Alcanivorax borkumensis SK2 uid58169

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|110832892|ref|YP_691752.1| hypothetical protein ABO_0032 [Alcanivorax borkumensis SK2]
    MHAVLTRLGCSSCNPVYAPPVNSRLMEPGHTGDFLIGDTVDTVIIGPLALPAGTFVVLVGFFAATLASLWWQRRGQRIEA
    TLWLIAVTAVFGARLAFVLRYHNQYESWLAMLDIRDGGWWWPGVLLALPVLAVSLFRHTRVRAALLSTCAAAMLTMTVTL
    AALQALSPTPSPLPDVTLYNLEGETATLKSAANGVTLVNLWATW
    CPPCRREMPVLESAQQRYPDVRFILVNQGENPTQVR
    QYLTEEQLHFEYLLLDPHTDLGRYAGNRGLPLTLLFDNKGQEVARHFGPLSDASLHHFLNHNLSGDTP

    >gi|110832894|ref|YP_691753.1| thiol:disulfide interchange protein DsbG [Alcanivorax borkumensis SK2]
    MSKIVVLLLTLLAPLISQAEAASMDSLLTQLEASSWVAEGAQEPQRVAYLFTDMACPYCARLWENMQPMINDADNVLQVR
    HIIVGLINPKRSFTQGAAVLGAPDPSAALAEHEEYYDDGGIRPLERVPDAIRSQIQSNTALMIGLGLQGTPTLIFQDKEG
    RWRVAPGMIGEADLRQQVFQLH

    >gi|110832905|ref|YP_691764.1| AhpC/TSA family protein [Alcanivorax borkumensis SK2]
    MSIAVGDNLPSITLKTNGPDGPQDLNTGDFFKGRKVVLFAVPGAFTPGCSNTHMPGFVINADALLEKVDAIACMAVNDAF
    VMGAWQKDQNAERITMLADGNAELAKALGLELDATGGCMGIRSKRFALIANDGVVEYLGVDAKGVDKSSADTVLKQL

    >gi|110832924|ref|YP_691783.1| hypothetical protein ABO_0063 [Alcanivorax borkumensis SK2]
    MRVKSGIMTATAIPRLGSPAMEINVNFLDNLRLEAKFDDFTVITDQPIRYKGDGSAPSPFDYFLASSAMCAAYFVKVYCK
    ARDIPTDNIRLSQNNIVDPEDRYNQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPDFQIEQVDSLTEDAQALL
    MVEPDEAHRTFIEGKDLPLEQTIANMTAILAKLGMKIEIASWRNIVPHVWSLHVRDAASPMCFTNGKGATKEAALCSALG
    EFIERLNCNFFYNDQFFGEEIANSNFVHYPNEKWFKPGPNDALPEGILDDYCLGIYNPEGELGGSNLIDTNSGRADRGIC
    SLPFVRQSDGETVYFPSNLIENLFLSNGMSAGNTLAEAKVQCLSEIFERAVKKHIIEEEIALPDVPQEVLAKYPGIVEGI
    TALEEQGFPVLVKDASLGGQFPVMCVTLMNPRTGGVFASFGAHPSFEVALERSLTELLQGRSFEGLNDLPPPTFNSQEVC
    EPNNFVEHFIDSSGVVSWRFFSAQADESFCEWDFSGTTEEESARLFGILESLEKEAYVAVYEELGAPVCRILVPDFSEVY
    PVEDLVWDNTNMALDYREDILNLHRLSDEQLSQLVERLEESQIDNYTDIITLIGIEFDENTVWGQLTILELKLLIYLALQ
    RHEDALELVDMFIQFNDNTVERGLFYRAVNAVLEITLDEELSLDDYRTNLGRMYGEDTLETVIGAVEGSLRFPGLTPTNM
    QLEGLEKHQRLIESYKKLHAARAK

    >gi|110833091|ref|YP_691950.1| glutathione S-transferase [Alcanivorax borkumensis SK2]
    MTSSFHCLYSFRRCPYAMRARLGLLFAEMRVELREVELKNKPAQMLTISPKGTVPVLQLFDGTVIEESRDIMIWALEKND
    PQGLLYTKGAGQIDALIEQNDSEFKYWLDRYKYADRYPEKTQTEYRQCGEAFLQVLEGLLIKHPFLLGDNVTLADVGIMP
    FVRQFAHVDRDAFYSLPYPNLQVWLKRWLQHPFFLQAMVKYKPWCEGDELVLFPSYG

    >gi|110833123|ref|YP_691982.1| disulfide bond formation protein B [Alcanivorax borkumensis SK2]
    MSSIIPAPRPLNALAFLACLAAIVGALYLQHVDGLEPCPLCIFQRVGVIAGAVILLIASLHGPKNIGVRIYGALTTLAAL
    GGGAVAARHIWLQNLPADQVPA
    CGPGLDYMLEVFPLQNVLQQVLAGSGECAEMDWSFLGLSLPGWSMVVFAGLLLVGLIQ
    MFRPLTR

    >gi|110833223|ref|YP_692082.1| HesB/YadR/YfhF family protein [Alcanivorax borkumensis SK2]
    MRIILDCFSRVLEHDQSVQEGSYLSGFSSAQMSADSESMIESAPISFTDAAAAKVKELRDDEGNPNLKLRVYITGGGCAG
    FSYGFTFDETVNEDDTSVEKEGVILLVDAMSIQYLDGSVVDYEKGLMGSRFVVSNPNAATTCGCGSSFSV

    >gi|110833310|ref|YP_692169.1| hypothetical protein ABO_0449 [Alcanivorax borkumensis SK2]
    MPSSRVVIHYCSQCNWLLRSGWYAQELLATFSDELDEVALRPSTGGIFWIEANGQQIWERKKDGGFPEITELKRRVRDAL
    FPERDLGHIDRKG

    >gi|110833386|ref|YP_692245.1| molybdopterin biosynthesis MoeB protein [Alcanivorax borkumensis SK2]
    MLNDDQLLRYSRQLMVEEFDLPGQEALSKARILVVGCGGLANPAALYLAGAGVGQLVLADDDRVELSNLHRQVAFRGDQL
    NQAKAEALRDQLQLLNADVDIRSAVVRVDDAWLNEAVADATLVLDCTDNFSTRQAINRACVAHRTPLVSGAAIRMDGQLA
    VFDLRTEDSPCYACVYGEGSEGDLA
    CSEAGILGPVVGMVGTLQALAAIRTLTGTSVASVLHLFDGRTLSWRQVAIPRDPE
    CPVCAMN

    >gi|110833569|ref|YP_692428.1| oxidoreductase [Alcanivorax borkumensis SK2]
    MEAPVQQTRGLPQINEPAPNFNALTTDGQRTLADYRGKWLVLFSRPADFTPVCTTEFMAFAKAAPEFAKRNGELLGLSIG
    SIHSHIAWIRNIKQNFGVEIPFPIIEDLKMEVANAYGMIHPGAADTSAVRATFIIDPNGILRAMVYYPMSNGRSIPEFLR
    LLEALQTSDENGIATPEGWQPGDKVIVPPAKTAQAANARVESGEYDCKDFYFCTKSL

    >gi|110833583|ref|YP_692442.1| glutaredoxin-like protein [Alcanivorax borkumensis SK2]
    MDVIQVIKDQIEKNPVILYMKGSPQFPQCGFSAQVVEAMTAVGKPFAYVNILEAPEIRQNLKEYANWPTYPQLWVGGELV
    GGCDIIMDMYRSGQLKEMVDGVAVESDDDA

    >gi|110833584|ref|YP_692443.1| oxidoreductase [Alcanivorax borkumensis SK2]
    MGVLVGKPAPDFTVPAVLGDGSIVDEFTLSEAIKGKYGLVFFYPLDFTFVCPSELIALDHRMDAFKERNVEVIGVSIDSH
    FTHNAWRNTPVNDGGIGPVKYTLAADMNHGIAQSYDVESEGGMAFRGVFLIDQNGVVRSQIVNDLPLGRNMDELIRLVDA
    LQFHEEHGEVCPAGWQKGDSGMKDTPDGVAEYLSGNADKL

    >gi|110833635|ref|YP_692494.1| AhpC/TSA family protein [Alcanivorax borkumensis SK2]
    MAHPKIGNLAPNFKLPDQDGNQVELKAFRNQNPVVIFFYPKALTPGCTTQACGIRDTQAELEKRGVVVFGISPDAVARLP
    KFIDKHSLNFTLLSDEDHAIAEKYGCWGMKKFMGKEFMGLIRTTFIIGKNGKLLKVMDKFKTKTHHEDLLAELDALGL

    >gi|110833665|ref|YP_692524.1| protein disulfide-isomerase [Alcanivorax borkumensis SK2]
    MKKGLLFVLLGLMTACGASSEGNKGNAEIDGDQAKAAFENAFDGVEVSDVRAAPMAGMLELEVNGGETVYMSENGRFVMV
    GKLLELKDGEVINPAEQRLEKVRADGIKTLNKDDMISYVAPEETAEVYVFTDIT
    CGYCRKLHRHIEEYMDSGVTVHYLAF
    PRGGPTTKAAAAMRHIWCAEDRLQALTDAKLNEKVSDAELGECAKPVDEQYPLGLKFGVRGTPAIYTSEGKQLGGYLPPK
    DLLKRLN

    >gi|110833677|ref|YP_692536.1| thioredoxin, putative [Alcanivorax borkumensis SK2]
    MTYVREYEDESITREQLDESAGLRVIEFGANWCGYCIAAQPDIEAALAEHPELKHEKIADGPGRPLGRSFRVKLWPTLIA
    IRDGEEINRVVRPESADQVRQLFL

    >gi|110833698|ref|YP_692557.1| thiol:disulfide interchange protein DsbE [Alcanivorax borkumensis SK2]
    MKANSPWVFLPLVGFVLLAVLLASGLGRDPQELPSALVGKPVPSFSLSSLLTEETYTEDSLKGRWQLLNVWATWCPTCHV
    EHPYLLELAARGVAIAGLNYKDELPAARQYLANLGNPFTHVIVDADGQLGLDLGVYGAPETFLINPAGEIVLRHAGDLNA
    RVWEEKFLPLLPAQAGQGKGGQ

    >gi|110833855|ref|YP_692714.1| cyclic nucleotide-binding domain-containing protein [Alcanivorax borkumensis SK2]
    MTRQSIDKSLLQTFVPVNALSGDQLDWLLDQQEVCRYVSGDVLFSLGDQDNTTIYLLSGKVELSDETGDRRTVSAGDTAS
    WHPLEHVQPRRSTARAVGDVSVVRFDSFRLDTILSWDQSAGYVILDINANSAYQNDREWMIRLLKSKLFHRVPPSNILGI
    FSRLKANRHKEGERIIRQGEAADCCYILKEGVCEVSINIGEGEPTSVAMLEEGEWFGEEALLSGKPRNATVSMATDGVLM
    RLDRQDFDALLREPIIKTMPGDQVLSSAEKGAWWLDVRTSDEFDQEHLVGATNMPLNVLRLKSRLLDPGKTYIAY
    CDTGR
    RSATAAFLLKNAGLDVIVLDGGLNANAVTLNEYLTQG

    >gi|110833896|ref|YP_692755.1| Na(+)-translocating NADH-quinone reductase subunit D [Alcanivorax borkumensis SK2]
    MAEKTKDILLGPIFDNNPIALQILGICSALAVTSNLSTTVTMCIALTAVTAFSNFFVSSIRNSIPSSIRIIVQMTIIASL
    VIVVDQFLKAYAYSISKQLSVFVGLIITN
    CIVMGRAEAFAMKNPPIPSFLDGVGNGLGYSAILLGLGFTRELLGAGSLFG
    HQILPKVSEGGWYMTNGMMLLPPSAFFLIGLFIWAIRAWKPEQVEEDTFKMKPNTRVSDAF

    >gi|110833897|ref|YP_692756.1| Na(+)-translocating NADH-quinone reductase subunit E [Alcanivorax borkumensis SK2]
    MFEHYLSLFVRAVFVENMALAFFLGMCTFIAISKKIQTAIGLGIAVVVVLAITVPVNNLILHNLLEEGALSWTGSEQLAS
    LDLRFLGLLSYIGVIAAIVQILEMTLDKYVPSLYNALGIFLPLITVN
    CAIMGASLFMVERDYTFGESVVYGVGAGVGWAL
    AITLLAGIREKLKYSDVPDGLKGLGITFITVGLMSLGFMSFSGVQL

    >gi|110833951|ref|YP_692810.1| hypothetical protein ABO_1090 [Alcanivorax borkumensis SK2]
    MMMKSLKSLFISGFIALAVCTSSIAFWQLFTGGGWPWAVLLFTCVPSVLFFSYLFLFKPARTSANLPGVFWPTLLGSLAV
    ISLALAGQASMVMVSLAIINLLGVHAYIRWYSRYGVRQANVVIGEPLPDVTFSDLNAKPVTVASYAGQPLVMLFFRGNW
    C
    PL
    CMAQIREVAEQYQSLQSQGVRVALISPQSHSQSGDLAKQFDVDFEYLRDDDNRAARALGIIDAGGTPAGLEALGYDSD
    TVMPTVLIVDGQGRLVYQHLTDNYRIRPEPALFVQVLKEKGLIDG

    >gi|110833983|ref|YP_692842.1| thioredoxin [Alcanivorax borkumensis SK2]
    MQPNSPIIEATEQNIQQILEQSQQIPVIVGFWASWSEPCQQMAPILERLVNEYQGKVILANVNADEQQMLASQFGVRSLP
    SLKLVFQGKLVSELDGAQTEGAIRQWLAPVVDPEAAQQQQEEGFIEQVRMAIEAGHTEQAEGALRQTLEQSPDKHAIRAL
    LVELLLGEGRLDDAQSVLAQVTEDAEPLRPFRARFALLDKLEGAGQSLADLSARIADKPTAEDLYAYGLQAAAAGQFKQG
    LEALLQLLCNHSDFRDGVARNALLEVFECLPKGDPLASEYRRKMFNYLY

    >gi|110834000|ref|YP_692859.1| arsC related protein [Alcanivorax borkumensis SK2]
    MLLEQGLNMELTIFGIKNCDTMKKAMTWLDNNGISYHFHDYKKEGVPEQRLRQWLEALSWEIVINKRGTTWRKLDTATKE
    SMTTEKAITVAMDNPSIIKRPILQSDTIITAGFNADEWTDILK

    >gi|110834150|ref|YP_693009.1| thioredoxin-disulfide reductase [Alcanivorax borkumensis SK2]
    MSDVQHHRLIILGSGPAGYTAAVYAARANLKPVVITGIQPGGQLTTTTEVDNWPGDVEGLQGPDLMVRMQQHAERFDTQM
    VYDHINEVDLKQRPVVLKGDNGTYTCDALIIATGATAMYLGLESEAAFMGKGVSA
    CATCDGFFYKGQKVAVVGGGNTAVE
    EALYLSHIAEHVTLVHRRDSLRAEKILQDKLLAKDNISVEWDHTLEEVLGDDSGVTGMRIRSTKGEGSKDLDLQGVFIAI
    GHKPNTDIFTGQLEMKDGYIKIASGTEGNATATSVEGVFAAGDVADHIYRQAVTSAGAGCMAALDAERFLDHLKN

    >gi|110834206|ref|YP_693065.1| cation-transporting P-type ATPase [Alcanivorax borkumensis SK2]
    MTSACWHCGNPAPAGAFPARTPDGDHDACCPGCAAAIETIYGLGLDDYYQMRQDAAPQPDDQRQALDEALFDVPELVAPH
    LTNTAEGQRLKLQLGGLT
    CAACSWLIEKTVSQQPGVLGASVNLANMTLSVDYQGEADPSQTARRVQALGYRVTLPGDPRT
    KADEQRAHKQLLGRLALAGLGAMQAMMYSTALYIGVFDGKDALYEWVFRLASLVVATPVVFYSGWPFFQGALRGIRQARL
    TMDAPIALALLLAWTGSLVMMATGGEHVYFDSAAMFVFFLLSSRWLEQRQRMTIQQAYQRLSDTLPQAVRRLDEYHNPHW
    VSARQVAQGDRLQLIQGDIIPVDGTLIDGHGAFDESALNGEPLPVNHSINDSVHAGSRLVEGNIVLEASGNVAESLVAKI
    TEQVEHAQHERVEVVRDWQRIAPLFTGGILLLAASTLLWHWSSGVAQAFEHTLAVLVVTCPCALALAVPLTLSSTLATAL
    REGILVASPRQLLKVASIKGVLFDKTGTLTAGQFRIVDSQVLDKSRGLDDLLSIVAALEWNNPHPLAKPFQQYARIAGMT
    DIHADHTGVTGMLNQQQWRFTGAPDMAKPGTTCLQLLCDNEVQLYVWMQDPVRQEAPMVIKALADAGITARLASGDNNKA
    VTSVADQLGIKERRGQQRPEEKAEWLESLQSISPQMMVGDGINDAQAMMVASVSVATGNATSLAQRAAGMFLLHDSLKGI
    PALPHLSRLCQRTIRQNLAWALLYNILAIPFAVSGLLPPWMAALGMSASSLLVTFNATRVSRWKLSSY

    >gi|110834273|ref|YP_693132.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Alcanivorax borkumensis SK2]
    MSTEQQRRQAIKDHSPLPGDNFVYGVLTTGIFCLPICPSRRPRDENVRLFDTPVQAIQNGYRPCRRCHPLGDIAAPSTAT
    VIALCRLIEAAERKPTLTELSAQSGWSAHHLQRQFKAVAGISPHQYGVAIRRRRAQQQLRYKQSLTLSAHLAGFDSTSHL
    HAVAGNTLGMKPGQYRQAGKDMALRFAIAESSLGSVLVAESERGICAVTIGDDPSVLLQDFEQEFSGATLLPGNSEFDQR
    VAMVITLIDDPHQITQAPRDLLPLDIRGTAFQQQVWAALQTIPTGQTLSYQALAVKLGKPTAARAVAQACASNRLAVLVP
    CHRIVRTDGGLSGYRWGVGRKAALLDREREPSDK

    >gi|110834284|ref|YP_693143.1| glutathione reductase [Alcanivorax borkumensis SK2]
    MTTEFDLVVIGAGSGGVRAARMAASHGANVAIIEERFFGGTCVNVGCVPKKLFSYGSHFPQEFALAEDYGYSVKGWDFDW
    ATLRDNKSREISRLNSIYQRILNQAGVTIFEGHGQVLGEGKVSVGEITLSARHIVVAVGGKPFVPDFPGREHVRISDDLF
    YLDTLPKHVAVVGGGYIATEFAGILHGLGCKVTQVYRGDLFLRGFDDDIRGFIAEQMEEQGVTLKFNADIASIENSEGEK
    RVTYKNGERGVFDEVFYATGRIPKLDDLFAEGAAPAMTDAGAIKVDEGFATSVPGLYALGDVIDRVQLTPVALAEGMWLA
    AQLYGQQKPEATMDYHNIATAVFSHPNIGTVGMTQEQALAQVPAVRVYKSAFRPMRYTLGDKHARSLIKLIVDDTTDKVL
    GLHMAGEDSAEITQGFAVAIKMGATKADFDATVGIHPTAAEELVTLRQGVRITA

    >gi|110834355|ref|YP_693214.1| 2-oxoglutarate dehydrogenase,lipoamidedehydrogenase compone [Alcanivorax borkumensis SK2]
    MADNYDVIIIGGGPGGYVAAIRCAQLGLNTACIEKRINKQDEPALGGTCLNVGCIPSKALLDSSWKYHETESSLADHGIN
    IKGAELDLDTMLKRKDTIVRNLTGGIAQLFKANKVTWLQGTGQLKSGKQVEFQPLDGDVQTLQAEHVILAAGSVPVDIPV
    APVDQEIIVDSTGALEFDAVPKRLGVIGAGVIGLELGSVWARLGSEVVVLEAVDAFLPAVDKQIAKDAQKQFAKQGLDIR
    LGARVTGSEVKKDQVVVRYSDKDGENEETFDRLIVAVGRRPYTEGLLSQDAGVTLDERNYIYVDNQCRTDVPGVYAIGDL
    VRGPALAHKAIEEGVMVAEVIMGESTQVNYDAVPGVIYTHPELAWVGKTEEEAKDSGDAYKTGAVPFAANGRAMAAGETG
    GMVKFVADEKTDRILGMHVVGPQASELIQQGVIAMEFGATVEDLQLMVFGHPSLSETVHEAALATDFKAIHVAQRRRKK

    >gi|110834391|ref|YP_693250.1| methionine sulfoxide peptide reductase [Alcanivorax borkumensis SK2]
    MNAVIPGTSLAIRPENFPDPIEDLPVNGTAKAVFAGGCFWCVEAVYLNLEGVNAVVSGYAGGHAAQANYEAVCTGTTGHA
    EVIEVEYNSAVISFGELLKVFFSVAHDPTHKDRQGNDRGTQYRSAVFYHDNAEKTVATAYIEQLNNAGAFIAPIATTVEP
    LETFFPAEDYHQNFARRNPTQGYVTHVAKPKVEKLIHAFPDKLKTRTP

    >gi|110834392|ref|YP_693251.1| methionine sulfoxide reductase B [Alcanivorax borkumensis SK2]
    MTQALSASGFDLTPLSEEEKQARAQTLTEEERHILLNQGTEPPFCGGLLDNKDAGTYHCKLCDLPLFASDAKFESGTGWP
    SFYQPYDPEHIRELSDRSHGMLRVEIRCARCDSHQGHVFPDGPPPTGQRY
    CLNSASLTFKA

    >gi|110834405|ref|YP_693264.1| arsenate reductase [Alcanivorax borkumensis SK2]
    MSDYTIFHNPRCSKSRQTLALLEERGITPIIVKYLDDIPDAATLKSLITKLGFTRAHDLVRNKEADYKTAGLTAQSNDDN
    VITAMTQYPKLIERPIVVKGDQAVLGRPPENALTLLD

    >gi|110834431|ref|YP_693290.1| soluble pyridine nucleotide transhydrogenase [Alcanivorax borkumensis SK2]
    MDISAGWGLVVIGSGPAGEAAAMQAAKKDLKVAIIEEQSSLGGNCTHWGTIPSKALRHQVRQVIRTQRNPLLRGILKPRE
    IRWQDLIARTREVIDSQVQVRTDFYVRNRVTVFAGRGEILSPNEVRVDDHEGRQHLLKTDNILVATGSRPYHPEDVDFSH
    PRIYDSDTILTMDHTPRHILIYGAGVIGSEYACIFTGLGIRVDLVNSREHLLDFLDTEISDALSYHLREQGCTIRQGEHY
    KRVTADDDGVTLELESGKKLRADALLWCNGRSGNTQNIGLENVDVKANDRGQLKVNERYQTETDNLYAVGDVVGWPSLAS
    ASYDQGRFCAAAIAGDEVRQVTDVPTGIYTIPGISSVGRTEQELTEAKVPYDVGQAFFKNLARAQITGERVGMLKILFHR
    ETLAVLGIHCFGYQAMEIVHVGQAIMRQPGENNTLEYFIDTTFNYPTMAEAYRVAAINGINRIKR

    >gi|110834470|ref|YP_693329.1| electron transport complex protein RnfA [Alcanivorax borkumensis SK2]
    MTEYVLILISAVLVNNFVLVQFLGLCPFMGVSNKVETAMGMSLATTFVLTLSSVLAYLTWAYILVPFELEYLRTISFILV
    IAVAVQFTEMFVKKASPLLYRVLGVFLPLITSN
    CAVLGVALLNVRQEDATFMSSLTYGFGAAIGFSLVLILFAAMRERIA
    VADVPEAFRGPSIGLITAGLMSLAFMGFSGLIKL

    >gi|110834471|ref|YP_693330.1| electron transport complex protein rnfB, putative [Alcanivorax borkumensis SK2]
    MSGVLIAVAALLALAAVFGAVLGFASEKFKVEGDPIVDQIDSLLPQTQCGQCGHPGCRPYAEAIAEGEEHNRCPPGGQDT
    VVALSELLGREELTLDDEGAEDANVAKVAYIREDECIGCTKCIQACPVDAIVGAAKLMHTVIVDECTGCDLCVEPCPVDC
    IDMLEVKPTLQTWGWQRPAGIGERPDSRIEVVNL

    >gi|110834475|ref|YP_693334.1| electron transport complex RsxE subunit [Alcanivorax borkumensis SK2]
    MMSDVNYKKISMDGLWNNNPATVQILGLCPLLAVTGSVVNAMGLGLATLVVLMGSNACVSLIRHYVTDAVRLPAFVMIIA
    AMVTVIEMLMQAYTFELYEILGIFIPLIVTN
    CTVLGRADAFASKNAVLPAMVDGVMMGMGFLVILLILGGMRELVGQGTL
    FSNMQLLFGPMAAHWELTVIDNYGGFLLAILPPGAFLGLGLIIAGKNVIDKRIKEVQKRKASDEPKTSRRVRTTGKVG

    >gi|110834586|ref|YP_693445.1| hypothetical protein ABO_1725 [Alcanivorax borkumensis SK2]
    MISPSAHYDLVFVGAGHSHALALRMLAMKPIPGVRLTLVSPDSLSAYSGMLPGLIAGHYTLDDTHVDVYRLCQASGCRFI
    QASVTQLDPQQRHLQLSDGSQLAYDWLSLDVGATPDLSPLGGSHPRVVPVKPVASFYARWQQLCQHAERQSPSLAVIGAG
    AGGTEMTLAMAQHFQRHQQPAQIQLITSGNLLPGFPASVREKMHKRLQAHNVTLHTDSRVHCDAHQQLHMGDQPLTAQWV
    LWCTGVRGLPILENSGLECDERGFVRVTETLQTATDKRIFAAGDCAAFPTPLPKAGVYAVRQARTLATNLRAVIQGQPLV
    AYRPQSRFLSLLSTGGKDAIASRGGRLSVAGHWVWRWKDHIDRAFMAKFDQQLPSMPPGPADPDTLHCAG
    CGAKVGSDAL
    HEALAELQPVVNPGIEAGVDAADDAAIIDWPAGQRLVQSLDFFPAFIDEPYLFGRIAALHSLSDVYAMNAQPHSALANIT
    LPWHHPRLQSRDLQRMMAGAVRELNAAGCTLVGGHTIEGPQMAAGFTVNGQADPAQLWHKHGARDGDRLILTKPLGSGVQ
    LAALMQVSREPSSAFHGPWLDTTLRHLLISNHLAQQALQGIPVNACTDITGFGLLGHLYEISQQSQVSLSVDCHKVPLLP
    GTLSLIEQGVASTLSDANRQILVHCQQQQPVAEALLTALCDPQTAGGLLFCLHADYAKQALQRLDSKGIAAAEIGKVLVK
    KTSNDAAILLNSGHTGKV

    >gi|110834730|ref|YP_693589.1| iron-binding protein IscA [Alcanivorax borkumensis SK2]
    MTVQTFHPGQVTLHLTEAANQQALREIQRAGAAGIRLDLDESGCSGFMYTLDFVESAKDGDKLFKIDGVNLYVPEKWLPM
    LNGLVIDYVTEGVNSLFKFRNPNATGECGCGESFTVDDV

    >gi|110834782|ref|YP_693641.1| rhodanese domain-containing protein [Alcanivorax borkumensis SK2]
    MATRISPTQGKALFDQGNTLFIDIRDPASFAAGHLQGALHLSQANVDQFLANTAQERALVVYCYHGNSSQSTSDWLSEQG
    FNNVVSLDGGYDVFRQQFPECIEEIA

    >gi|110834854|ref|YP_693713.1| rhodanese domain-containing protein [Alcanivorax borkumensis SK2]
    MKRYLIISIFAVLNTLCASLWAADSLSVSELKQRMQDGNAPIIIDVRDEDEYLAGHIPGAIMVPAKQMEHHLDMMEQYRK
    EDIVLY
    CQSGRRASAAATVLENAGFKNVKLLQGNYPGWESAQ

    >gi|110834867|ref|YP_693726.1| thioredoxin family protein, putative [Alcanivorax borkumensis SK2]
    MRFLRVLALLVIPWLAHAEPLPFSPEQVGEAKVIYVDFWASWCVPCRRSFPWLNRMQAKYGDRGFTIIGVNLDLRKEDAE
    KFLANYPATFPLVFDPQGELASRYQLQGMPSAVLMDERGNALARHIGFMETNKDAYEQEIVQLLEEQ

    >gi|110834868|ref|YP_693727.1| thiol:disulfide interchange protein DsbD [Alcanivorax borkumensis SK2]
    MHTSWQRLGLALLMLFTVSTAIAQDLFGDQERLPTVDEAIQLVPDADWDNQQLRLDFELIDDVYLYQHRFGFTLRDTNGN
    VINDFAELILPPGKPKTDEIFGDVEVYFDRLKFSLPLNSVPLVDTELEVRYQGCIEDTLCYPPTRKVFAFDNPQPAKKPM
    AAVPPAATDSTAGPGFLDTLRSEDANAFNQWMNEQPLGLIIGLFFVGGLLLAFTPCVFPMVPILSGIIAGEKEPSATRGF
    TLSVSYVLGMAVPYTLAGLLVALFGAGLNLQFMLQQPAAIITSVAVFVVLALSMFGLYELQLPAALRNKLHQPGQEARGS
    LIGAAIMGTISALVVSPCVTPILAGALIYVAASGDAATGAASLFALSIGMGLPLIIFGTGGGSLLPRAGMWMEEIKRFFG
    VVMLGVAIWLLDRIISDTITLGLYGLLLTVYGIQLGALEPAGEGAARLKRGLALVLALYGAVMIVGALSGGKDPLQPLAQ
    MNQPATNNGPLHVSTPSSQPGDHGPWQTIVGKASLEQALATSRQANKPVLVDFFAEW
    CVACKVLEETTLSHPDVLNAMLG
    FDLYRVDITEINADSQAIMEQYNILGLPALVFFTPISTEIPDSRVLGEMGPQRFIEHLNKRVLPRL

    >gi|110834883|ref|YP_693742.1| hypothetical protein ABO_2022 [Alcanivorax borkumensis SK2]
    MKAVVKWQGEACYEAETESGHKVLMDGPPDHGGQNRGPRPMETLLLGVGGCSSFDVIHILKKSRQDVTDCRCELTAERAD
    EVPAVFSKIHLHFIVSGNSLKEAHVKRAVELSAEKYCSASIMLTRGGVEITHSYTIEG

    >gi|110834968|ref|YP_693827.1| monooxygenase, putative [Alcanivorax borkumensis SK2]
    MATLLTGLFPMQVTHNVVIIGAGFGGLGMAIRLKAQGQDNLLLIEKGHDVGGCWRDNTYPGAACDVPSHLYSFSFERHYP
    WSRRFAQQKEIFAYQQYCARKYDLYRHIRFNTEVAEARFLDEPGLWEITMTNGEVITCRALITATGQLNQPAYPPLSGIE
    DFQGPHFHSARWNHDEDLTGKTVAVVGTGASAIQFVPEIAKVAGKVKLFQRSAAHVIPKPDRAYRKAEHWMLKKLPVTQT
    LDRMRIYAANEARVLGFTSFQKAMLVYEWLFARQLKKQIKDPVLREKLTPDYPMGCKRILMSNDYYPALAQANTEVINYG
    IDAVDKKGLTDSSGTHHKVDVIIYGTGFKATEFLTPMTITGRNGKDLNSTWRDGAEAYLGITVRGFPNLFMLYGPNTNLG
    HNSIIYMLESQIHYVQQCLAEMDDQQLHSMEVRESVQARFNDNVQRKISDTVWDKGCHSWYKTDSGKNTNNWPGFTFDYR
    RQTQHLQLNDYEYKSL

    >gi|110834989|ref|YP_693848.1| iron-sulfur binding domain-containing protein [Alcanivorax borkumensis SK2]
    MSNSKTLTFAFMDPPFESERTVTFFRLLDAALEKNANVRVFAYEGAVALSFSKQAPHGNAVHGLNREEESLPLSKDWVAA
    LQQKATDKGLTFEWIN
    CGLCVDERGVNDVIDGCGRGGPPDLWRYASKAFNTLTIGTR

    >gi|110835043|ref|YP_693902.1| arsenic (+3 oxidation state) methyltransferase [Alcanivorax borkumensis SK2]
    MHEDVQNYYGKQLHSSADLQTNACCDQAPPEYLKPLLAQLHDEVISRYYGCGLVAPEQLEGMRILDLGSGSGRDVYLLSA
    LVGEEGEVIGVDMTDEQLAVANRHLDYHREAFGHSKSNVRFLKGYIEELDKLDLQDGYFDIVISNCVINLSTNKAKVIAD
    VKRLLKPGGEFFFSDVYADRRIPSALAKDPILYGE
    CLSGALYWNDFINLSKRCGFADPRLVESRPLTIENPAIEKALGNI
    RFYSATYRLFNIDTLEPACEDYGQAVIYKGTLPNSRDTFTLDDHHAIEAGKVFPV
    CGNTWLMLEKSRFADHFEFIGNFET
    HYGIFAGCGLDVPFLQTSNAGAEACC

    >gi|110835044|ref|YP_693903.1| mercuric reductase, putative [Alcanivorax borkumensis SK2]
    MSIKKGLLFTALAALIACYFVFDLGQYFSLDYIKQQQSAFDALYQDNPALILGGFFGLYVLVTALSLPGAAIMTLAAGAL
    FGFWIALVMVSFASSAGATLAFLASRFLFHDAVQSRFGERLKKLNEGVKKEGAFYLFTLRLVPVVPFFIINLVMGLTPIK
    ARTFYWVSQVGMLAGTAVYVNAGTQLGQIDSLKGLLSVELIGAFVLLGIFPWIAKGIMARVQARKVYKGWKKPKQFDRNL
    IVIGAGAAGLVSAYIAATVKAKVTLIEKHKMGGD
    CLNTGCVPSKALIKSARVAFNDKQAEKYGFEAINSRFRFSSMMERV
    QQVIEKIEPHDSVERYSELGVDCRQGEARFLSPWEVEIRNGDHVETLTARSIIIASGARPFVPPIPGIEDIDILTSDNLW
    QIEEQPKRLLVLGGGPIGCELAQTFARLGSEVTQIEMLPRLMIREDAEASEIVTRSLKESGVHVLTNHKAVRFSEENSEK
    VLLVEHDGKETALPFDQVLVAVGRKANTDGLGLDALQLPTETNGTIQTNDRLQSRYPNIYACGDVAGPYQFTHTAAHQAW
    YASVNALFGFLKSFKVDYRVIPWCTFTDPEVARVGVNEQEADEQGIEYDITRYGIDDLDRAIADSADLGYVKVLTAKGSD
    KILGVTIVGQHAGELISEYVLAMKHGLGLNKILGTIHIYPTMAEANKFAAGEWKKARKPEGLLRWVERIHNVRR

    >gi|110835073|ref|YP_693932.1| thiosulfate sulfurtransferase [Alcanivorax borkumensis SK2]
    MLPLLLEPTELANRLDDGNLLILDLSKQPVYVQAHVPGAIHLDFKRLQSGAQPAPGMIPSDDALSDLFSELGLTSDTHVI
    AYDDEGGGWAGRLLWTLDAIGHKHYSYLNGGIHAWLADGHATSSEAHEPSPSDYQVGAHDPLTEVDLNYLLAHYQDEDVV
    IWDSRSLDEFDGVRAFAKKAGHIPGARHHEWTEPMDKQNNLRLRPLDDIRAELAALGISGDKEVITH
    CQTHHRSSFSWLV
    GKLLGFERMRGYAGSWAEWGNHPDTPAEKSA

    >gi|110835134|ref|YP_693993.1| glutaredoxin, putative [Alcanivorax borkumensis SK2]
    MARVELYTTSWCPFCVRAKQLLNSKNVAFEDTDVDREPQQRAVMMQRGGGRTVPQIFINDHAVGGCDELFALERAGALDA
    LLGADQ

    >gi|110835135|ref|YP_693994.1| rhodanese domain-containing protein [Alcanivorax borkumensis SK2]
    MGNLIEFASNHYILVSAFFLLWALFFVLESRRGGQSLTPQLATNMVNQKDAVIVDLRDSDEFRAGHIAGSINIPAGQAID
    RIAELEKYKDKPLILT
    CDMGTKASHLGRQLRTKGFSDLYRIQGGLNAWRSASLPVVKA

    >gi|110835214|ref|YP_694073.1| Cu(I)-exporting ATPase [Alcanivorax borkumensis SK2]
    MSTQARTQTLPIRGATCKGCSRTITAALEALTGVERVTVDLESQQVSVTGTASHSALQEALVQAGYGVNPDDAHHEHNNP
    ADHDNTASKPIAQEPQSIQLNISGAT
    CASCVRTIESALRDTPGVDSADMNFADRTAQVSGSASTASLIKAVEDAGYGASE
    AREEDNGEQEAKERAHYHQLLRHMGLGLGLGVPLMAWGLLGGDMMVRPGETSQWVWLGIGVATLAVLATAGRHFFVGAWK
    AFRNHNANMDTLIALGTGAAWLYSMVVVLLPGALPEAARHVYFEASAMIIGLINLGQALEVRARGKTSAAVKRLLDLGAK
    TARVIRDGEEQDIPVEQVQAGDQLRVRPGEKIAVDGTVEEGESRIDESMLTGEPMPVNKAPGDKVSAGTLNEAGTLLYTA
    TAVGKDTALSHIVALVKKAQGSKPPIGRLADQVSAIFVPTIMLIAIAAALVWFNVGPEPRLTHMLISATTVLIIACPCAL
    GLATPMSVMVGVGKAAEYGILIRQGEALQTSSQLDTIVLDKTGTITEGKPAVTDIVCNEGQQEDTVLTLAASVESGSEHP
    LATAILNESKQRELSLDSASEFQALNGKGVTATIQGKTYRLGNRRWLESEGVNINLDSTSLTDKGVTPLFLSEANTLLGI
    IGVADRIKDDSKAAIARLKDQGLKVIMITGDIAASANAIAEQAGVDEVMAEVLPEDKAKKIQALQSEGRTVAMVGDGIND
    APALAQADVGFAIGTGTDVAIESAAITLMGGSLHGVPDAMAISSATVRNIKQNLFGAFVYNSLGVPVAAGILYPLTGNLL
    SPVIAGAAMSLSSVTVVTNANRLRFFKPKHHQGTSA

    >gi|110835285|ref|YP_694144.1| hypothetical protein ABO_2424 [Alcanivorax borkumensis SK2]
    MPSAFGFRFDNTYRRLPEALFSDCLPQPVSTPAFVLFNDNLAQELGLDSEALSEHPEFFSGNELLAGSEPIAQAYAGHQF
    GSLTMLGDGRAVLLGEQLDGHGQRHDIQLKGAGRTPFSRGGDGRAALGPMLREYIVSEALHALNIATTRSLAVTRTGDRV
    RRDTLLPGAILTRVAASHIRVGTFQYAAGQQDPVLLEKLVDYTIARHYPALEGAENKALALFEAVMDRQIDLVVDWMRVG
    FIHGVLNTDNVTLSGESIDFGPCAFMDRFDPNTVFSSIDHQGRYAYGNQPSITQWNLGRFAETLLRMMDDNTDIAIEKAT
    TSLKSFSLRYEEKWRAMMNKKLGLFGSETEDDTLIADLLTWMHAQNADYTNTFRDLIQDGLPDGEQYQSEAFQHWHQRWR
    ARLARNSKPLASSLCLMRNHNPAVIPRNHLVEQALQAASEDNDMTPTHALLQALSAPYADRDSDDRYRQPAAPCEQVHQT
    F
    CGT

    >gi|110835291|ref|YP_694150.1| Alkyl hydroperoxide reductase subunit F [Alcanivorax borkumensis SK2]
    MLTNEILQALKGYAANMQKKVSFVLQSGSHDKREELVTFLSSIAGVSDNLAFEERDLGDRLRSPISFLLEADGEDTGIRF
    SGIPAGHEFNSLVLAFLHASGTEIKLDAGLQRMVAKAKGDMHFEVFISLS
    CHNCPDVVQALNQFALLNPNIRTEMIDGGL
    FQDVVSDRNIQGVPSVYLNGELFANGKVTAAELIDKLLAYDPSLAEAGVGEKLPLQDVTVIGGGPAGVSAAIYSARKGLK
    VTLIADRIGGQVKDTMDIENLISVKKTTGPELSGALQAHMSEYDVTVKEHLRVARVEKGDIKTVVLSSGEAIDTKTIIVA
    TGAKWRELGVPGEKENIGNGVAY
    CPHCDGPFFKGKDVAVIGGGNSGIEAALDLAGIVKSVNVFEFMPELKADKVLVDKAE
    AKANITIHRNVATNQIMASNGKVDAIEYIDRDTEQLHRLPLHGVFVQIGLVPNSDFLEGVVERSRFGEIEINEKCQTSQE
    GIYAAGDVTTVPYKQIVISMGEGSKASLAAFEYLLTQSDRLDALYENDKDVQKVAAVA

    >gi|110835292|ref|YP_694151.1| alkyl hydroperoxide reductase, C subunit [Alcanivorax borkumensis SK2]
    MALINSEIQPFNATAFKQGEFVDISEADVKGKWAIFFFYPADFTFVCPTELGDVADKYEELQKMGVEVFSVSTDTHFTHK
    AWHDTSDTIGKINYFMVGDQTGNITNNFGVMREGQGLADRATFLIDPDGVIQAMEITAEGIGRDADDLLRKVKAAQYVRN
    NPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|110835323|ref|YP_694182.1| thioredoxin [Alcanivorax borkumensis SK2]
    MSGEIINVTDADFEAKVINADGPVLVDYWAPWCGPCKMVAPILEQLAGEYGDKLTIAKINIDDNPETPKKYGVRGIPTLT
    VFKNGNVEATKVGALSKSQLTAFLDSTL

    >gi|110835493|ref|YP_694352.1| peroxiredoxin family protein/glutaredoxin, putative [Alcanivorax borkumensis SK2]
    MFENREGQPVPAVTFRTREGNEWKDVTTDDVFKGKTVVVFALPGAFTPTCSSTHLPRYNELAPVLKANGVDDIVCLSVND
    GFVMNAWAGDQAAGNIHFIPDGNGEFTDKMGMLVNKQDLGFGPRSWRYSMLVKDGVIDRMFIEPDKPGDPFEVSDADTML
    KYINGEAVLPKRVTVFTKPG
    CPHCTRAKQALTDYGYAFEEIELGSRGLSYSSLAAVTGAGTTPQIYIEGERIGGADELEA
    WLQQG

    >gi|110835499|ref|YP_694358.1| glutathione peroxidase [Alcanivorax borkumensis SK2]
    MGIYDYSAITLSGEEKSLADFQGKVLLIVNTASKCGFTPQYKGLEALYKTLQPKGLEVLGFPCNQFGKQEPGAADEIGAF
    CEKNYGVSFTMFDKVDVNGGDAHPLYDFLKKEAPGVLGSKGIKWNFTKFLVNKDGKVVKRYAPTDKPEAIQKDIEALL

    >gi|110835510|ref|YP_694369.1| DsbA family thiol:disulfide interchange protein [Alcanivorax borkumensis SK2]
    MLRIVTALLLSLGLATGVAAAEEHTRFAVDTHYKVLDVPGSVDDPSKVEVREFFSYGCPHCYSLEPAVDAWLEEKPDYID
    YVRTPVLFLRNAEPLARAYYVEDALGLVDEMHVPLFDAIHKHREPLFNESALANFFRKYGVEPAEFSKLYGSFGVSTKIR
    QADALSKKYQIPGVPNFVVNGKYLVKRENVKSNEELFKVIEFLVNKEKTGS

    >gi|110835524|ref|YP_694383.1| hypothetical protein ABO_2663 [Alcanivorax borkumensis SK2]
    MSEYGATVAWHLQRGTSFDYEHFNRDHEWTFAGGEVVSASGSPEFYGCANRVNPDEAVIAATASCHMLTFLSIAAKRGLT
    VLSYIDQPLGTVDKNEEGRMAITRIVLRPRVVFDGQEPDGPALEKLHESAHRN
    CFVANSLRADVRIEPV

    >gi|110835564|ref|YP_694423.1| peptide methionine sulfoxide reductase [Alcanivorax borkumensis SK2]
    MRMITLLGLLIISAPSLAAEAYFAGGCFWCTESDFEQLNGVSDVISGYAGGDVANPSYQQVAAGSTGHTEAVKVIYDPKV
    VSYDNLLTWLWRHIDPTDANGQFVDRGTQYRSEIFYQTDEEKEAAKASRMELEERGPFKKPIVTAITKLDSFYPAEDYHQ
    DYYKTHSLKYKYYRYRSGRDQFLKEHWDDPDHRPWLVKDVTQSWQGADKFERPSDSDLQKTLPKLTYKVTREDATERAFH
    NPYWDNKEKGIYVDVISGEPLFSSTDKYQSGTGWPSFTQPIDEAFITAHEDNTLFTTRTEVRSRYADSHLGHVFDDGPAP
    TGKRW
    CMNSAAMRFVPLEEMTQKGYGKYLSYFQ

    >gi|110835612|ref|YP_694471.1| alkylhydroperoxidase [Alcanivorax borkumensis SK2]
    MTDFTLHTDETAPEASLTLLKESQKSFGMIPNLHAVMAEAPGLLEGYQKLHALFLETSFTDEEVTVVWQTINVEHACHYC
    VPAHTGIAKSMDVDDSITNALRDKTPLPTDKLEALRDFTLSVVRDRGEVDEKTVQAFLDAGYEKRHILEIILGVSQKVMS
    NYTNHLANTPVDKPFKKFEWHADSTPSS

    >gi|110834114|ref|YP_692973.1| hypothetical protein ABO_1253 [Alcanivorax borkumensis SK2]
    MSTQHRVETPHSIVVAALYKFVRLSGFEQLQQPLLDLMHANDVRGTLLLANEGINGTVSGPRAGVDAVLNWLKSDERLAT
    LEHKESFHDEHPFLRTKVKLKKEIVTMGVEGIDPTRTVGTYLSPQEWNEIIADPDTVLIDTRNDYEVEVGTFKGAINPET
    RTFREFPEYVKQTLDPQKHKKVAMF
    CTGGIRCEKSTAYLKEQGFDEVYHLKGGILKYLEEMPKEDSLWEGECFVFDERVT
    VDHDLNPGEFDQCHACRRPISDEDKRSAQFQLGVSCPKCFDESSPEQKQRFAERQKQIELARARGRQHRGQNPRKSS