Desulfohalobium retbaense DSM 5692 uid59183

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|258404167|ref|YP_003196909.1| periplasmic binding protein [Desulfohalobium retbaense DSM 5692]
    MALAGPVHAGPVLTDQAGRQAAVPEDPQRVVCLAPSLTETVFALKQGERVVGVSQFSDYPPQAAKLPRVGSYVRPELERI
    LARKPDL
    CLAVKDGNPRQVVDRLEQFGIPVYAFAPYSLKQVLEMVPRLGQILNCPDQAEILHRRLSHSIDAARARAEAAS
    SRPRVLYLAGLAPLIGVGGDTYLHELIATAGGSNVTVDSAGYPRLSYEDILRLAPDVVLLPSMGGRERAVEAKKRLQRWE
    HLPAVTQGRVHIVDADRFNRPGPRLVQALETLTALLHPGAEAVMESK

    >gi|258404199|ref|YP_003196941.1| Rhodanese domain protein [Desulfohalobium retbaense DSM 5692]
    MRWKQFLTPIHSVDAETARSSLQAPGVDAEIIDVRQPKEYDQGHIPGAKLIPLPQLQDRLQEIDADKPVYVYCAVGGRSR
    VAAQMLSSQGFAEVMNMKGGFKAWNGHQAIGAEELGLELFDGLESFAELLKTAYGMEAGLREFYTSIASRVDDGDVRELF
    ETLARIEEKHTRRVFQAYLQKVDDQVDESTFSEQIVPQALEGGQTSQDYIDRFAPDWNKPEEVMELAMGIEAQAMDLYTR
    AAQRESGDAREFLEQMALEEKGHLQQLGQMLDRMLGA

    >gi|258404334|ref|YP_003197076.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfohalobium retbaense DSM 5692]
    MRIGVFVCHCGSNIAGTVNVQEVAETARDFPEVAFATDTMYACSEPGQEGIVQAVQEKGLDGVVVASCTPRMHEPTFRRA
    VQRAGLNAYMFEMANIREHVSWVSKDVAANTDKASELIRMAVEKLRRDRPLISEKFDVTKRVMVIGGGVAGIQAALDCAD
    GGLEVVLVEKSSTIGGKMAKLDKTFPTVDCSS
    CVLGPKMVDVAMHPNITLYAYSEIESLGGYVGNFEATVRRKATYVDWE
    KCTGCGLCMEKCPSKKAYDYFNEGISTTTAINIPFPQATPKKATIDADYCRRFTKGKCGVCAKVCPTEAINFEMQDEIVT
    EKIGAVITATGYDLFDHSKYGEYGGGRFADVITSMQYERILNASGPTGGHIKRPSDGKEPENVVFIQCVGSRDKSVNRPY
    CSGFCCMYTAKQTILTKDHLPESQSYVFYMDIRAPGKMYDEFTRRAMEEYGANYIRGRVSMIYPKGERYVVRGVDTLLGT
    QVEIDADLVVLAVGAECADGAEKLAETLRISYDTYGFYMESHPKLRPVETNTAGVYLAGACQGAKDIPASVGQGSAAASK
    VLALFSKDQLEADPQVAQVQLARCVGCFKCVNTCPFGAIQESQDRGGNPKAEVIASVCQGCGICNVTCPQGAIQLQHFTD
    NQILAEVSALCQPKMETSSA

    >gi|258404551|ref|YP_003197293.1| response regulator receiver protein [Desulfohalobium retbaense DSM 5692]
    MPTQEYAALVVGAGIGGIRAALDLAETEHKVLLIDNKPHLGGLLAQLDYQFPSDHCGMCKMLPLTERDDSSQFCLRKGLF
    HRNLDILLSSRLTSLEGEPGKFQAVVKQQSSLVDAHKCISCGQCSTVCPVRIPDTFNAGLGERAAIYLPVPHNIPNQYVV
    DLAHCTRCWKCAEACPTGAVDFKFAERANFPILVAHQDSSLRQSIDQSLADENFPLHWATTGEEALRMVEQETSLGLVLL
    DSTFADVTAQRVLQRGLEIHPDLQVVAMAPESVAEAAQALVANGARTTLATPLTDDFPGWLDKLYLRITSETSHQLEVGA
    VILAGGFECYDPAPVHDVLGYKDHPQVVTSLEFERLLSSTGPCGGDLQRSDGKPVQSIAWLQCVGSRDRQKNADYCSSIC
    CMFAIKEALLAKDHARDQIETTIFAMDVRTFGKGYQRYRDHAEQERGVRFVIARPHSIIPDGHGGLLLQYIDENGQPQNA
    EYDMVVLATGAKPPQDMPGLIQATGIECNEFGFCRTDALAPTRTSQFGVFAAGAFGEPKDIADTVIQASAAALEASRLIY
    LYAAPKRWEKEPEPTYRRVEQEAPRTLVVLCDACPTLEQSVDMPTLTEQLQQMSSVQEVVRIPQACTEAGWQRIEDQVRQ
    SAPNRIVLGACLPYAHVPRLRQLGRTVALDPAFMEVVDIYTPTFPDMPLTSEQRLREIVSNLGMAVVKVQSASPTPLLKP
    VPVTPKALVVGAGLAGMTAAMAVADHGMDAYLVEEGDSLGGTANRLRSTLEGSDPVKYIQDLCEQVQKHPKITLLTESRI
    TLSMGRAGQFLSAVQTEAGQSLTIEHGATILATGGKEAKSYAYGYGTRKTIFSQLQFEDKLATGAIDAGALSGVVMIQCV
    ECREEPRNYCSRVCCATAVKNAITLKRRNPKLPVYILYRDMMTYGFSEHSYTEARRLGVVFIRYTPAHKPQVECMDDDRY
    RVTLTEPILQRPLEIHADLLVLATGIVPNEVEELSEIFRVPVDQDGFFQEAESKWRPVEFLRQGVFVCGLARAPGNMRET
    VASAKAAAQRALRLLTHDRIAGGTVTAEVRHSLCSLCQACVNVCPYGARSLDWENEQIVVDEILCQGCGACTAVCPNSAA
    VLRGFQDEQVLAEIDASLGVVP

    >gi|258404554|ref|YP_003197296.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfohalobium retbaense DSM 5692]
    MAVKIGVYVCHCGTNIASKVDCPEVARFAAGLPGVVVGRDYKFMCSDPGQDMIIKDIQELGLNRVVVSSCSPRLHEKTFQ
    KACLRAGLNPFLFQMTCIREHCSWVTADPAEATRKAKHLVAAAVNRVQRHAKLYARQEHVHPDVLVVGGGIAGIQAALDV
    AKSGHRVHLVEKAPSIGGHMAQFDKTFPTLDCAA
    CISTPKMVAVAQEPNINLMTYAEVQEVKGFVGNYEITVRQHPRYID
    ATKCTGCGLCLEKCPTKVPSEFEEGLGMRKAIYRYSPQSVPATPVIDADHCRFLNGKKCQVCAKFCPSEAIDFSQKPQDV
    VLEVGSIVLATGYDAFDPAGLEQYGYGRLDNVYTALQFERLNNAVGPTGGKIQLKDGSAPQSVGIVHCVGSRDTHYHEYC
    SRVCCMYALKYAHLIKDKVGHDVAISNFYIDLRCFGKGYEEFSRRVQEEGVTFIRGRPAEITDEAQSPAEDGKLVVVCED
    TLLGRNLRVPVDMVILCTAMEAGRDAPELARLFGISQGQDGFFLEEHPKLGPVTTATDGVFLGGCCQGPKDIPDAVSHAS
    GAAAQALALATRGEVAISPTTSWIDPDICIGCQVCIGLCAYSAITFDARRGVSVVNEALCKGCGSCAGYCPSGAAQIKHF
    NQQQVFAELEGILEPAAPPPPAEEEALAAEKGAS

    >gi|258404650|ref|YP_003197392.1| Redoxin domain protein [Desulfohalobium retbaense DSM 5692]
    MRTARLLCLVAVLLLTSTWVWAASPPQAGDAFPEQALQAPQSEKERAYLGLGPEVEQFRLQDLKAPVIVVEIFSMYCPYC
    QREAPEVNALFQRIQEEGLGDSIKMLGIGPGNSAYEVGIFRDKFSVPFPLFPDRDYTWHKVVGEVGTPYFFVLERDGDQL
    RVRISHLGPFESPEAFWNRILKATHL

    >gi|258404651|ref|YP_003197393.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfohalobium retbaense DSM 5692]
    MRKMMVAIGVFVCACLVAGSVPAQVETVYSVGQLKPVDSELKVAVGDAAPDFALPDLQGETVRLSSFEGEKNVILSFVPA
    AFTPV
    CSDQWPGYDLMQDIFTAHNAIILGISADNTPSQYAWVQEMGGVWFPVLSDFWPHGQAASRFGVLRSDGTTERALF
    LIDTQGIIRYIDVHDINSRPRLEPLIEALENLSTEAP

    >gi|258404664|ref|YP_003197406.1| RnfA-Nqr electron transport subunit [Desulfohalobium retbaense DSM 5692]
    MASVVQEFKKGLWAELPPFRVVLGLCPVLAVTSGVASALGFGCGLLFVITMSSVLVSLLRNVIPDKVRVPVFISIIASGV
    IIVERVMHAYFYGIYEILGIWIPLIVVN
    CLILGRSEAFARKNPVHLAAADALGMGTGFTLSLVVLSSFREIVGAGTWFGA
    QVMPGWYLGFEFLVRPPGAFVCLGIMLGLINVISARLDARKTA

    >gi|258404665|ref|YP_003197407.1| electron transport complex, RnfABCDGE type, A subunit [Desulfohalobium retbaense DSM 5692]
    MQEYLLMIVSAVFINNIILLQFLGLCPFVGVSNKMDSAIGMSAAAMFVNVLASSICWIIQKYVLVPLDLVYLQTLAFIVV
    IATLVQLVEIVLQKIAPPLYRSLGIYLPLITTN
    CMIFGVAVLNIREEHTFMQAVVYAFSTALGFSLVLIFMAGLRERFTI
    SRIPQAMQGFPIALVTACMMGLAFFGLIGLA

    >gi|258404675|ref|YP_003197417.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfohalobium retbaense DSM 5692]
    MKKYEVAVVGQGPAGLSAAIYTARAGMSTLVLGCEPKVSGDYDIDNYFGFPETITGRELLERGKRQAKRFDVQMRCDRVL
    GIHPTENEEFEIKTETGKVRACSVILATGVSRIRPGIEDLSEYEGKGVSY
    CVSCDGFFFRNKQVMVVGEGIFAANQALEL
    TQYTPHVSVCSQGKPLTMTESFQEKLQEAGIPVKQRKIERVEGNDVLERVIYDDGSEEAVDGLFIALGEASSLDFAYSLG
    VMRNGVFLQVDEEQKTSFPGVFAAGDCVGRFLQISVAVGEGAIAGRSAINFVKKQCREKGKS

    >gi|258404900|ref|YP_003197642.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfohalobium retbaense DSM 5692]
    MSPLFRKKDESSQEQQWFLPQEQQTYLRELFQQLNAPVQIHLYTAKGTNDAYNDFARKFCTDLARLSESITVHEHDLQEE
    SAQNGKVTRSPTLLINPEQFNIRFTGAPAGEEGRSFIQTLLLVSTKNTELGAESKQLLHDLDDERRIRVFVNPN
    CPYCPG
    QCINAIKAAVQRPDLVSAECVETVENPDLADTYAVGSVPHTVINEWEASKGLLPLEAFLYELVTLTPVQEALDASEETHS
    HAERPVESCDVVIVGAGPAGLTAAIYLERAGLQTVVLEKDIIGGQVAVTPVVENYPAFTSIGGKQLMEMVESQAREYADI
    REGEEVEEIKVGKAIETLTRRSTYHSKSLLLATGATWKKLDVPGEDRLFGKGVGY
    CATCDGYLFKEKRVHIVGGGNTAVT
    EALHLKNLGAEVALIHRRDALRAEPHLQRSLEHENIPVLWNTIVEEIVGQDKVTGLRLKNVQSGTPQEVATDGIFIAVGE
    SPNTQLARDLGITLDAHGYIQADRSCRTTIPRIYAAGDAIGGVNQIVTAVGEGATAALSIFHDWQKTNRNT

    >gi|258404987|ref|YP_003197729.1| Redoxin domain protein [Desulfohalobium retbaense DSM 5692]
    MRSLLVWAAVTAALVFGPLTAGATQSASLPRYSVDTVLQTISEARGQVVVLNFWATWCAGCREEIPELVALREKYADHEV
    LIVGLSLDTDPGTVRAFLERFPVNYRMAHAAGDIQMLYDLTTIPKTIVYGPKGQKQLDHTGFMSTGDLTQTIDPLLTHEH
    NN

    >gi|258405077|ref|YP_003197819.1| Methyltransferase type 11 [Desulfohalobium retbaense DSM 5692]
    MGTQDTKDATRRAVREQYGHVAQEGEGCCGPGCCGAAATDIKDLSAQLGYSEAELQAVPGGANMGLGCGNPQAIGALQAG
    ETVLDLGSGGGFDSFLAARAVGETGRVIGVDMTPDMLSKARANAEQGGYANVEFRLGEIEHLPVADASVDVILSNCVINL
    SPDKPQVFAEMYRVLRPGGRVAIADVVARSELPETIRTDMRLYTS
    CIAGASLVSEIENMLEVQGFTQIRIQPRDESTTFI
    AQWAPGTDVQDWVVSATIEAVKPGV

    >gi|258405119|ref|YP_003197861.1| Heavy metal transport/detoxification protein [Desulfohalobium retbaense DSM 5692]
    MPEVTVKGMSCQHCVQAVTNALESIDGIANVQVDLSTGRVEFEQSGEIPEPQIRQAVQDAGYEME

    >gi|258405182|ref|YP_003197924.1| Rhodanese domain protein [Desulfohalobium retbaense DSM 5692]
    MPNLKTLMVLLLTGCVLLAFANPATALFGSKFEEELETEKAAVKLVRDTKRGGYELVDTATLKQWIDNGKEMLIIDTMPF
    EASYAKQHVPGAEQFLFPKGDMPQWDSEQTAGKTKQDFQQLLGPDKDKLIVVY
    CGFVKCARSHSGANWAVKLGYTNVYRY
    PGGIFAWKGADFPIGSVE

    >gi|258405324|ref|YP_003198066.1| Thioredoxin domain protein [Desulfohalobium retbaense DSM 5692]
    MSAQNAIPTNGVALLDFSASWCGPCRALSPVIDELSQAYDGRARVQKIDIDQHKDLALKMGIQSVPTVIVFKDGEEHKRL
    IGMSSKTDLQKALDGALS

    >gi|258405347|ref|YP_003198089.1| alkylhydroperoxidase like protein, AhpD family [Desulfohalobium retbaense DSM 5692]
    MSKQISELEKMVANFRAFRHHLPDVGEAYDCLPAEAHKDGVLSGKVKRLMALSAALTHGCKACILYQTEEALKLGASVEE
    ILESCAVAMSLGGTMAAGETPRVMEYLQEKGLV

    >gi|258405371|ref|YP_003198113.1| Redoxin domain protein [Desulfohalobium retbaense DSM 5692]
    MSERSGLITMKGNPLTLTGTPLTVGDTVPDVTLLNTGLEPVRLSDYKDKVLILASVPSLDTSVCSEETKRFNAEAAQLSP
    EINVLTISMDLPFAQKRWVDTYLATNVTTLSDHKDATFGTSFGVLIKELRLLARAVFVVGKDGTLAYQQLVGEVTDPPDY
    DAALGAARQQVSA

    >gi|258405432|ref|YP_003198174.1| Rhodanese domain protein [Desulfohalobium retbaense DSM 5692]
    MQVSELYPEDVETFQRQHREREYTLVDVRQPEEYREEHIPGALHLPLPELEDRLDQLPRDRELLFYCRSGRRSATAAALT
    AQSGQSFKALYNIQGGIAAWQGGIVEQVPRVDRFDMSRGAGELLRRAAAMEKGAQRFYTVLAESNALSARLRQTAAELAD
    LEGRHAQSVYTLLTRQEAIPDFDPFFASLDDTILEGGQDLGEALAQWTQQGDLTCLDFLELALDLENKAYDLYKTLAENT
    AQGQERSHFLTLAEQEKAHLRVLVNHLPECG

    >gi|258405434|ref|YP_003198176.1| protein of unknown function DUF255 [Desulfohalobium retbaense DSM 5692]
    MSQTLVNRLAESGSPYLEQHAGNPVAWQPWDDQALATAHRLQRPIFLSIGYATCHWCHVMERECFEDTEVAHILNTVCVP
    IKVDREERPDLDTFYMSCCQALSGRGGWPLNLFLTPDGRPFFAATYIPKQSRFSQPGLLDLLVSVQEDWVRNREQIEQSA
    TRLVSHIHDLFSDSSGPLPENAIFEQAVQELRQNHDDDFGGFGKAPKFPTPHVLLFLLRLYDLSQDRSLLNMVDSTLEAI
    CRGGIRDHIGGGFHRYSTDRAWHLPHFEKMLYDQALLLMALAEGHARTRRDLFRREAVAVAEYMLERLHDGDGGLYCGED
    ADTEGEEGAFYQWTETELEAALPPDTFRVVQTVAGIRSDGNILDEATRQRTGKNVLARVADTADAAERLGLSEEQVRLEW
    HRAMATLGGLRAQRPQPFLDDKQLTSWNGLAVAALARSGILLGEEHLIAAARETADWVLETMQPEPGRLWHRARNRHAGI
    PGFLEDYAYFIWGLLELVQTSEGQDYRRIALRLADTVLSEFADLKEGGFFQTHAAAQEPLLRLKKVFDDALPSENAVMLY
    NLVRLYGSGPTNDCARKHLRGVSGIVRQHPQGAVFTLFAASFLRPLEGHGTWREK

    >gi|258405460|ref|YP_003198202.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfohalobium retbaense DSM 5692]
    MPERFDVIVLGTGPAGGVVAKECVAAGLSVAAIDKGDFGGTCPLRGCEPKKVLVDAADAVARASNMQGNGVTGNFGLEWP
    SLHRFQRSFVEPIPKAVQHSLHKAGITTVQGVPVFTGANTLSVEGRQFEAEHIVIATGAQPRQLPVPGNDLALTSDDFFH
    LSSLPSRLVFVGGGFISFEFAHVAALAGAEVSIVHRSERVLRPFDPDLVARVEEASRQAGIRIYKDTPVHSLSEDGSEVV
    LTAGPEGTQRFVADAVVNAIGRVPSIDGLDLENAGIEWSEHGVRVNEFMQSVSNPAIYAAGDVAEPGQALTPVAVMHAET
    VVHNILNGPSKTADHSGTAATLFTYPPLARVGMLESEARETDPDCVVKHRHSENWSEYQRLGQQYAGYKIVFSGDRQRVL
    GAHLLGDGAEEVANVFALAVRKGLSVASLQDMLWAYPSFGYTLRHMLG

    >gi|258405529|ref|YP_003198271.1| glutaredoxin [Desulfohalobium retbaense DSM 5692]
    MADITLYALSTCVHCKHTKEFLDECNVNYDCIYVDRLSGDERNDTIREIKKLNPNLSFPTLVIGDTIIVGYKKEDIEQAL
    ENHS

    >gi|258405620|ref|YP_003198362.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfohalobium retbaense DSM 5692]
    MPSFDYDVGIIGGGAAGLTTASGSARLGAKTLLIEKEPALGGDCLHYGCVPSKTLLHTAKLYHQARTMHHFGLPEVELPP
    VDFAQVAERIQSVIDTIQKHDSVERFCRLGALVEFGSPEFKDEHSIRLEGRTISARTWVVATGSSPAVPPIPGLVESGYL
    TNKDLFSLPQLPKSLVVLGAGPIAVEMAQAFTRLGTEVHVLQRSGQILSKEDKDMADMALSRLLAEGVRVHLNVAVQQVE
    KTGDGRVVHFTNYDGEAQRLETENILVALGRRPNVEGLGLDNAGVVTSAKGIEVDDRLRTAQKHIYAAGDVTGRHLFTHA
    AGYEGGIVVSNAVFHVPRKVDYSLLPWCTYTDPELASIGYNEKRAAADGMEFTVHRQEFAANDRSLAEGEEMGQIKLLVD
    HKDKPLGVQILGPHAGELVAEWVAALNGGVKTTTLAGAIHPYPTLAEVNKGVVGKLLEPKLFSEKMQKALKFFFHFKGRA
    CGIDGVHD

    >gi|258405700|ref|YP_003198442.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfohalobium retbaense DSM 5692]
    MLQSDLCIVGGGPAGCKAALDAAAAGLKTVLVEREHLGGTCLNWGCIPTKLLLGAVAPKTEADHLRRLRLVSGNVEVDPA
    ALRKRIQSVLTASRKAMRDRLAAAGVQLIMGQARFTSPNRLCVEGEDNATTEVAFTTALLACGTSPQHIPGLKPDGETIL
    DSNQILDTLPQPASLAVIGAGAIGLEMAEYFHASGSRIALIEMQDRLAPLEDPDVSRQVLRAAKKRKWEIHTGCRVERAE
    QTADSVTLHLDSGTAVQAEMVLVAAGRQPNSAGLGLEHTGAEIEGHGWVTVDGYLKAAPNVYAVGDINGRTLLAHAAEDQ
    AAYAVRHLTATTASPYAEMPPPSCVYADPEIMRVGWSVADLQAQGKPVQTAQVPLAANPIAQAHGQTQGLIKTIWSGDRL
    QGITAVGCRVSHLVTAAEIMVCQGWTKEDIPGYIFAHPTLDESLRDAVLAERADVS

    >gi|258405901|ref|YP_003198643.1| Carboxymuconolactone decarboxylase [Desulfohalobium retbaense DSM 5692]
    MRMLAQLFPEFTEKLDEMDALYKEKRLIDEKTYQFICFALSIKARSQPCVRKHYKEALDAGATAQELAYILALVMREAAG
    ADDCWVHDVLHDCAEIAAGSVECGCQK

    >gi|258405902|ref|YP_003198644.1| redox-active disulfide protein 2 [Desulfohalobium retbaense DSM 5692]
    MRIQVLGPGCPNCEKTEQIVREALQEAGVEATVEKVSDFQEIAQMGVLSTPAVVVDGQIKVTGKVPKKQDVLGWIGAAP

    >gi|258405908|ref|YP_003198650.1| Redoxin domain protein [Desulfohalobium retbaense DSM 5692]
    MRRLRVLSLTICLVGIVLLVGTISTASTGQYKGAISADKLEQMIDEERSDKVVLLNFWATWCSPCRREMPELAQLRRDFS
    PEELVILSVSLDYNSKVIPHFVDQFGLNFPVYRDGGGVAQQFEVAAVPKVMLFTQNGLVMEHAGYVPPAMLRRVVEQALD
    KQ

    >gi|258405954|ref|YP_003198696.1| protein of unknown function DUF395 YeeE/YedE [Desulfohalobium retbaense DSM 5692]
    MSEIWLGLFSGIAFGFVIQRVGATNPDKMAKAHLMVESGIPRFMLLAVALSAIGLLGLQAADVGRTMIHPTSLVATGVAG
    VIFGVGWGLAGY
    CPGTCWAAAGEGRMDAIFAFLGGLAGAAAFAHVHETLIPTLYMPTNVGQITLAEVFGSPGLAVGILAV
    GLGICIWLIGLLWKDGGRDA

    >gi|258405955|ref|YP_003198697.1| protein of unknown function DUF395 YeeE/YedE [Desulfohalobium retbaense DSM 5692]
    MKEHKTSAYWAWFPAAIALAGIIVFIFATFGPPASSSGFIAVLKGALGKIAPDYVAGKTHYQILPGPGSWLMAFVLGMAI
    GGFFAGRTFRIPIRDVPRLWERRFGPSKSLRYGCSFLGGFLILFGARLAGG
    CTLGLFISGSTQLAVSGLYFGVVIFAVAM
    LTARLVYGKTAKEADHE

    >gi|258405956|ref|YP_003198698.1| Rhodanese domain protein [Desulfohalobium retbaense DSM 5692]
    MQDRKILRFILIAAVLLLGVVWSLASAEQPGTQGHSGYPNGQFLCTAQWLKTQGQDQGVVVIDVRNDEHFDNTLIPGAIR
    MPWSLFRTNDRAGNLADIFVGLDKAQEILGEHGIARGSTVVLYDSVARDGGATASYVFWVLDMLGHENKIILERGIDGWK
    EAGGDLAQQPAELESVLYQAPAEEMVPQRGVNGDFIAKRLGDPYYQILDVRSQGEYTGELANTALDGSVLKRGHVPGAVN
    IPDASNWTDEKTKDIKSYADLQQLYRGLDPGKAIIPY
    CHSGRRGSFGYFILRLMGFSDVRLYERSWNEWGQHSRFYPVQA
    AVQRPTGSSLPQGSSAQAPAAASGPSTQPAGASKPAPKSGSSSGGYVSCGG

    >gi|258405997|ref|YP_003198739.1| heavy metal translocating P-type ATPase [Desulfohalobium retbaense DSM 5692]
    MDASTSTPHKGTFSITGMTCAACSSRIERTVNKMEGVQEASVNLAAETMQVSWDPVIVSAEDIVQAVKDAGFNAQPPSSH
    QQLQLGIRGMT
    CAACSARVEKALGKLPGVDQAQVNLAAETASVTLDPNKLRFADLQKAVADAGYEAVAMEDSDSAEDQRQ
    QELLDRLHTMRQRLWVAVAFTIPLLIVSMGEMLGLPLPVWLSPQHAPLNFALTQFVLTVPVLWAGRDFYLHGFPNLYRLA
    PNMDSLIAVGTSAAFVYSTWNLLEIMIGNSPVSRAMDLYFESAAVILTLVSLGKYLENRSKARTSDAIKELMQLRPETAT
    LVRGEELVSVPIQDVRPGDTLLVRPGERIPVDGTVVEGHSSVDESMLTGESLPVGKRIGDALVGGTYNAHGSLRMQADKV
    GKDTTLSRIIQLVQEAQGSKAPIASLADTVSLYFVPTVMAIALTAGLAWFFVGQTEFTFALRIFIAVMVIACPCALGLAT
    PTAIMVGTGRGAQLGVLIKSGAALEMARKVGAVVFDKTGTLTFGRPELVHTDYMEQDGLDQTTIARLVAGVEQESEHPLA
    QALVRGLSQEEAILPRPDSFEAVPGKGIRSRIAEHDVLIGNAAFLRDEGIAGIDDPSSQETIRQQSDQGATPIAIAVDGR
    AAAIFGVADTVKDEASEVVHRLNDLGLKVIMLTGDNSRTARAIAERIGIDDVVAEVLPENKAAAIQDLQQQGHKVAMIGD
    GINDAPALAAADLGISMGTGIDVAIESGDVVLMQGRLTGVLDALELSRATVRNIKQNLFWAFFYNILGIPVAAGLLYAFG
    GPTLNPMIAGAAMAMSSVSVVTNALRLRFFQPSYAMR

    >gi|258405998|ref|YP_003198740.1| hypothetical protein Dret_1878 [Desulfohalobium retbaense DSM 5692]
    MIELTPGAKAQLDKHFTGQEEIPAIRVYMAAGCGGPRLALALDEQKETDDVATVEGYTFVADKNLMQSASPVTIDASPYG
    FSVTSPGIDMGGGGCSSCTSC

    >gi|258405999|ref|YP_003198741.1| hypothetical protein Dret_1879 [Desulfohalobium retbaense DSM 5692]
    MVELTPDAKAQLDKHFEGQESIPSIRVYMASSCSGPGLALGLDEKQETDDVFDVEGYSFVVDKSLVIAASPITIDAAQYG
    FSVSSNLEMTAGGGAGCSGCSGCG

    >gi|258406027|ref|YP_003198769.1| Thioredoxin-disulfide reductase [Desulfohalobium retbaense DSM 5692]
    MQIYDATVIGGGPAGMTALLYLMRAGLQCAWVEAMAPGGQVLRTEQIDNYPGFPEGIKGYELADLFAKHLERFSYDSYTE
    EVTGLETNGDGVHTIRFRDDTIQSKTLILCSGAEYKRLGLPREEEMTGRGVSY
    CALCDGQFFKDQTVACIGGGNTALEDA
    LYLSKLAQKVYLIHRRCDFRGCQFNQDRVRQAPNVEILLDTVPTELLGSDEIHGLRVQNVKTEQTRDLDVQGVFIFVGTQ
    PLSGYVSENITCDQAGFVVTDAEMRTNVPGVFAAGDVRSKLCRQVSTAVGDGATAAHAAGLYVEEMNNGQ

    >gi|258406028|ref|YP_003198770.1| thioredoxin [Desulfohalobium retbaense DSM 5692]
    MANQVTDANFESEVLQCDLPVLVDFWAPWCGPCRAIAPVIEELAKEYTGRVKIMKMNVDENPTSPNKYGIRAIPTLILFK
    NGEVVEQLTGAVSKASIKDLLSEKAL

    >gi|258406085|ref|YP_003198827.1| quinone-interacting membrane-bound oxidoreductase complex subunit A [Desulfohalobium retbaense DSM 5692]
    MSKAILVIGGGFAGITAALEAAEVGHEVYLVEKGPFLGGRVMQLNKYFPKLCPPSCGLEIQFQRIKNNKNIKCLTLSEVT
    AVSGQAGDYEVKVKVKPRHTAPNSVDLSGLAAKLKQSIKDDFEFGLAARKALYMDVPFAFPHRYVLDAGALSEEDRAMLK
    EHEAIDLEAQEKDLTLNVGSIVVATGWKPYDVTNLENLGAGKLDNCISNMQMERLAAPSGPTSGQILRPSDNAAPKKVAF
    VQCAGSRDENHLSYCSYICCMASLKQAQYLREQYPDSEVTIYYIDLRTPGRYENFAKKILDDPKVHAVKGKVAEVELDDA
    GEDVWVTVEDAVSGAKGQEKYDMVVLATGMQPSLAGEKLPFALQLDEEGFVTGNEQGIFAAGCAKQPLDVMKSAQSATGA
    AMQAIQTVRGR

    >gi|258406213|ref|YP_003198955.1| UBA/THIF-type NAD/FAD binding protein [Desulfohalobium retbaense DSM 5692]
    MEQLDKEIRAAAVSETAVLRILPEQSGSEIAARTGVSLHDVEGAALELDILPQRYRRNWAALQVAEQLLLHRSTVALAGL
    GGLGGYVLELLARCGVGSIRGVDGDIFESSNLNRQLLSGQSTLGQAKAEAAALRVEEINPAVAFSATLATLDQDGFLQWL
    EGSDLVIDALGGTRVRLALHRAAAELGLTVVSAAVAGATGVVATIAPGDAGLRALWTDEQGAEEDMG
    CLPHGVAVLAGMQ
    SAEAVNILTGHGAALQGFMGALDLNDFSWERMEIG

    >gi|258406344|ref|YP_003199086.1| methylated-DNA/protein-cysteinemethyltransferase [Desulfohalobium retbaense DSM 5692]
    MSEPRLAGTEHLVTSPLALSCTWQEGRLTRIRLHIPAQGQRSSLLSEWGEVLLHSLETYADGKPTAWPALPLAWTTVPPF
    ARTVLEALAQTVGWGEWTTYGGLAQACGRPKAARAVGRIMSCNPWPLVVP
    CHRVLGAGKQLGGFSSGLDQKRLLLGLENI
    L

    >gi|258406374|ref|YP_003199116.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfohalobium retbaense DSM 5692]
    MASQRILVVGGSAAGPKAAARAKRLDQDAHVIMIQKAPELSMASCGYPYYVGGFFDRREELLCTPTGVVRDENFFAGAKG
    IEARTETEVVAIDREAKQVSCKDLRSGETYALDYDKLILATGATPRMPPIPGTDLDGITTLHAMRDADYLRSLRDEGGVR
    KAVVIGGGLIGIETCEALQLAGMEVTVVELLPQILMFLDWELAKLLENHVKEKAANVITDNAVSGFLGQNGKLSGIKLQS
    GTELECELAVVAIGVQPNVQLAREAGLDIGVTGGIAVDEQMRTSDPAIFAAGDCIEVPDRLTGKKTLAPYGDLANLEGRV
    AGENAVLESGATFPGTQHTGICKVFDYAAGSTGLSERKAREAGFNVLTGVNASLDKPGFMGGKLLVSKMVVDADSQRMLG
    YQCVGPGDVSRQISEAAMAIAGKQTIPDLVNADLPYAPPFSLAIDHLIAAAHIVENKLKGRMVGIANTEVKAKLDSGEHP
    FFLDVRGPAEFEAMRLGLGETLIPLGKLRDRLGELPQDKDKEIICY
    CKISMRGYEAQRILWAHGWTDIKVMEGGIMAWPY
    GREK

    >gi|258406380|ref|YP_003199122.1| methyl-viologen-reducing hydrogenase delta subunit [Desulfohalobium retbaense DSM 5692]
    MQAPRIAVWLCGCQGQISDALDLEALAATVREWPHVVHVETAAGCCNPAATEGFRKRFADAGADRLLFAGCSPRSSLKFP
    EEEIAAALSGVVDSSLFEVANTREQGVWLHEAGPGLEAKALDELRMAHARLCTATPSSPPVPVAQRALVVGGGPAGLATA
    KELAGMGREVTLVEQAPSVGGRMAQIRLLFQSEQWDGRCLSL
    CVGPVQALGTLVQRKVTAFTQTEVTSITKHEGNFRARL
    SSAAQPVDPAACVACGACSAVCPEFGHSGFNEGLFARKAIDKDAPRAVPDAYTILDDVCTRCGACEEVCPAGAIDLKAEP
    EERVQDYGAVFLATGFETLDLSQEQAFHTDAPNVVHGMQFERMLDQGITNPQTGEAPEHIVFVLCAGSRATADKSTGGVP
    YCSKTCCGATMRQAQQVARLLPETAVSILYYYDVRTYERSFEAMYDMVQKMGVEFVQGDLTAIADAEDGAVRLTIRQIGE
    QTTSSMGEFEFDPEGHLDIDADLVVLASAQTPRQQARRLADQLGVALDNVGFPIENQPRIFRPTECFVDRVYYTGASSGP
    KVVQQAVEQGKAAAMTALPALHFGQKTPPKHSSHLNRETCIQCRMCETVCPHGAIRLTEEGMVADPAFCQACGLCAAACP
    THAAQLANFTDRQLLDQAEVAFSALPEGEPRILALLCYW
    CSYCGADMAGTERRKAPSNVRSIRIRCSSSVNTGLLLEMFR
    RGVDGILVGG
    CPTKSCHHLHGNYLADKRIGLAQNLLEQLGLDSNRLRFANIGVAHGKEFVDIVGAMDGILRKLGPNPAAQ
    DRLKQLV

    >gi|258406384|ref|YP_003199126.1| methionine-R-sulfoxide reductase [Desulfohalobium retbaense DSM 5692]
    MKTLLFAFVLIIAGAGQLHASKNSATAYFAGGCFWCVEADLEKRPGVKEVVSGYSGGEEPDPSYEEVASGQTGHRESVKV
    IYDPEIVSYTTLLDHFWRSIDPTDPGGSFGDRGHQYTSAVYYQNEDERQAAEDSKARLDASGRFDAPVVTAIEPFTGFFP
    AEEYHQDYYQTHAVRYTTYRFFSGRDRFLESHWPKNQDSANKGPRSADNSSREDLQSRLSPIQFEVTQNDGTEPAFDNAY
    WNNKQPGIYVDVVSGEPLFSSTDKFDSGTGWPSFTKPLEPENIIEREDRKLFMVRTEVRSRQGDSHLGHVFADGPEPTGL
    RY
    CINSAALRFIPADDLASEGYARYEDLFQE

    >gi|258406435|ref|YP_003199177.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfohalobium retbaense DSM 5692]
    MRIGVFVCHCGSNIAGTVNVQEVAETARDFPEVAFATDTMYACSEPGQEGIVQAVQEKGLDGVVVASCTPRMHEPTFRRA
    VQRAGLNPYMFEMANIREHVSWVSKDVAANTDKASELIRMAVEKLRRDRPLISEKFDVTKRVMVIGGGVAGIQAALDCAD
    GGLEVVLVEKSSTIGGKMAKLDKTFPTVDCSS
    CVLGPKMVDVAMHPNITLYAYSEIESLGGYVGNFEATVRRKATYVDWE
    KCTGCGLCMEKCPSKKAYDYFNEGISTTTAINIPFPQATPKKATIDADYCRRFTKGKCGVCAKVCPTEAINFEMQDEIVT
    EKIGAVITATGYDLFDHSKYGEYGGGRFADVITSMQYERILNASGPTGGHIKRPSDGKEPENVVFIQCVGSRDKSVNRPY
    CSGFCCMYTAKQTILTKDHLPESQSYVFYMDIRAPGKMYDEFTRRAMEEYGANYIRGRVSMIYPKGERYVVRGVDTLLGT
    QVEIDADLVVLAVGAECADGAEKLAETLRISYDTYGFYMESHPKLRPVETNTAGVYLAGACQGAKDIPASVGQGSAAASK
    VLALFSKDQLEADPQVAQVQLARCVGCFKCVNTCPFGAIQESQDRGGNPKAEVIASVCQGCGICNVTCPQGAIQLQHFTD
    NQILAEVSALCQPKMETSSA

    >gi|258406511|ref|YP_003199253.1| Peroxiredoxin [Desulfohalobium retbaense DSM 5692]
    MENRIPLLGEKMPQLEVTTTHGTINLPGDYSGKWFVLFSHPADYTPVCTTEFVAFQQRSQEFKDIGCELIGLSIDQVFSH
    IKWIDWIKETFDVDIEFPVIADDMGKVAAQLGMVHPGKGTNTVRAVFIVDPQGALRTMLYYPQEVGRNMDEILRTVKALQ
    MSDTNGVACPAGWPNNEILGDRVIIPPATDHKTAKERKAQSDCYDWWFCHKIV

    >gi|258406602|ref|YP_003199344.1| Rhodanese domain protein [Desulfohalobium retbaense DSM 5692]
    MPVWMMWTLGIAGVFLAWEPLWSLLGGGSVSVSHLRRWRQNGRVFLLDVRTGPEFSWRHIPGAIHRPDLLWGSRALPLPK
    DRPVVVV
    CLTGHRSPVVAWRLRRAGFENAFSLHGGMVAWLLAPGNKEERQ