Desulfococcus oleovorans Hxd3 uid58777

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|158520148|ref|YP_001528018.1| thioredoxin domain-containing protein [Desulfococcus oleovorans Hxd3]
    MKGRFQSACLALFIVAGLLIGGAPAIFAADQTRDGIRWFSYDQGLARAKAQQKKVFLHFYTNWCRYCDMMAASTFVDKKV
    IDTLNQDFVSIRVNSDEVRDVAGKYQVRGVPVSFFLEANGGQIGSRPGFLQPDVFLRLLEFVKAEGYKP

    >gi|158520326|ref|YP_001528196.1| RnfA-Nqr electron transport subunit [Desulfococcus oleovorans Hxd3]
    MSTEPTPMERFLQGIIPENPVYRQLLGLCPVLAVTGNMQSAMTMAGAVLFVLFCANVMISLIRNILKPHLRIVIFTLTIA
    TFVTIVDRFLAAYMYNMSKALGPYIPLIIVN
    CIIICRCEVCASKQSVFHAGADAIGQSLGFALALASIATVREILGTGMF
    FGLPVLPDVWPDWVIMALPPGAFFTFGLLLGLVNWFTANRAKKEKNS

    >gi|158520327|ref|YP_001528197.1| RnfA-Nqr electron transport subunit [Desulfococcus oleovorans Hxd3]
    MNYIIDIFLIAMSAALINNFVLYYFVGICPFIGVSRNISMAFGMGCAVTFVITIAAFISWAITTFVLIPGAPLTAFVAGF
    FLPGEQAAAVDLTILSYIVYIFAISSSVQFVEMYVRKFFPPLYKSFGVFLPLITTN
    CAILFACLTIMSNVAVDNPAEAWD
    LGRALVLAIFGGVGFTIAIVIMAGIREELDMCDVPKPLQGAAITLVTAGILAMGFMGFTGVDSGLKKALKPEPAQEMSIN
    LQDAAPVLARVTIEN

    >gi|158520438|ref|YP_001528308.1| heavy metal translocating P-type ATPase [Desulfococcus oleovorans Hxd3]
    METVQEKRFRVQNLDCAACAAKIERELQNTEGVEAAVVDFANLTLHLRAADISKALAAVARIEPDVKIESTLQDSEGDAH
    ESTEAGNFRKQVGIIVIAGIIFAIHLFFEDQLHQRPWAWVEYPIVIAAYLLAGWSVLIGALRTLRRGQFFDENVLMVIAT
    TGAMAIHALSEAVGVMLFFKVGELLQDMAVSKSRRSVRGLLAARPNRALLKTEGGLKETSPEKVKVGEIILVKPGEKVAL
    DGTVIEGVSQVDTSPLTGEPVPVQTRPGDTVLAGSINTASALTVRVTKPFEASSIARVLELVESAAARKAATEKFITTFA
    RYYTPVVVAIAAAIALVPPLLINDAQFSTWIYRALVLLVISCPCALVVSIPLGYFGGIGRASRSGILIKGSMFIDALSKV
    KTVVFDKTGTLTRGVFTVDRVVTDNGFSSDQVLQMAAAVELHSDHPIGKSIVEAMTSKGLAIDESLVSNHVAISGKGVKA
    VFDGKSIAVGNDALLHERQIDHGKCDFDSTVAHVVVDNQYAGHILIGDQLKPDAKLAMERLRSDGVSKLVMLTGDNACAA
    ASVAKALNLDQFHAELLPEDKVRIFEQILAETKEDGKVAFVGDGINDAPVLARADVGVAMGALGSDAAIETADVVLMTDA
    PAKMADAVSIAKNTRKIVLQNIVLALTVKGIFILFGSFGLATMWEAVFADMGTALLALLNATRAFRGYPSLKEVHVKNAS
    V

    >gi|158520536|ref|YP_001528406.1| vitamin K epoxide reductase [Desulfococcus oleovorans Hxd3]
    MRARNFFKQGPPLAYGWYFIPVFVIALIGFGDSIYLAVSHYRNYVDMGYQSFCAISRSLNCDTVSQSPYSIFLNVPVPVW
    GIFGYGFFLFLLGVAWHPTAGRKRVWTLLFVISLAFSVYSVVLALISSYLIRSYCIMCILSYAVNLALLFYAWMIRKRFG
    CEPFASALVLDIRHLLNFKKTTIPVAAVFGVVGLAMMLAFPDYWHLSPPPLSAQTRTGVTAEGHPWIGAQHPKLEIVEFT
    DYM
    CFQCKKMHFFLRRLVDAHPDTLRLVHRHFPMDHEYNPFVKEPFHVGAGKLSLIALYAQTQEKFWEANDLLFTLGKAD
    IKLKDVLNPLGLEVTGLADALENRGLERVLRQDIHDGLRIGITATPCYVIGDYAYVGTIPANIINEAIRR

    >gi|158520779|ref|YP_001528649.1| arsenite S-adenosylmethyltransferase [Desulfococcus oleovorans Hxd3]
    MNTMKNDDIREKVRQAYGKVAASGASGCGCAAPSCCNGAVNATDLAMGLGYSAEDIAAVPEGANMGLGCGNPGAIASLKP
    GETVLDLGSGGGFDCFLAGRAVGDSGQVIGVDMTPEMVAKARRNAEQLGAENVEFRLGELENLPVADGTVDVVISNCVIN
    LSPDKERVFKEVVRVLKPGGRVAISDVVATAEMPDTIRNDPLMLAG
    CIAGAVSVSSLEAMMKRAGFKNIRIQPRVESRAF
    IRDWMPGSRAEEYVASAVIEAVKPPA

    >gi|158520858|ref|YP_001528728.1| redoxin domain-containing protein [Desulfococcus oleovorans Hxd3]
    MAQIKFKGNPINTCGELPKVGTKAPDFLLTRTDLSDFSLADVAGKMVLMNIFPSIDTSACSMSVRTFNSRITQFFKTVLL
    SISLDLPFAHKRFCETEGIENAISASELRNRKFGDDYGLRITDGPLAGLLARAVIVLDEAGTVRYTQLVPEIAQEPDYEE
    ALNALKTAATETDSCTYTETAEHARPFSSDEPCDDGRSG

    >gi|158521016|ref|YP_001528886.1| heterodisulfide reductase, subunit A (HdrA) [Desulfococcus oleovorans Hxd3]
    MATDNSTSANGSIMVVGGGISGLTTALEAAEVGYEVFLIEKEPYLGGRVAQLNQYFPKLCPPSCGLEINYRRIKDNRNIR
    TYTMAEVEKVEGGPGNYKVSIQLNPRFVNENCTACGDCVAVCPAERSNNFNFGMDKNKAIFKSTDMVFPMRYAIDGAACK
    GTACNKCVEVCQYNAIELDMKPKVIELQVGSIVWATGWEPYDATKIDTLGFGKYKNIITNMMLERLASPNGPTQGKIVRP
    SDEKAPESVAFVQCAGSRDENHLPYCSYICCMASLKHATYIRERYPEAKVYIFYIDLRTPGYRYEKFYNTIKEDPNIFFI
    KGKVAEVKEAAGSNITVVAENAVTGEKTEQTVDMVVLATGMQPTAARQKLPADLQYNEDGFVLNDFDKGGMFAAGCANKP
    LDVVSSNQNATGMALKAIQTLKR

    >gi|158521069|ref|YP_001528939.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfococcus oleovorans Hxd3]
    MSRRIVVVGGVALGSKAACRAKRVDPEADVYLIDRDEYISYGGCGIPFYISGDVSDVSELRSTSFHMLRDERFFLKDKGV
    VALTGTEVTRIDRQGKTVAIRRKDGTTDTLAYDKLVLATGTTPRMLPLPGRDLENVFTVANLHDALAIKEKVTEGSIGKA
    VVVGGGFIGLEMAEALADMWEIETSIVEVFDQIMPGFVSPSLATMARKTIEDKGVRVYTSEKVEALVGEGAVSAVKTDKR
    TLDADMVIMAVGVVPNTGLAKEAGLEVTPQGWIVVNDQMQTSDPDIYSGGDCAAVKNLVTGELGYFPLGSMANRQGRVIG
    TNVTGGSARFDGAVGSFVVKIFDNALAGAGLTADRASAAGFDAVGIQVAQFDRAHFYIEKEVIFLELVVDEKTRRVLGIQ
    GFGGKDSGMVARINAVAPLLKYKPGVEEISNLELAYSPPFASAMDIINALGNAASNYLDGRYRPMTMEAFAACWENRSCG
    DTFFLDCRANADAQPFADKYPEIWKSIPHDQLVDRMDEVPKGKKLVLL
    CNTGVRSYEAQLNLNAKGITDNVSAGAGIAGL
    KTWGVDFGLDK

    >gi|158521172|ref|YP_001529042.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfococcus oleovorans Hxd3]
    MSQNSKPSGSVMIVGGGIGGMQAALDLADSGFKVHMVQKDSSLGGTMVMLDKTFPTGDCSMCMISPKMVEIGRHPNIEIH
    TLAEVTAIDGEPGRFTATVKLLPRYVDPDKCTGCGICEKKCPKLVTSEFEQGLTKRKAIYSLLAQAVPNTRVIDYDNCLY
    FQRGRCKACEKFCTAGAINFEDTGKEISLTVGAVILSPGLARHSAARHPELGFGRWPNVVSSVQFERILSASGPFSGQIL
    RPGDKKHPHKIAWIQCVGSRDTNHGNPWCSSVCCMYATKQAVIAREHDASVQPTIFYMEMRAFGKDFDKYVDRAKNQYGV
    RYHRAMVSAVHEDADTGNLVLRYAEMDGTITEETFDMVVLSIGLEPHADALEFAKTFNIESNRHGFAATTPFAPVDTTRP
    GVFVTGTFQGPKDIPETVIQGSAVAGKAMALLGEARGTEITEKALPPETDTTGAEARIGVLVCHCGINISQTVDIPAVVE
    TAKTLPNVVFADDLMYACSQDSQEAIKALVQEHNLNRVVVASCTPRTHQPLFQETIRDAGLNKYLFELADIREQCSWCHM
    GQNEPATKKAIDIVKMTVAKVKLFEAIHTDSVPVTPAAMIIGGGIAGMTAALALGDQGYEVHIVEKTSALGGLVKNVYRT
    LDGRDVQSFLTDCIQKVEQHPKVTVHTGTDIKKTDGFVGNFVTTLSDGAAISHGAIIVATGGVEYAPVEYEYGNSSSIVT
    QRELEKRLETETFSPTAAFAMIQCVGSREEPFNYCSRICCQDAIKNAIAIKKKYPKAGVTIFYRDIRTYGLREDYYQEAR
    SLGVLFVRFEPENKPEVRVDGDRVTVTAFDFLANRPVTVKADVLALSTGLRPHPSTEEVGRRYKLTCNPDGYFLEAHVKL
    RPVDFPSEGLFVAGLAHAPKNLDETVSQALAASGRAGVLLSHDRLSVSGIISKHNRDICMSCLACFRVCPFDSPFIDEEG
    HISHNEVKCMGCGICAGVCPAKAFQVNNFRDDQIIAMIDAIS

    >gi|158521183|ref|YP_001529053.1| methylated-DNA--protein-cysteine methyltransferase [Desulfococcus oleovorans Hxd3]
    MTRQKAETAETVTVMVDTAFGKCGLVFRENPFTIVRVFLPGVSIRGRQGRAGGHPEEAQAVAQALVDYFDGKKVKLPWRW
    FDMSEATHNQQKVLRAVFDIAYGTVQSYGEVARRAGFTGGARFVGNTMANNRFPILIP
    CHRVIRADGALGGFGGGTDLKK
    RMIELEQKTVLRAVKYNASRFRSR

    >gi|158521475|ref|YP_001529345.1| glutaredoxin 3 [Desulfococcus oleovorans Hxd3]
    MIKAIEIYTTGTCPFCIRAKALLDRKKVSYTEFRVDHTPAYVDEAVKRSGGRTTVPQIFIGEVHVGGCDELYALEKEKKL
    DALLGL

    >gi|158521523|ref|YP_001529393.1| thioredoxin reductase [Desulfococcus oleovorans Hxd3]
    MSETNYDLVIIGGGPAGLTAGIYAARARLNAVVVEKMAAGGQVLTSDWIENYPGFPEGISGADLMMRMSDQASRLGVALE
    YEEITAVDLSDPVKILSLGDKTITCKAVIIASGASPSRLNVPGEERFIGRGISF
    CATCDAPFFRDKVVAAVGGGDTAVQE
    SLFLTKFAKKVYLIHRRDALRATKILQERAFENKKIEFVWDSVVTEIGGGLTNVEKVTVKNVKTEETRDLAVDGCFMWVG
    IHPNADFLAGAVDTDKGGFILTDQAMATSVPGVFAAGDVRATPLRQIATSVGDAAIALHSAEAYIESME

    >gi|158521524|ref|YP_001529394.1| thioredoxin [Desulfococcus oleovorans Hxd3]
    MGDKVLSISDGSFEAEVIQAEMPVFVDFWAPWCGPCKAIGPLVEELAAAYEGKIKFAKCNVDDNPSTPTKFGIQAIPTLI
    IFKGGEVVERITGMVPKAKLEAALNKALE

    >gi|158521543|ref|YP_001529413.1| hypothetical protein Dole_1532 [Desulfococcus oleovorans Hxd3]
    MNANTPGSNHLADEKSPYLLQHADNPVDWYPWSDAAIARARQTDRPILLSIGYATCHWCHVMAHESFSDPDTAALMNAHF
    VCVKVDREERPDIDRLYMTAVSAITGSGGWPLNVFLEPHALAPFFGGTYFPPRPGRTLMITWPDLLQQIADAWENPDKRS
    SLLASADSITTFLESALTGTRHRPAEGDAELTGIYKKALDAFTGMYDSQSGGFGPAPKFPMPAIINFLLACAATDPAADL
    GLDTRQREKALGMAIHTLSAMARGGIYDQLGGGFHRYSTDERWHLPHFEKMLYDNAQLLACLADAYALTENNSLLCRARQ
    TADYILKEMTHPEGGFYSAQDADSPESAGAGKKVEGAFYVWEAREIESLLDAPAAKLFMSHFGVRPEGNVSGPHAAEFSH
    KNVLYGTGPVDQAAKTFGLSEQETQDLLQTARQTLLAHRKHRPAPDTDDKIITAWNGLMISGLAKLYRVTREAQYRDGAV
    KAARFIQTHLYDPQTHHLARIWRAGEARIDGMAEDYAFLAQGLIDLYEANADAFWLAWAIDLSEEVLASFYDSKNGGIFM
    TGKGHDPHLLLRMKEDTDNVMPSAGSVAARNFYRLSAYTGRNDFSDAARATINALIPLLEEHPSAAPLLLTATMKQTTRG
    R

    >gi|158521552|ref|YP_001529422.1| methionine-R-sulfoxide reductase [Desulfococcus oleovorans Hxd3]
    MAIMMSMAGAFSQADGGPADGSEKVKTATFAGGCFWCMEPPFEKLEGVKNVVSGYTGGQTANPTYKEVTSGKTGHLEAIQ
    VIYDPEKISYQELLDVFWRQIDPTDTGGSFVDRGSQYRSAIFYHDEAQQAVALASKEALAASGRFAAPIATGVLPFTAFY
    PAEEYHQDFYRTNPSHYKRYRAGSGRDRYIQTIWEIPPLEASRQWSPGTYTRPSDAELKQRLTGLQYDVTRKDRTEPPFK
    NEYWDNKRAGLYVDVVSGEPLFLSADKFDSGTGWPSFTRPVAEDAVVYKRDRSLLMTRTEVRSRHADSHLGHVFDDGPPP
    SGKRY
    CINSAALRFIPVDELAAQGYGEYVKRLE

    >gi|158521609|ref|YP_001529479.1| mercuric reductase [Desulfococcus oleovorans Hxd3]
    MSHNGYLDRESLDAHDKRWLSRVRPEGWTNPNPALMYNLVVIGAGTAGLVTAAGAAGLGARVALVEQNLMGGDCLNTGCV
    PSKSLIRSARLAHEMRHVAGLGLSGGANVSQADFATVMERLRRIRANISVNDAATRFRDDLGVDLFFGQGVFAGHNAVSV
    SGDILRFKKAVIATGAGPFVPPLPGLARSGYLTSDTVFSLTRRPMHLVVIGGGPIGCELAQAFARLGTYVTLVEGGGTLL
    PNEDKDTARLIQDKFTQEGMTIFLNAMVTRVDDRMGEKVVTLNVGSVEQKVTADAVLVAVGRAPNVEGMGLSTAGVDYTP
    HGIIVNERLQTTNPCVYAAGDCCMTYKFTHVADATARIVIGNALFGGRARATDLNVPWCTYTDPEVAHIGLYERDAQRQG
    IRVDTLSVPMSEVDRAVTEGHTDGFVRIHLKKGTDRILGATIVGSRAGEMIGQVAVAMAGNVGLKKIAGTIFPYPTYGEA
    VRKAADAYNRGRLTPFVKRLLNAWMKWRLK

    >gi|158521887|ref|YP_001529757.1| heavy metal translocating P-type ATPase [Desulfococcus oleovorans Hxd3]
    MTEKTTTLAVTGMTCANCAANIERALNKKTAGVASASVNFATERVAVTYDPDVLSLEGIVAAIEKAGYGALPVTEGEEGD
    DREQAAREAAIALQTRHLVVGAIFTIPLFVLSMGRDFGLLGAWSHHPLMNWLFLALATPVQFYTGWDYYTGGLKSLKNRS
    ANMDVLVAMGSSVAYFYSTALLIFPVLGDHVYFETAAVIITLIKLGKLLEVRTKGRTSGAIKKLIGLRPRTAIVLKNGVE
    TPVDIGDVVVGDLVVVRPGERIPADGVVRDGRSSVDESMLTGEPIPVEKAPGNKVVGGTINNDGVLHFEATAVGSRTVLA
    QIIRVVQEAQAGRAPIQAMADRVAAVFVPAVIGIAFVTFGVWWATTGEFVPAMIRLVAVLVIACPCALGLATPTAIMAGT
    GRAAETGILFRRGEAIETSARLDTVVLDKTGTLTEGRPVVVDVLFNKTCCDTENRFLALAAAVETGSEHPVGKAVVSAAR
    DRFLELPEMKDFQSVSGMGVSARVEGRNVKVGKPGWFEGLGMDLGGLKSDMEKLRSQGKTVMAVFIDDRPMGLIGVADRL
    KTESAGAVQQLKEMGMHVVMLTGDNRETAEKIAAQAGIDQVMADVKPEEKATAIADLQKKGSRVAMVGDGINDAPALAKA
    DVGIAIGTGTDVAIETADIVLSSGNLEGVGRALSIGRQTLRTIRQNLFWAFGYNVILIPVAAGVLYPFESLPGLLRQLHP
    MLAALAMAASSISVVSNSLRLYKQRMRM

    >gi|158522071|ref|YP_001529941.1| periplasmic binding protein [Desulfococcus oleovorans Hxd3]
    MKQFFSMQFRRMAVVTALITFLCLPVAYAKTVTDPTGRTLEVPDSPSRVVSLAPSITEIIFALERQDVLKGVTQYSDYPP
    EALQLPRVGSYVHLDLERIVALSPDL
    CIAIKDGNPKQVADRLTELGIPVYAVNPFDLNTVIQTVEEMGTLLNATKKAGQL
    ADSMRARINRIDRLVASIPHRPAVFFQIGISPIVSAGTDTFINELITRAGGKNLAAGQTPYPRFSEEELVGLAPDVVIIT
    SMTRDGEFDRAMAQWRKWDTLPAIKSNRIHLIDSNLVDRPTPRIVEGLETLARLIHPELFSGTPSEDTP

    >gi|158522075|ref|YP_001529945.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Desulfococcus oleovorans Hxd3]
    MTDDIYRALQRQLETYSMGFPATDSGIEIRILKYLFSEDDARLFTGMTHQLETPEAVAARLGRPVDELAARLDDMAERGL
    LFRLKKENGSRYAAIPFVHGLFEFQVKTLDRELSEMVQIYFDEAFDAAMQKGADYFLRPIPVQKSLDVAHNVASYEDAVK
    ILADKPKIIVTDCICRKRTQVMEKGCGKQLEACFMFGSMGQYYLDRNMGREVSLEEAIAILDKCREEGLVTQPATAQNPA
    GMCNC
    CGDCCGVLVALKKHPRPAEIVFANHYAQVDTDECTGCEACLDRCQMGAIRLNADDVAEVDLNRCIGCGLCVTTCP
    TQAITLVAKPEPERVVPPVTMMDQMVGMARKRGLI

    >gi|158522272|ref|YP_001530142.1| rhodanese domain-containing protein [Desulfococcus oleovorans Hxd3]
    MKWRQFFTPVKSMDTDQARQLIADTHRNDISIIDVRQPGEYEKGHIPGARLIPMGELDTRLSEIDRNKPALVYCAVGGRS
    RVAAQMMAGKGFFNVINMAGGFKAWNGEAAVGPQSLGLELFSGSEPIDQVLAVAYSIEDGLRDFYLSMGRQVKNIQAASL
    FEKLAAIEVKHQDLIYRAYTAITDSPVSRERFVTERVGNAIEGGMSTEDYMAMFSPDMESATDIISLAISIEAQALDLYF
    RASEKVDATEGKKALARLADEERSHINELGKLMDTIQEK

    >gi|158522305|ref|YP_001530175.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfococcus oleovorans Hxd3]
    MKFLVIGGDAAGMSAASRAKRNDKNMEVTVLERSHDVSYSACGMPYNIAMPDRAIEDLVVRQALVFREKQGIDLLTGHEA
    TAIDPAAKKVFGTTDQGASFEMAYDRLLIATGGSAMVPDLPGFDLPGVMVLKSLDDGRRLKAYMEERGVRRVVIVGMGYI
    GLEMCDALVERSVAVEMIKPGKGFLSWLGEPLSDVVQQEVESKGVKLHIGCEVHRIEKQKNGLAVICDLGQLEADMVLVA
    IGLSPNSDMAGAAGLELSVKNSIAVDRTLKTSHDDIYAAGDCADAYHVVTGEKTFIPLALRANRAGWAVADNILGARVEL
    DGVAGTAVFKVFDLEVARTGLFPREAQRAGFDPVEVVIESRSRAHAHPGARPIHVRMIGDRKTGRLLGAQMVGKEGVAHR
    INAAAVALHNHMTVAAFAQTDLAYAPPFGPVWDPLLTAATQLLKKIG

    >gi|158522363|ref|YP_001530233.1| FAD dependent oxidoreductase [Desulfococcus oleovorans Hxd3]
    MIQCPAEAKASWDVVVIGTGMGGSAAGAICALNGLKTLIVDKNPAPGGACSCYEKQGFRLDTGTHLFIRCNRGPFGDLTK
    RLGMGLPIEFRRTRYLTHVKGMNVDARIPAGRFGMVMVLPLLIWQLKIHPRYHGPILRLFYDIARMKPRQVEALDKVPIE
    AFLLRYTENPEVRAMMGILLGLFFVLPAWEASAGESIWNLQKMFVENCLGYPKGGAITIPKTFLAGAERHGAEVRLKCGV
    EKIEIQHNQVKAVVLDNGEQVTTRSVISTTALRDTVFRLAGGDLFPPGYVAGVKKIKQAWTAVQAKIAVKKRLIHAGSMV
    GCVPLRFKIEDRVVREAMARVENGIQGDTIPIYAPVPTNYDPDLAPEGCHIITAAAVAPTLDVPLADNEQVWINGLMNAL
    HQMVPGLKENTLFADTWTVADLAGWIGKSSGSVITTAQTVDQVGPGRPDHRTPVEGLYIAGDCAGPARGVGTELACQSGM
    DCGDLVSSDLRRGEG

    >gi|158522550|ref|YP_001530420.1| NADH:ubiquinone oxidoreductase, subunit D [Desulfococcus oleovorans Hxd3]
    MKLTKTQAFKTLAQPVWENNPINIQMLGICSALAVTVQLKTALVMGLAMTFVVSFSSLIISALRNLIPRNIRIIVELAVI
    SSLVILCDEFLKAFMYDTSKQLSVFVGLIITN
    CIVLGRAESFALANPPHLAFLDGLGNGAGYASVLIIVAAIRELLGAGK
    LLGVQVIPGAAYSAGYEDAGFMLLAPAAFIIIGLLVWLQKSLKKE

    >gi|158522551|ref|YP_001530421.1| NADH:ubiquinone oxidoreductase, subunit E [Desulfococcus oleovorans Hxd3]
    MQDLITIFLNSVFVGNILLAYFLGMCSFVAVSKNIHTATGLGFAVVFVLTITTPLNWLVYTFLLAPGALAWAGLPNVDLS
    FLKFITFIATIAAMVQAIEMVIDRFSQGLYTALGVFLPLIAVN
    CAILGTSLFMVERQYTFLESLVFGFGSGLGWLMAIVS
    MAAIRKKLHYADMPHGLEGYGITMVVTGLMAMAFMLFSGITL

    >gi|158522655|ref|YP_001530525.1| thioredoxin [Desulfococcus oleovorans Hxd3]
    MTDQAVIVPCSRCGAKNRVRTDPAGKMPVCGKCRAPLVAGKALSVPITVFDRTFQDEVLSSAVPVLVDFWAPWCGPCKMV
    GPMLERLAAKYAGRVKIAKLNVDENPATASRYAVSSIPTLLFFKQGRVAQTLVGAVPESRIEDQIRALLA

    >gi|158522814|ref|YP_001530684.1| hypothetical protein Dole_2804 [Desulfococcus oleovorans Hxd3]
    MRKNNQTSPYWKWLPAAFALAGIILFVFATYGPPASSSGFVSTLKGVLQTVAPDYVVEKAHYRMIPDTGSWLFAFVLGMA
    IGGFIAGRTFSIPVRDIPEIWEKRFGNSKVKRFAATFAGGFVILFASRLAGG
    CTLGLFMSGSTQLAVSGLYFGVLIFGIA
    MLTARFVYRGAGGGIGKGEK

    >gi|158522815|ref|YP_001530685.1| rhodanese domain-containing protein [Desulfococcus oleovorans Hxd3]
    MKNSFFRYFVIALVLFLGALWSFSAADQTARGYPNGNFITDAQWVKAHLTDTDLVVVDVRTDDHYDGSVIPGAVRLPWSE
    FQFNDVGEDLASTFVGVRQAQDILGRHGITRKDTVVLYDSVERDGGATASYVFWVLDVLGHENKMLLERGINAWRDAGYE
    VTTAPRTPEPLLYQAPAGEVNREKLTTGQFVYKRLGDPYYQIVDVRSRAEYVGEKGTTGLDGNPLKLGHIPTAVNINYES
    AWTDADTKALKSYPELQALYRGLDPSKGVIVY
    CNSGRRSSFSYYVLRLMGFENVFTYEASWKEWGNPDKFFPVETRENRL
    VGDMLPDASGQAVSSRRIKPRDGKTGKPSSGEPSGGYVSCGG

    >gi|158522816|ref|YP_001530686.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfococcus oleovorans Hxd3]
    MTHHHLQVGDTAPEFSLNNQDNQAVNPMALAGKRILLSFHPLAWTSICEIQMRTLEVKHTVFKELEVMAYGISVDSLKSK
    QAWADAMGIKETNLLADFWPHGGVARQYGLFLDDTGVSNRANVLIAPDHTVEWIKIYDIHEVPDIEAIIAFVNQKKQ

    >gi|158522835|ref|YP_001530705.1| electron transport complex, RnfABCDGE type, B subunit [Desulfococcus oleovorans Hxd3]
    MLNAILSMLGLGMASSVILGVASRVFYVYEDPRIAEVESATAGANCGGCGYAGCSAAAAAVVKGEALPSVCIVGGPDSAA
    NIAAIMGVDPGTAEPRVSENECTGGNRAENKYNYKGILSCNAVTALYGGRRDCPTGCLGYGDCIKACAFDAIVMGEDGYP
    VVDPAKCVGCGACEAVCPKNIIRVKTMSQRLFEFNATNGAHAPCTQTCPAQIDIPKYINQIKTGDYEGAVNTIRERNPLL
    LACGRVCPHPCEDKCRRGVVDEPVSINQLKRFAADYEMNSGKRLPISCAPSTGKKVAVIGGGPAGLTAAYFLRRVGHGVT
    IFDDNPELGGMIRYGIPEYRLPKKVLKWETDGILNMGIEHKPNMRLGRDFDMGSLMAAGYDAIFLGIGAWKDYGLKIEGN
    DLKGVYTGISFLTKFAAWQQGAGTDPVPVGRK
    CAVIGGGNTAIDCVRTLVRLGAEEVSIVYRRTRNEMPANMVEIEAAEH
    EGVNMKYLFSPNRILGDENGNVVGLEVQEMELGEPDASGRRKPVPKEGAVQVLETDMIVLAIGQGPDISFKETEKGRRGE
    ALATTKWDTIDQIDPQTLQTNIPYIFTAGDSATGASLVVEAIGGGRRAARSIDLYLSGQPVTPPPNDLFKTHIPGCLFET
    VDGVTKSKRVEMPELEVSSRIKTFDEADLVISEENALKEADRCLFCCTTCYNREDGCKL

    >gi|158522836|ref|YP_001530706.1| electron transport complex, RnfABCDGE type, A subunit [Desulfococcus oleovorans Hxd3]
    MTEYILLAISCILINNILLAQFLGNCPFLGTSKKMETAVGMSMAVVFVLVMAGMITWCVDVFLLKWLDLEFLRTLAFILV
    IASLVQFVEMFLKKSIPALYAGLGIFLPLITTN
    CAVMGACLINIKEEYNFLQALVASFSYAVGFGLALILFAGVRERINL
    GKVPKPLQDTSIGLVTAGMIALAFFAFKGMA

    >gi|158522837|ref|YP_001530707.1| SoxR-reducing system protein RsxE [Desulfococcus oleovorans Hxd3]
    MAKSITQEFTKGLWAEIPPFRLVLGLCPVLAVTTKVENGIGMGLATTFVLVGSNILVSMLRNVIPTKVRIACFITIIATF
    VTLVELLMQAYTYSLFLQLGIFIPLIVVN
    CIVLGRAEAFAFKNPLLPSIADGLGMGVGFTLSLAAIAAVREALGAGTLTV
    LGNSYSLFGDAFLPFAFMVQAPGAFVCLGLMLCIMNMLEK

    >gi|158522888|ref|YP_001530758.1| redox-active disulfide protein 2 [Desulfococcus oleovorans Hxd3]
    MEIKVLGPGCAKCQQAEKIVKEAVAEAGVAATVEKVTDLMKIAGYGVFGTPAVVVDGDVKCVGKIPKKEDVIQWLKK

    >gi|158522893|ref|YP_001530763.1| rhodanese domain-containing protein [Desulfococcus oleovorans Hxd3]
    MSDATTDSTIKQALRQGLSLLVIAWVLALGVNALRPGGIPLVADWSPAARLSAATGESMVIPLDEAVVLYDRREAVFVDA
    RLPEEFAAGHIPGALNVPWILVDEYEEQFFTTVPDPETIVIVY
    CDGEACALSEDLARMLIDMGYVHVKVLADGWGQWTRH
    GYPVEKEDRHGS

    >gi|158522896|ref|YP_001530766.1| thioredoxin domain-containing protein [Desulfococcus oleovorans Hxd3]
    MTRINRLLFIGLLLFCCAGLAVAEDGKTAAIPPVPTPGMVTMVDLGAKKCVPCKMMAPILVELEKEYAGRASIIFIDVWE
    HREQAPRFGIRGIPTQIFYDKDGKEVGRHVGFMDKKSIIEVFEQLGVPGEKAL

    >gi|158522957|ref|YP_001530827.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfococcus oleovorans Hxd3]
    MKKLSTIPVQLSIACAVILLSLSTARAQEIHLHVPHFAGSHYEWKIFQGKQELTVRSGEISPDGRVILTMPDPYQDYRGM
    TRWLLKKGGGLDMIYTGKGFSVECLSEKPNSDNIIYTGNPENDYLESHHSRQQTILGKLGAVNHLLQVYAPDENLHKIAL
    DEQTHLRQAFSQVQADRAESLLYAARFGKIVDFTKGIADKIYDNPEDHTTYFNDFVTHTLDFKDLYTSGHWDQVLHHWVM
    MNIRSGKGDHAFIERMESAMSRMNQDNILAAFAEKAVPLLVEKGKDDLLPAIADHLENRPAVQAALSGSVKNMMASVKML
    TGKKAPDLVFHAPVRTQTKTSAEDIIIKTGNLDAAHTILLFYQGE
    CPLCENTLIDLANKYQQLKEQNVRVIAISADMTDQ
    GFEDKLIYHQWPDNYCDFTGMAVENFTKYGVLGVPTLFLLNQEGVVVKKTAMMDELMEILDKKKPF

    >gi|158522978|ref|YP_001530848.1| glutaredoxin [Desulfococcus oleovorans Hxd3]
    MTQNDVMIYSLSTCSHCKSTKRLLNECSVAYDFVDVDLTTGDERKAILDDIKKINPNCTFPTIKINDRVIVGYKEQEIRE
    ALGIS

    >gi|158523080|ref|YP_001530950.1| thioredoxin [Desulfococcus oleovorans Hxd3]
    MATIKIANRHQFQEAIQQGVALIDFNAAWCAPCRAQAPIIEKIAAELQGKALVAEANVDDNIDSAKEYGIQSIPTLILFK
    DGKEIQRFVGLQPEALLTQTILQTL

    >gi|158521115|ref|YP_001528985.1| hypothetical protein Dole_1101 [Desulfococcus oleovorans Hxd3]
    MESTDEAIVIRWASAHSQETVILPAFLSESREGLFLRDFCRHLKKTAPFVHIDMADARPEQAPCLNPAPNIFYQAAPSGA
    ELDLFLSVLCGESPVPAEKIPPAAGLLESLEKPVNLDLYISSH
    CPFCPQVAGPLLGLALFCPKLVLNVIDGTLFEEKAAK
    AGIKAVPTLILEDGFRWTGKVALEEVINVAAHRDGADFGVDTLKAIVTGGNAGTAARMMIDRSRIYPAFIDLLTDPDWSV
    RLGAMVVFEYLCDAGEKLATEVVDTLWSRFETVSGDVQADMVQMMGDSGLPAAMEKVTAVLNGPFEEDVKDVARAFLE