQGVDPTPPD
    VLMDVSRSALVVGGGLAGLTASMAIADQGFGVCLVEAEEELGGMALRLHTQLDGTDPRKYMEDLIAQVEKHPRIKVFKDA
    RVVLSRGSAGRFRSAISGENGIFPLEHGVTILATGGHEAKIYESGFCVHRTVMTHFGLEEKLSTGALDVGSLGAVAMIQC
    WRSRKEGERNYCSRICCPEMLKNVLTMKERKPELSIYVFYRDIMAQGFLESYYTQARKAGVIFIRYDPENPPKVTFVEGK
    PVIRALDPILGAEIEVHADILSLSSGVEPNDVDDLVEIFGVKTDRNGFFQEADSKWRPVDFLKQGVYMCGLAHSPRRMAE
    TVASAKAAAQQSLRILSAGKVARETLVATVRPSLCSLCQACVAACPYGARTVDLENELILVDEMLCQGCGACAAVCPNSA
    TVIKGFHDGPMMAVIDAALEQLA

    >gi|256830116|ref|YP_003158844.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfomicrobium baculatum DSM 4028]
    MARRIGVYVCHCGSNIAGKVDCPEVAAFARGLKNVAIARDYQFMCSDPGQDMIIRDINEHGLDRVVVASCSPRLHEKTFQ
    KACARAGLNPYLMQHCCIREHCSWVTADKGEATAKAKHIVEAAVLRVRRHQELHSREVAVVPDVMVVGAGIAGIQAALDV
    SRSGHRVILVEKSPSIGGHMAQFDKTFPTLDCAA
    CISTPKMVAVAQEPNIDLLTWSEVEEVTGFVGNYTVTVRRKARYVR
    EDICTGCGACLEKCPTKVVSEFEEGLGMRRAIYRNSPQAVPSTPVIDAEHCKMLTKGKCGICQKTCPTGAIDFTQQDRKE
    VYHVGSVILATGYDTMDPTPMTEYGFGRYPEVYTALQFERLNNAVGPTGGKILMKNGQAPESVAIIHCVGSRDTNYHEYC
    SRTCCMYALKYDHLIKDKVGHGAQVYNFYIDMRCFGKGYEEFYRRVQDEGVTFVRGRPSEVVQENGKLVVVGEDTLLGTR
    LRVPVDMVVLCTAMEARPDTTEVARIFGVSQGRDGFFLEEHPKLGPVSTASDGIYLAGTCQGPKDIPDAVAHAAGGAAQA
    LALAARGVVSISPTTSWINPDICVGCKMCIGLCPYSAIEFDERRHIAVINEAMCKGCGSCAGHCPSGAAQIKHFRQVQVF
    NEIDGLLDRKPDIMALIGDIYEPANRAGA

    >gi|256830234|ref|YP_003158962.1| Redoxin domain protein [Desulfomicrobium baculatum DSM 4028]
    MNKRDNVVTMKGNPLTLLGPEITPGMAAPDFSVVDNDLGPVSLSSLKGKVVIISAVPSLDTPVCDMETRRFNQEAQNLGD
    KVKVLTVSMDLPFAQKRWCGNAGVENVQTVSDYQTASFGQAYGVLIDGLRLLARAIFVIDAGGKVAYVQVVPELTHEPDY
    AAVLGAVKKLL

    >gi|256830441|ref|YP_003159169.1| Rhodanese domain protein [Desulfomicrobium baculatum DSM 4028]
    MSDTTTPAELKALLDQGRVTLLDVRRAADRDGGGPMIGGAQWRDPEQVEQWAGELAPERPVVIYCVRGGSVSTSVQGALR
    GRRIDVRFLEGGLVAWEAQGAKEQGE

    >gi|256830628|ref|YP_003159356.1| HesB-like domain-containing protein [Desulfomicrobium baculatum DSM 4028]
    MFTLQPAAKAQLDEHFGGKDKEPIRIYLASGCGGPRLGLALDEKKDNDQIFDVDGYSFLVEGDLFEQAKPMTVLFDQNMG
    FTVESSMVFPEGEGGCSSCGCGGSCG

    >gi|256830830|ref|YP_003159558.1| heavy metal translocating P-type ATPase [Desulfomicrobium baculatum DSM 4028]
    MNSTSRSIRLPVGGMHCAACSTRIEKVVGAMPGVEQIVVNLATEEMDLRFNPQDAPLDTILEQVRELGFSVEAPTEQSVL
    ELKIGGMH
    CAACSSRIERVTGRIEGVTEASVNLGAESGRFVFDPALVSQRALRQAIHDAGFTTSIPQKERAGDEEERINA
    RLAEKKKVVLWSMAFALPLLVLSMGHMWGMPLPHWLDPMHAPGAFALAQLLLTLPVVWSGRSFYLIGFPALARRAPNMDS
    LVAVGTGAALVYSLWNTVEIWLGVDAQARAMDLYYESAAVLIAMISLGKFFEARSVSRTTGAVRALMALAPDTATLVDGE
    NERKIPVEEIEPGDLLRIRPGERLPVDGEVAEGQSHVDESMLTGEPLPVRRGPGGRVYGGTLNTTGAFVMRASLVGEDTM
    LARIVRLVRDAQGSKAPIASLADTISYYFVPVVMVLALVSGLAWYFFSDEPFVFALRIAISVLVIACPCAMGLATPTSIM
    VGTGRGAQLGVLIKSGRALQRAGELGTLVFDKTGTLTVGKPVLSEVWVDPAAGIDKESLLRLSASIEAQSEHPLARAVVL
    AVQGPLPKASDFLSVPGQGVTAVVEGRAVAIGNERLMQAENLNLEEAKAVRERMEENGATVVHVAVDGRLAGLLAVSDQL
    RPEAKGALQRLRDLGMEIVLLTGDSERSAQAVARQLGIGRVIAGVLPDRKAEVIIDLQKEGRAVGMVGDGINDAPALARA
    DLGVAMGGGMDVALESGDVVLMREDLTGVLTALSLSRAVMRNIRQNLFWAFAFNTIGLPVAAGLLHIFGGPTMSPMLAGT
    AMAMSSVLVVSNALRLRFFISPHT

    >gi|256830962|ref|YP_003159690.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfomicrobium baculatum DSM 4028]
    MASNSILVIGGGFAGITAALEAAEIGHEVFIIEKTPFLGGRVMQLNKYFPKLCPPSCGLEIQYQRIKNNPNVKFFTLAEV
    TKVDGSVGNYEVTVQIKPRYAGPSSPDLSDLCDDLSTEVVNDYEFGLATRKPVYMDAPFAFPQRYVVDKASLSDSDKSKV
    QKCDYLDLTEEEKTITLSVGSIIIATGWKPYDVTNLSNLGAGAVKNCISNMQMERLASPYGPTNGAILRPSDNRAPKKIA
    FVQCAGSRDENHLHYCSYICCMASLKQAQYVREQYPDAEVTIYYIDLRTPGRYDNFAKKILADEKIFAVKGKVAAVEQDS
    AGDDVWVTVEDAVSCSKSVERFDLVVLATGMQPSLAGASLPIDVPVDAEGFIVGGEEKGIFAAGCAKQPLDVMKSAQSAT
    GAAMKAIQTVRGR

    >gi|256831114|ref|YP_003159842.1| methylated-DNA/protein-cysteinemethyltransferase [Desulfomicrobium baculatum DSM 4028]
    MNAFSETFANRWFSVTFVWTDGLLTRTDLSAEPKAATAPLSPYGAALERIVTQYASLHADEWPEMPLDRRSLTTFSLKVL
    DTLRMHTPRGAFTTYGRLADRCGSPRAARAVGGVMARNPWPLLVP
    CHRVLAGNLGLGGFGPGIELKRTLLTLEKAPLPA

    >gi|256831168|ref|YP_003159896.1| thioredoxin reductase [Desulfomicrobium baculatum DSM 4028]
    MKENTLENKMYDLIIVGGGPAGLSAGIYAMRAAMHTVLIEKGMPGGQIALTKDVENYPGIEEVGGFELCEKFLNHAKRYN
    LEIRENEVVSVEPGVDFHEVVLAGGERLHTHSVILAPGGSARKLGVPGEMEQYGKGVSY
    CATCDGFFFRGKTVVVVGGGD
    TALEDALYLSKICAKVYLVHRRDEFRGSRILQQRVFAEPRITLVLDSVLDDIAADDQGVTGVTVKNVKTEETHNVATDGV
    FIFVGFLPNNALVPAGVKMNAAGYVVTDEKCETSLPGIFAVGDVRQKYANQIVLAAADGCVAALAAAHYVETRKAQAARK


    >gi|256831201|ref|YP_003159929.1| peptide methionine sulfoxide reductase [Desulfomicrobium baculatum DSM 4028]
    MRLVLIFAILASGVFGGTVAAQTKEAVFAGGCFWCLEGPFDALPGVMETEAGYTGGQISNPTYEQVSSGTSGHIEAMRVV
    YDPEQVDFEKLLNVFWRNIDPLDAGGQFCDRGPQYRSAVFFADAAEESAAQASKARLEEAHGFTIATEILPRSEFYPAEE
    YHQDYYKKNPLRYHFYRQGCGRDQRLRQLWGAEAKVKP