Desulfobacterium autotrophicum HRM2 uid59061

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224367204|ref|YP_002601367.1| putative peroxiredoxin [Desulfobacterium autotrophicum HRM2]
    MEKSNTMPMLGDTFPEFSAATTHGPMNFPQDLKGQWFVLFSHPADFTPVCTTEFVAFQKRIKAFEDMGVKLIGMSVDQVF
    SHIKWVEWIEEKLDVEITFPIVAANDAIADKLGMLHPGKGANTVRAVFVVDPESRVRLMLYYPQEIGRNMDEIVRAVKAL
    IQSDKDGVAIPAGWPENELIGDKVIIPPAQDQAEAKKRPGQYDCYDWWFCYRDLK

    >gi|224367355|ref|YP_002601518.1| Fe(III) ABC-type transporter, periplasmic substrate-binding protein [Desulfobacterium autotrophicum HRM2]
    MSSTPIPGQGRPVSRRDTLNKDISRIKTALWLSLFMVLSNLAPVLGAQRVVDQNGRTLIFERPFSRIISLYGAHTENLVF
    LGLDREIIGVSRSDIHDPRFSTTPWFSAHDGPEKFLGARPDLILIRPMIERG
    CSRLIQQLERSGITVVSLQPADVEGMYD
    YWTTLGRLTGRNEQAGAMVADFKHQVAGFRALTKGIAPKKQVYFEAIHSKMKTFTPGSMALFALEVAGGINVAKDARASR
    GTNIGNYGKEQILAHADKIDVFLAQQGEMNPVSRETIETEPGFAMIKAVKNNAIYLIDEQIVSRPGFRLLQGIKTIGEIL
    YPDIFGALDPRNSDALIQEKRKAF

    >gi|224367487|ref|YP_002601650.1| hypothetical protein HRM2_03660 [Desulfobacterium autotrophicum HRM2]
    MKKLFIYVFSMVFVLTAAGFAFADDSAMLKANEEKAWENATKVFPVERQLDVQGFKDLYDKVMAGQEDAYLVDLRTHPEF
    YAGHIAGTDHIHAGHMYTFPKIITNKDAKIVVW
    CRTHKRGAYVGERLTQYGYTNVWWYKDGILGWIKAGYPLCNQFMGQF
    KVTGYDKNFTEIDKETQKPLYHIREFHPF

    >gi|224367566|ref|YP_002601729.1| QmoA [Desulfobacterium autotrophicum HRM2]
    MTTDNSAPTSGSIMVVGGGISGLTTALEAAEVGYEVFIVEKEPSLGGRVSQLKQYFPKLCPPTCGLEINYKRIKDNPKIT
    VITMAEVDKVDGKPGDYTVKLKISPRYVNENCTACGECAKVCESEISNEYNLGMDRCKAAYLPHNMAFPQRYVMAPSMAQ
    DDRDRCKEACKFDAIDFDMEEKSLDLKVGAIVWATGWRPYDAARIDNLGFGRYQNIITNMMLERLASPNGPTRGKIIRPS
    DDKAPATIGFVQCAGSRDENHLPYCSYICCMASLKHATYLRAQYPEAKIYIYYIDIRTPGRKYENFYKKLKEDKNIFFVK
    GKVAEVGEEEGTGNITLVAEDTMSGDKVRQTVDLLVLATGMQPNSAVERPNADLTFNSDGFIVNDFKKGGMFAAGCANKP
    ADVVTSNQNATGMALKAIQTLVRR

    >gi|224367736|ref|YP_002601899.1| mercuric reductase (Hg(II) reductase) [Desulfobacterium autotrophicum HRM2]
    MKKPTKTKSLVMTAIAAMVVCFYLFDLKAYVSLDFMRESLNAFQAYYVNHRVATIMAYMAVYIAMAALSLPGAVMLTLLG
    GALFGTLLGTVLVSFASTIGATLAFLVSRFLFREAVQRRFKEKLDAINRGVEQDGGFYLFTLRLVPVFPFFIINLVMGVT
    PISLPLYYGASQIGMLPATFVYVNAGTQLAGLESIQGILSFNLLAAFALLGILPLVAKKVTAMVQARKQLAPYPRPKQFM
    YNLVVIGAGSAGLVSSYIAATVRAKVALVEADKMGGD
    CLNTGCVPSKALIRSAKIMAQAARAQTYGFEKADITFDFSKVM
    ERVHDIIRTVEPHDSVERYTQLGVTCIKGRARVISPWEVEVNGSRLTTRSIVIATGARPMVPDIPGLSTVDYLTSDTVWQ
    LTTLPRRLLVLGGGPIGCELSQAFARLGSTVTLVQRGPRILNREDPEVSELIRQTFKHEGVQVLTDHSAREIIHTDQGSV
    LVCDHGGVDKKIEFDTILIALGRVANTQGMGLKTLGLEMSDTGKIKAGNFMETNFPNIFCAGDVAGPYQFTHVAAHQSWY
    ATVNALFGMFKRFRVDYSVIPWATYTDPEVARVGLNENEAKQRKIDHEVTVYKIEDLDRAITDSEARGFVKVITPPGKDR
    ILGVTIVGSHAGDTIAEFVLAMRHGLGLNKILGTIHIYPTMAEANKYAAGQWKKAHAPEKILAWVRRLHDFLRT

    >gi|224367810|ref|YP_002601973.1| NqrD [Desulfobacterium autotrophicum HRM2]
    MAKEKSNRLDIMVRGIWRENPVAFQVLGICSALAVTVKMSTALVMAVALTVVTACSSFTISLLRKQIPSNIRIIVELAII
    ASLVIITDEVLKAFFYDTSKQLSIFVGLIITN
    CIVLGRAEAFALANTPGDSFVDGIANGIGYGLILVAVAFIRELLGSGN
    IFGIPVIPGFMIEAGYQNMGLMVLAPGAFFIIGLLVWLKNSLPGVSHENK

    >gi|224367811|ref|YP_002601974.1| NqrE [Desulfobacterium autotrophicum HRM2]
    MGDLFSLFINSVFIGNILLAYFLGMCSFIAVSKNIETATGLGFAVIFVLTVTSPVNWVVYHGLLAPGALAWAGLPNVDLS
    FLKYITFIAVIAAIVQALEMVIDKYSPLLYAALGVFLPLIAVN
    CAILGTSLFMVERNYTLVESMVFGAGSGTGWMLAIVS
    MAAIRKKVQYADVPVGLQGFGITMIVAGLMAMTFMMFSGITL

    >gi|224367843|ref|YP_002602006.1| Dihydrolipoyl dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes) [Desulfobacterium autotrophicum HRM2]
    MTREVDVAIIGAGTAGLTAQEFVAEKTDNYVIIDDGPLGTTCARVGCMPSKALIAVANNFHKCLFFDEYGISGANALRPD
    YSRIMAWVRMLRDEFTDGVIQEMSTFTDRLIRKRARFIDANTLDLGDERIRARRIIIATGSKPWIPERWQPYKDLIIDTD
    QFFELADLPGSLAVFGLGPIGIELGQALHRLGVEIIAFSRRKTAGGLTDPDLQTYAFEHFSKEMNIKLGTADIRRRLGNK
    VVVGCESGEWTVDRILLATGRRPVIQDLGLENLGVELDDRGMPPFDPGTLQIKDLPVFLAGDVNGQKPILHEAADDGTIA
    GYNTTAKRISCFKKRTPLAITFSSPDIAIAGLSHKELTTRGVEFVTGKASWEKLGRARMILGKAAGIARIYADKKNGRLL
    GAELMAPAGEHMAHLLSWAVGAGLTAARALTMPFYHPVPEEALRSALGQILKQIDDPAPDFRLELCQKKGDS

    >gi|224367920|ref|YP_002602083.1| FAD/NADH-dependent pyridinepyridine nucleotide-disulphide oxidoreductase [Desulfobacterium autotrophicum HRM2]
    MKNGERLVIIGGGGGGFATAMRAKALMPKIDITLVRKEKRFIVRCSLPYVVSGLVTGESIVNPDKKFIDAGINVIVDEVT
    HVDTKQKKVRLSNAREIPYDKLVMATGATPVVPPIEGSDLDGVFTFRSLSDAEKILDFMEKKKPRKMIFIGAGFITMELA
    SNLLITPSERYEITIVEMLEHPLPLMLDAEFGTKLQEYLTEKGLKMKMGHRVTKILGRDQAVSAVVLENNEQLEADLIVL
    NVGVKANLELAKQIGLETGAYGIKTNEYMETSEPDIFALGDCAEKKHFITGKPVPGVLRGPAIIAGRHVAKKLAGYDVPF
    PGVLDNAVVRLFDKSIGFTGLTETRAREEGYDPVCATVESRSKHMMMPGMKPWTIKLVFDRKSKKLLGGQILSDSEAPVK
    EIDTVNALILGGKTVYDLCSIMCAGQPDLSSEPSAEPISIAAEQVLVKM

    >gi|224367988|ref|YP_002602151.1| MsrAB [Desulfobacterium autotrophicum HRM2]
    MKTRMMMFLMIFTAVFIFGCLSFAEKQETKEVTMKTDTKSHMEKLDVATFAGGCFWCTESDFEQVKGVKDVVSGYTGGHK
    TDPTYSEVSGGTTGHTEAIQVYYDPGMVTYNELLAVFWRHINPTDPGGQFADRGSQYRPEIFYHNDNQKEEAMASKKALE
    ASMVFDKPIATAITKFEKFYPAEDYHQDYYKKNSYRYKYYRWGSGRDAFLEKTWGKKAMEGKTMEIKEKNAMETASWSKP
    SDAEIKEKLTPMQYKVTRENGTERPFNNEYWDNKHQGIYVDIVSGEPLFSSTDKFVSGTGWPSFTKPLESEHVIEVTDKT
    LFMVRTEVRSRYGDSHLGHLFDDGPKPTGLRY
    CINSAALRFIPKENLEAEGYGRYLDLF

    >gi|224368102|ref|YP_002602265.1| pyridine nucleotide-disulphide oxidoreductase [Desulfobacterium autotrophicum HRM2]
    MKSDVVIIGGSAAGLMAALTLKKRAPEKTVTIIRNVINTPIPCGIPYIYGIMGQVNKNLIPDQGFIDQGIEILQREVEDI
    DRADKAVVFSDGDRISYDKLIISTGSKPFVPPLAGIDKTNVFTVKKDPVYLQKVYTALTPARNVVVIGGGFIGVEMAEQI
    ALMGQKAGIEKKVTVLEMMPRCLMLACEEEFCLEIEEELKKVGVMVKTNCQAEELIGNGGIKGVKLANGEIITADAVVIG
    IGAQANIDLAIKCGLEADPRNGIKVDKYMQTDDADIYAAGDCASKFSCITGKPSGIRLASVAASEGMIAASNLCKGRSRV
    TMGALGAFSTKVGNRSVAAAGMTSRSATEEGIEFVVGEVTTPNRHPGHLPGSVSDMKIKLLFRRDNDQVIGGHVSGGDAA
    SDMVNIIATAIQANLTAEQLAVMQYATHPLMTASPLSYHVMLAAENAAVKLR

    >gi|224368127|ref|YP_002602290.1| Glutaredoxin-related protein [Desulfobacterium autotrophicum HRM2]
    MGKGRPMEPDQRIKKELPNGWQNEIKACKGLRLKPYQTIKFKGVPMLKVYAAHWCPHCTKTVDYLKKNNIEFEYIEIEAQ
    PDQTIKKIIEVNGGDDWVIPTLEFNGKWRPGKVYNEFELHFDLKEMGVIGQK

    >gi|224368143|ref|YP_002602306.1| Tpx [Desulfobacterium autotrophicum HRM2]
    MAKFTIGGNPANTSGDLPQVGEKAPEFLLTKTDLTDISLKDVAGKKVVLNIFPSVDTPVCSASVRRFNSEINNYANAVVL
    CVSLDLPFAHSRFCETEGLKNVIPVTELRNRDFGRAYGLRIVDGPLAGLLARGVVVMDEQGTVIFSKLVPELKTEPDYEP
    VLTVLGKRVSAENVCTQTSTAEHSRLNENDEPCDDGRAG

    >gi|224368177|ref|YP_002602340.1| rhodanese-like domain protein [Desulfobacterium autotrophicum HRM2]
    MKWKPYLTPIRSFDPDEARAFLNHRPVDQVTLVDVRQPGEYQAGHIPGARLIPLPELVDRLDDIPRNFPVIVYCSSGPRS
    RAACQLMTLDDSFGEIINLTGGFNAWEGEAALGRENQGLTFFTGAETPREILEIAYGLEQGLREFYLSMDKQVKNPGVRR
    LFATLARVETLHQESILREYQRIIDPSIKEDQLTAAALQGTLEGGMTTQEYIDYYMPQWEDPEDVVFLAMAIEAQALDLY
    LRAKTRVVDETSRKILTRIAQEEKSHLVHLGELMDGLISGTAT

    >gi|224368270|ref|YP_002602433.1| HesB-like domain protein [Desulfobacterium autotrophicum HRM2]
    MIDVTLAAQDQVLAYFEGKESKSVRIFLNNGCGGAQLAMAVDEKTPKDKVFEYKGVEYVMDQKLFDQAKPVLVDYSNNGF
    KLESSLKLSSGCSSCGSKGSCCS

    >gi|224368278|ref|YP_002602441.1| TrxA1 [Desulfobacterium autotrophicum HRM2]
    MAESVIVVCDSCGTKNRIPRDRIDQGPLCGRCKQPLGREQIFTAPVTATDQTFDQEVLAHRGGVIVDFWASWCGHCKTME
    PVLSGLAKAYAGRIKIVKVNVDENASTAARYRIMSLPSLVFFKAGKVVDSTVGALSRGEIETRLKPLL

    >gi|224368284|ref|YP_002602447.1| HdrA1 [Desulfobacterium autotrophicum HRM2]
    MTNKPVGSVLLAGGGISGIQSALDMADSGYYVYLVEKSSGIGGAMAQLDKTFPTNDCAMCIVSPKLVECGRHLNIELLTL
    SEIEKVTGEQGNFTVTIKKKPRYVDEDKCIACGLCAEKCPKKVPDEYNEGLNYRKAAYIKYGQTVPLKYAIDPDNCIMIN
    KGKCGVCAKICPTGAINFEMKPEFVDVNVGAVVLAPGFKPYSPKGVDYYGYDEIPDVITSLEYERYLSASGPTIGHIARP
    SDGGEPNKIAWIQCVGSRNTNCVKNGYCSSVCCMYSIKQAVMTGSHLSSDDNEQTIFYMDMRTVGKEYERYYEASKTQGV
    SYVKARPHTLLAGPDGVGVTMTYTDENGVQHNNEYFDIVVLSIGLEAPQDAMVLADKFSFDLTQYHFAKTGSFAPVSTTR
    DGVFVTGAFHSPKAIPKSVIYASTAAAEVEAVLSESKNTLTREKTWPEEINIADQDPKVGVFVCSCGTNIAGVIDVKAVS
    AYAATLPGVEYVENNMFTCSTDTQDLIADKIREKGLNRVVIAACTPRTHEPLFQETLQGIGLNKYMVEMANIRNQNSWVH
    PHEPERATAKAKDQVRMAVAKAIGNYPLTDVSVNVTPRALVVGAGLAGMNAALGLANNGYETVLLEKGTALGGVALDLYE
    TWKGELVKPGLERVIADVENHDLIRIFTNATLKSVTGSVGSFIGEIARGEETETLEFGACVLATGGKAYTPHEYLYGEDP
    RVVTALEFDRKLSTDQAALTAVNSTVFIQCVGSRDKERPYCSRVCCAGSVANAVLLKKSNPGMDVYVLNRDIRTYGERED
    IYKEARDLGVLFISYTPETKPRVTRSGDDLIVTVHDPISQFDLEITADRIVLATAVIPNETASFVNIFKCGVNADGFLSE
    AHPKLRPVDSTVDGLFLAGLCHYPKPINEAIAQGKAAASRASVVLSKKTMKLDAIKSHVTQNCDGCALCLDVCPYNALTL
    VEFEENGKQHRRIKTDRALCKGCGICAATCPKEGIVVDGFTPGQLRAQVDAILEKV

    >gi|224368298|ref|YP_002602461.1| HdrA2 [Desulfobacterium autotrophicum HRM2]
    MDKIKGALTKVSGAVMVVGGGIAGMQAALDIANSGFYVYLVERSPAIGGKMAQLDKTFPTNDCAMCIISPKLVEVGRHSN
    IELLTLTEVTGISGQEGDITATLTQHPRYVDTDKCIACGLCAEKCPKKVDDEYNEGLGKRKAIYVSYSQAVPLKYTIDPE
    NCLYLTKGKCGNCEKVCPSHAINYLDTAREITINVGSVVLSTGFKSFDPSKLDYLSFGRHPDIVTSMGFERVLSATGPQG
    GHLVLPSDKKHEKEPQKIAWLQCVGSRDENRCNNGYCSSVCCMYAVKQSVMAKDHSKQPLDCAIFYMDMRTQGKDFDTYV
    ETAKQKGVRFVRSRVHSILPDTETGDLIMGYADELGVMNREHFDMVVLSTGLEISAESFELATGMGIELTPSNFIKTDSF
    NPVSTSIPGVYACGVFTGPKDIPQSVMEASAAASAATEGLSTARNTKTRTVTLPEERRVEDEQPQIGVFVCNCGTNIGGI
    VDVPSVAAYARTLAGVTYVEENLFTCSQDTQDKLVEVIRAKGLNRIVIAACTPKTHEDLFRETLINAGLNKYLVEMANIR
    NQDSWVHSNQPELATAKAKDLVRMAVAKAFRLDPLFESKLPVTQSALVVGGGIAGMTAALSLAHQGYPVTLVEKNQVLGG
    NGRRLYKTYKHEDVPAFMKKIINEVETDDKIEILLGSVIDKVDGFVGNFKTTIATGENNRTVDHGVAVIATGAVESSPSE
    YCHGEHEAVMTLLELDARFLDDAKRLETAENTVFIQCVGSRNQEHPYCSKVCCTHSIKSAIALKERHPDMGVYILYRDIR
    TYGEREFLYKQARELGILFFQYDLENKPEVVPEGDHVTVTFKDHVLGQRLCVDADILCLAARIDARDNTKLGQAFKVTSD
    NAGWFLEAHQKLRPVDFANDGVFLCGMAHYPKPVDESIAQAKAAAARALTVLSRDSINIGGIVAQINPERCAGCGGCIAV
    CPYNAITMDKVNHVAVVNDALCKGCGACAATCPSEAPSLMGFNNEQLYAQIKSAMAV

    >gi|224368345|ref|YP_002602508.1| TrxB [Desulfobacterium autotrophicum HRM2]
    MPETDTDYEIVIIGAGPAGMTAGIYAARARMKVLLLEKAAPGGQVIITDWVENYPGFPEGISGYDLAEKMLTQAKTLGLE
    IESEEVSSMTLTPKVKTLQLGERTITTKSLIIASGASPRKLNVGEEKFMGKGVSF
    CATCDAPFFKEKTVVAVGGGDTAIQ
    EAIYLTKFVNKVYLVHRRDELRATKILQERAFKNKKIEFVWDSVVTGMDGFFGVENVHVKNVKTQESRTIKADGCFVWIG
    ITPNTGFLDKSIELDQWGFIVADQYMATSVPGVFAAGDVRNTPLRQIATAVGDAAIASVSAEHFIENIG

    >gi|224368346|ref|YP_002602509.1| TrxA2 [Desulfobacterium autotrophicum HRM2]
    MSEILEIDDDGFEKDVLNSDKPVVVDFWAPWCGPCRAIGPIVEELEATYGNTVKFVKVNVDENPVTPSKYGIKAIPTLIF
    FKDGKIADQITGMVSKSKLEAAIKAL

    >gi|224368393|ref|YP_002602556.1| SseA [Desulfobacterium autotrophicum HRM2]
    MNKKQRIVLAGAVMLILSTLFMACSSSSVTEKKYPNANLLANSDDLTQAEVVILDTRSAEAYSQGHINGSISIPWQQFLD
    ADSNLLATDQLEQDLSQMGLTRTLSMIIYDDTTASFGGAGRLFWMLEVLGCPSVRILNGGWDKWLADGNTPQITENTRPV
    SVFTAQVNTGITSDKEYIAARMDNSDFAIVDTREDEEFTGWQRYGEARGGHITGAVQIPYPWYFSKDKTVLPYENLKNLF
    ESRGITQDKEVTAY
    CTIGIRSGFAYFLFRLLGYDRASNYDGSIRDWSESDPAAFPMEKLAQYSKLVYPTWVKQVIDYHAP
    GSTTPAPAGYDHDRDHKFMVVETQWGTLEWAEAYKNGHIPGAVHSNSDIYENDYPRWFLLPDDQLHAALADMGITEDTTV
    VVYSDSNIFAARLWWILTYAGVKDVRYLNGGYAAWINAGYEGETQVNNPVSTTAFTGTACPELLATVAEMVQIYDDTDTV
    VVADVRSAPEYKGKISGYSYVVQKGRIPNAVWAHDADDSSLEYTDSDGSLRSFPEIKSLWESAGISSGMTAGQFDRDVYF
    Y
    CGSGYRSSLSFLHAYLMGFSNIKNFSDGWEGWSTEYTHDEDACADSLTPGWCQDPSGRPVATGEF

    >gi|224368495|ref|YP_002602658.1| RhdA [Desulfobacterium autotrophicum HRM2]
    MKKGIFNGLVIVTSMVLMISLWGCGSSSTTSKAVPSDNLTGDTSMFPNNDLIASAQYLLDNGASNVNASANSTPIIIDTR
    SAAAYALGHIPGAINTEWGNFVVWNEPPEKAVLQPVADLETTLGSLGLTREATIVIYDDTLASWGSSGRIFWMLEYLGCT
    HVKILNGGWDKWEADKLPAQTSVNVLAPAVFTAVLNTDINPDKDHILDRMGDSDFVTVDTRTDAEFNGWTLYGEARGGHI
    SGAVHLPYEWYFNSDHSILGYADLQDLFDSHGISDDKEIVPY
    CTAGIRSGFFYYLARLMGYDRVSNYDASMWDWAAANSA
    VYPMEALAHYERLVYPALVNQMMAEEPDLVIVETGWGPVGDNYNSGHLPGAVWVNTDEIEYDCFNPRDNWPVDAGDPPCW
    DRSTTMEEDLAKGLTPGDALPRNWWNIYPDQYLLPAIAYMGIQKDTPVIVYGEDVTAAARIISTLMYAGVEDVRLLNGGK
    TAWTTAGFSLSTEPAQRVSLEEFDPDTPGRTTAIYPEYKSEIPHVREVVNGDVTDAVIVDVRSMDEYLGKSAPYGYIPTD
    GRIPGAVWGLAGSSPWTMEDYTDDQDTTLRSYEEIKTFWVSQGLTPDKHLSFY
    CGTGWRSSLAWFYAYLMGYPQVSNFDS
    GWFEWSMGEGSAYAGADPVLNPIVDDDLTLP

    >gi|224368499|ref|YP_002602662.1| rhodanese-like domain/cysteine-rich domain protein [Desulfobacterium autotrophicum HRM2]
    MIPEIPTTRGIEADKSGTRARRPKRMATPAPIRTRGLDRGPRVMFFLIMIWAAVIRMPNPCQGADLALLDVQALNNDKTA
    WVILDARPVKAWEEEHIKGAFSFSWEQYTTVDKDQIAYRIKDSKILGQALGDLGITPVTKVVVYADAGESWGGEGWLCWA
    LEWLGHQGEVRLLKGGIQAWKRNGFELAQGRSSQPTPVPVSYIPKPDAAMLISARELKQRLHEFQLVDTRSIREWFMGHL
    PGAVHISWTRFFTGPDRIPLDVVQLKKLLKKNDLNPDKPIVYY
    CSGGIRSGYSWLVHELAGLPESLNFEGGTAEWEVVYP


    >gi|224368543|ref|YP_002602706.1| HdrA3 [Desulfobacterium autotrophicum HRM2]
    MKGEADKRFPVIVVGGGVAGLTAALDLARAGRPVHLIEKSAVLGGQVTRLDKLYPTDHCAFCPVWTQARLCLGHPLITVH
    THSCIEDVTQGKEMGKKQEQGLIQIIICRDLNRIDPGRCILCGRCEKVCPENAVSPTICHALPRTFLVDINACTGCGKCV
    AVCPTHAIDLERKQDRIKILAENIIWATGFAESEVSVLPELGYGSHPNIMTSLAFEALLSESGPGRGHVLTPGGKVPRRI
    AFVQCAGARDQRKFAYCSAVCCMHALKQARWVKQRDPGMDCVIFFTDMRTEGRHYYNYYRQAVQEYSIVLVRSRPGLICP
    LPSGDGLAVRYENTRTGQVKTERFDLVVLNGALEPCQKADKGSAPLPLTDDDGFIGKPSNPALACGFCRAPADVEVSVVQ
    ASSAAMGAYMGKGINGKD

    >gi|224368615|ref|YP_002602778.1| ZntA [Desulfobacterium autotrophicum HRM2]
    MVHAMLMESDEYKDTKDFKDTDLYKQCVAAGIVPDTTKETSESWEARLEPPAPELSGTDSEVPMDAGNFLTLNLQIQNMW
    CPACAWLIETTLTRSKGVVNASCNFSSDRGSVVYDPVKTSPDKIYAAIEKLGYPAADINQKASKSRAEFIRICVTLFLTM
    NVMMLSWSIYSGFFIELSPHAVQLLAWPVFLMATVVVFYGGYPIHKRALAGITSGFPGMETLVSTGSFSTYTYSLFHFYR
    GSIHLYFDAASMLILLILTGKMLEQTAKNKISEGLWKFFSLVPQKVRICADQFPRGRYVSIKQLSQGDAFLAEEGEILAA
    DGIVTRGSAVIDESSITGEAKPANVRPQDTVKSGTRIISGKIQITAVKVGEDSILGRMLAIMENSLSEKTAQTQRFEDIL
    KFFVPSVIGFSIVTYFFWMLYGLTSYEAFNRGISVMVISCPCALGIAIPLALVAGVSAAGKKGILVRDFEAFEKVNGLDT
    IVFDKTGTLTTGKLKVLGMDTANNFPAQKAWQIVHAMEQESDHYIAHTISAFAMAMNLPPLDLEDLTYHSNGISCQYQDK
    IYCFGSRDFVNKSNPADPSFISFARQGAQVISTVFLAQDDTIVAAVHLGDAMKTGVKTLVADLYKRGLTCYLISGDAERP
    TLAAGAFVQIPAENAHGGLLPHEKAEFIKTLKQSGKKVAMVGDGVNDAPAMGQSDIAMAVHSGLNPGEGVAAITLMQETP
    VQIIDFIGLATRVNRKVKQNLIFALVYNIISIPVAAGGFLNPIIAATAMLFSSLSVTCNTLLLVKQESKNKPVS

    >gi|224368664|ref|YP_002602826.1| hypothetical protein HRM2_15540 [Desulfobacterium autotrophicum HRM2]
    MAHTLSAAPTAKAEGPFSHIPHPGTQLYDKNLIQRLENARKVHGRTYRPRTKHLHPDGSAKYTNRLFLESSPYLLQHAHN
    PVNWYPWGDEAFETARKLNRPVFLSVGYAT
    CHWCHVMEEESFENEEIARYLNENYLCVKVDREERPDIDSIYMSAVQALT
    GRGGWPMNVWLTCDRKPFYGGTYFPPRDGDRGADIGFLTLLEKLIQSFHAQDGRVENAGRQITAAIQQMMSPKPGTRLPG
    KETIQNAVSFYRQSYDSRFGGLSGSPKFPSSLPVRLLLRHNRNTFEKVKQDTNILEMIDHSLAQMAGGGMYDHVGGGFHR
    YSTDEHWLVPHFEKMLYDNALLAVVYLEAWQATDNADFKRVVNEILSYVIQDMTSADGAFYSATDADSITPRGHMEEGWY
    FTWTPEELDAILGKENSKIIKRYYSVGVTPNFEKRHILHTTKSRAETASALNITEEKLAKIIETSRELLYLERNKRPAPL
    RDEKVLTAWNALMISAFARAGFTLNNTVYIDQAVRAARFIMENLYIDNRLFRSYKDGKARHNAYLEDYAFFIAALIDLYE
    ATHDIEWLKKALELDDVLKTFYEDRKNGAFFMTSSDHEALISREKPYYDNATPSGNAIAILNLLRLHSFTTDYRYKQRAE
    KALKFFSERLNTAPSALSEMLLAIDYYFDNPKEIIVIAPTEKPDAGDCLLETFRNLFIPNRILMVADEKQAADHAKIIPL
    AQGKKAINGKATAYVCENGTCKLPTSDPEVFDKQLQPDGPTLLKVS

    >gi|224368720|ref|YP_002602881.1| rhodanese-like domain family protein [Desulfobacterium autotrophicum HRM2]
    MSYLNQAFREMDLHFFGSGEHGMSIEGMRKVLGNDHFLFLDVRTDEEVKYLSFPFVLHIPLNHLPDRLDEVPRDKFIVTF
    CSSIFRGAMAYTYLLANGYEEVKGLTASSEDMALAFKPGPLVKM

    >gi|224369308|ref|YP_002603472.1| HdrL1 [Desulfobacterium autotrophicum HRM2]
    MTNKVTGSVAVIGGGISGMLSALDLANSGYYVHLVEKSPSIGGVMSQLDKTFPTNDCAMCIISPTLVEVGRHLNIELHTL
    SETKSIKGKAGNFQITLDRTPRFIDTAKCTGCGECAEACPVTLPSIFEQGLTTRHATYKPYAQAVPGAFSITKKDRSPCT
    NACPNSVNAHAYVALAGKKKYKEALEVILRNLPLPGSIGRICPHPCEDACRREQVESAVSICTLKRFVADQVNIKDLPAP
    EIAPRPERVAIVGAGPAGLSAAAFLAGKGVKVTIFEALPAAGGMLKVGIPDYRLPPKVLEDEVSYITNQLGVEIQYNKAL
    GRDFTVDALFAEGFASVYLAIGCHRGMELGIPGEAFNGVISGVTLLKEAALGTGKPLKGKVVIIGGGDVAIDAARTALRI
    GAEKVSILYRRTETEMPARDEEIEDALEEGVDIQFLTAPKEVVAEDGKTVGIRCFRMELGEPDKSGRRRPVPVEGSDFII
    NTDYIIPAIGQRTDTSCIDEKQGITINRWGNIEVNPLTFETQRKGVFAGGDAETGASIAINAVAAGNQAGVSILRFLDHE
    DLAQGREPVEYAQKNFNPIPDRIKKVQRQTMARIPMEQRLAGFDEVELGFTEEQAIAEASRCLDCMVCCECYECVKACGA
    GALTLETHLEKGATETIDAGAVILAPGFTAFDPQGLDNYQYANHPNVMTAMEFERILSASGPTQGHLARFSDHKEPKKIA
    WFQCVGSRDMNRCDHKYCSSVCCMYALKEAVIAKEHAGDSLECTIFFMDMRTHGKDFERYYNRAKDLGIRFVRSRVHTVN
    PVAGTDDLNVRYVDEMGSMESETFDMIVLSVGLEISPEVVDLANRLNIELTEGNFARTESFAPVETTQRGIFVAGAFQGP
    KDIPQSVVDSSAAAAEAGALLSSARDTMTKKAEEIPETNVIGERPRIGVFVCKCGSNIAGIVDVESVRDYAAKLPYVEYC
    SDNLYTCSQDTQDTMTQIIKENNLNRIVVAACTPKTHEPLFQETLINAGLNKYLFEMTNIRNHASWVHKASPKLATEKSK
    DLVRMAVSKVALMEPLKEAKLNVNQTALVIGGGVSGIASAKNLAEQGYEVHLVEKSDKLGGQANNLYRTYLEEDIQQGLT
    DLVTSVTSNDKVHLHLNTTLDDVEGFVGNFKSTLTTNGKPETIEHGVAIVATGATGLKPKEYLYGKDPRVLTSLELDRRF
    IDRDEELKTLNSAVFIQCVGSRDKDRPYCSRVCCTHSIDNAIALKTINPDMDVYILYRDIRTYGEREYKYQQAREMGVIF
    IRYSLDNKPVVEASKESLKITITDHVLGIPLEIEADILTLASAIVPNRDERLANFFKVPLNEDGFFVERHAKLGPSEFAT
    DGVFLCGLAHYPKPIDEAIAHGQAAASRAVTLLARQTVSMSGNVATVDPMVCSSCGVCVSICPYSAPSFATEGRFKGKAE
    INPVLCKGCGLCVASCRSGALHLKGFDTNQIFAQIFALDEAV

    >gi|224369367|ref|YP_002603531.1| HdrL2 [Desulfobacterium autotrophicum HRM2]
    MAVRIGFYVCHCGINIAGMVRVEEVAEYARSVKNVVVARDYKFMCSDPGQELIERDIRELGLNRVVVASCSPRLHEKTFQ
    NACQRAGLNPYNFQMASVREQVSWVTDDKDSATLKAKTLSAAALNRVNFHESLDSRTVTINPNVLIVGGGIAGMQAAIDI
    GNAGLQVYLVEKDTTIGGHMLQYDKTFPTLDCAA
    CIGTPKMVETAQNPFVELMTLSQVEEVSGYIGNYTVRIRKKARYVN
    HRCTGCGECASVCPVEMDSPWDLGLLKRKAIYRSFPQAVPITFAIDKYATPPCRIACPAGTNVQGYVQMVKMGNYQQALN
    IIMERLPLPGVLGRVCPHPCENECRRALIDTAISIRDLKRVAADLGDLAQVPVAMGPERNQQIAVVGSGPAGLTVAYYLR
    QKGFKVTIFERHEKPGGMLRWGIPDYRLPPAVLDREIDHILGTGITLRTGTALGRDFTLKSLNADGFDAVFLGLGTHGPV
    DLGIDNGNALGVVDAVEFLRAVNQGERKAIGKHVVVVGGGNVAMDAARVAVRLGAQRVTVLYRRSEQEMPADREEIQGAR
    DEGIFFLVLAGPVRVIADQGRVTGVTCIKNTLGPPDRSGRRRPVPVENTLFTLDCDTLIPAIGQRLDLGTIDEGFELTSW
    GTVSVDHTTMETSIPGVFAAGDAVTGPATVIEAVAAGHRVVAAMAQYLDSKQSQAVEQEKDRPDPGGKTDLIQEQRSTDY
    APMPKDPEQLPRQTPVFLDPETRKNNFDEVDPGFTPEAAALEAQRCINCGGCCECKLCVDACEPGAVDHEMRAEIVEVKV
    GSIITATGFDPLDPTPMKQYGYGRYPNVFTSLEFERLSNATGPTGGEILIRDDKGQLTRSPRSVALLHCIGSRDVNYHEY
    CSRVCCMYALKYGHLVHEKVGHDTLVYNFYIDMRCFGKGYEEFYTKCQQEGTVFIRGKVAEITDRAETDSEQGKLVVISE
    DTLLAEKIRVPVDMVVLCTAMEARADARDIGRVLGINQGSDGFFLEEHPKLGPLNTATDGVFIAGACQGPKDIPDAVAQA
    SGAAGKALLLASRGEVTVPSTVSYIDPDICAGCKTCIGLCPYTAISFDELHGVSVVNEALCKGCGSCAGFCPSGAAQVRH
    FNEKQMFAELSGVMDSINSL

    >gi|224369370|ref|YP_002603534.1| HdrA4 [Desulfobacterium autotrophicum HRM2]
    MIKKQGQALVVGAGISGIRSALDLAEAGCRVTLIDAAPHMGGVLSKLEHQFPTDGCGMCRMLPNTDRESCFQGCLRKGLI
    HENIEVKLLTRLVKVEGEPGNYHATLESPVPIVDPNRCTGCNLCAQVCPVSIDDPFNHGLSRTKAIYLPVPHAVPNIYTI
    DMNHCTLCGECEQTCPFDAITLPADHRKNFKILVVDDEQIVRESLKDWLEFEGFVVETATSGQGALERLEATPFAMMFLD
    IKMPGMDGTEVLSRAKEQFPDLVAVMMTAYATVETAVSTMRSGALEYVIKPFDPEKVVSLVKKVFLEQRPDLRESAGIDV
    GAIVLATGVDYYDPMAGTNTFGYKALADVVTNSELERILSQTGPFNGELKRPSDGRVPQRMAWIQCVGSRQKDFPICSSI
    CCMIALKEAVLVRQRSCGTIETVIYFMDMRCSGKDFEAYRKRAENEYGVILKRARPHSVCPAPVAAASPGTPPESGGLLV
    VISEDSGKRADEIFDMVVLSVGQRPGKDTNDLAAATGVDLNPFGFLSSPYQDLFLDNGKKAGVFVGGSASGLKEIGESVI
    YASWASSLALKTIRAAKAAGPGDGPDKEPALPNVLRDVSSEISDIGVVVCQCPLGPDIAQQVAPIVEQDIHVSKMIKIDR
    ICTQAGWDDLVHTLGGTRFNRLLVVACDPLLFIKKKGEIAAAMGLDPAYIEFAEIHRDQPPGPSVRMGLARIRHLARPKT
    HTPAMVPRVLVVGGGIGGMTAALGVAGAGFEVVLVERSSELGGNLAWLDKNISGNDLQALLKTTRERIGKTPGITVYTHA
    TVDNTRGGPGRYSTVININTESNPDGSNPGSPNPHGPSPKGLREIFHGAVILATGGQAAETKAYGYGTSPVVMTNQEVEI
    ALRSGKLDPETLNAVVMIQCVDSRELRMDARPYCSRICCTSSLKHALELKRANPELDIYVLYREMMTQGVTEAYYKEARD
    LGVIFIRYTLDKKPEVAFESDQAMVRVNEPILDRILEIQADLVVLATGIVAKGVEPLAGFFKAGVDSYNFFKEADPKWRP
    VDAVTGGVFACGLALGPRDVEESIASAGAAAMGAVRLLSSSGIASSPVTAAVKQSLCSVCGRCIDACAFGARTLDPDTNR
    IKIDPIICQGCGACASVCTNSAAYVNNFLDQQMFEIIDAAV

    >gi|224369469|ref|YP_002603633.1| TpxA [Desulfobacterium autotrophicum HRM2]
    MAKTQLAGNNVILAGDFPGKGLPAKNFTAVLQDLSETTLDAFKGTKVVLNVFPSIDTDVCATSVRTFNQKASAIGNTKVV
    CLSFDLPFALKRFCGAEGIENVLTASLFRNPEFATDYGVLITDGPLKGLAARAVFVVDEAGKIIHAQLVDDITHEPDYDA
    ALAALK

    >gi|224369475|ref|YP_002603639.1| RnfE1 [Desulfobacterium autotrophicum HRM2]
    MADQPTASERFLQGILPENPVYRQLLGLCPTLAVTNGMKPAITMAVSVAFVLVCANVVISLIRNLLKPHLRIVIFTLTIA
    TFVTIADRVLAAYLYQMSKTLGPYIPLIIVN
    CIIICRCEVCASKQSPFIAASDALGQAIGFGLALSSIAAVREILGTGGL
    FGIQLLPAAWPDWVIMVLPPGAFITLGLLLGFVNWLGMRKSGGSI

    >gi|224369476|ref|YP_002603640.1| RnfA1 [Desulfobacterium autotrophicum HRM2]
    MNYLVDIILIALSAALINNFVLYYFVGICPFIGVSRRVDMAFGMGCAVTFVITIAAFLSWTITTMVLIPGAPLSSFVAGF
    FLSKEAASTIDLTVLSYIVYIFSIASSVQFVEMYVRKFFPILYKSFGVFLPLITTN
    CAILFACLTIMSNVVGVENPADAW
    DLWHSLTLAFFGGVGFTIAIVIMSGIREDLELCDIPEPFKGAAITLVVGGILALSFMGFTGVDSGLRKAMTPAQETAMVL
    PLEPAQTAMIEFNQGGMDQ

    >gi|224369525|ref|YP_002603689.1| putative transmembrane protein (YeeE/YedE family protein) [Desulfobacterium autotrophicum HRM2]
    MKGQLNWFKGGLLLGASFLLAVAFVKPIGVSTQFVIADGIVWNLFSDTVVQKDAAIKSGYTSSNAYLNKSGGSYAKNVAN
    PFNYSFVFVIAMVAGAFLSSRLGGPRPTALDRSAPEVWRQRFGNNFALRNLTVFFAGVVVLIGARLAGG
    CTSGHMMSGMM
    QTSLSGYLFALGAFAAAVPVAIMVYKRN

    >gi|224369595|ref|YP_002603759.1| LpdA [Desulfobacterium autotrophicum HRM2]
    MAEQIAIIGAGPGGYAAALRASSLGAKVTLVEREGVGGTCLNWGCIPSKIMKTTADLLLKFNEAQKYGINVQGPVALDMV
    ALMARKQALIQTQQQGILSLLKKGRVTVLMGRAKIKAMGLLTVTDDSGTRTEIAFDRLILATGTIPLNVPAFAFNGRTIL
    SSNDLLSLKQIPPSIIIVGGGVIGCEFAFILAALGSAVTVVEAMDRLLPLDSVDTACSKLLLREMKKRKIKVILDRSVTT
    CEPHDRGVSVMVGASPFSNLKTGATVTPVKIEVSAMAVCIGRTPLSKDLGLEAIGLKTDGQGWIPVNDAMETTIKGVYAI
    GDITGPANIMLAHVATHEAMVAAENATGGTRTMSYNAVPNAIFTMPEIGTVGLSEEGCQKKGIDAQCFTVNFRAIGKAQV
    MGEIAGEAKIVLERPSGRVLGLHLIGPHATDLIAEGALAVKKGLTISDLAETIHAHPTLAEIVSELALKATGKALHG

    >gi|224369805|ref|YP_002603969.1| putative rhodanese-like sulfurtransferase family protein [Desulfobacterium autotrophicum HRM2]
    MGFPCPFKPEAGNSWSQPGRMMVTRHDIKGIVILLMISLCSAFAFNFWSNEGIAFLGQWDKSRGVVFPKEKNTVVDSHRE
    INNLDTMARFVKDRACTIVDVRTKVQFDQGHLPGAVSVPMADYDQMIGDFFVNYPPGLCLIVY
    CSGRECHDSHRFADRLE
    TLGYTDLRVFSGGFPEWEQGGLTVETR

    >gi|224370085|ref|YP_002604249.1| putative selenocysteine protein [Desulfobacterium autotrophicum HRM2]
    MLVKNNAETGAWFLSLVLIFFWVLSLSSPLFAASPNIRVAYFGMQAGELESCGCGGRKAGGLSRQTTVINELRLENGAEN
    FLIINSGDSLGNLEPDEPEMKKAEVIFKSFSMMGMDVIAPGLSDFRFGVPYLNGLIKQNKLNAVCANLVYSETELPCFSK
    YSLITRGDKRILVTSVLSPGARYLVNMNYKVLDPVKALAAVRDQVPHDLMIVVLQTDLDQAQEWIKMTPGIDLAIVGAKH
    AVCYEKIKVNNASLVYNNDKGQVISHVDLSINGGKIDIPVPKGVPVMESMIQADGEIVKLIEAYKTWFKDYTDKRNKETN
    NDSHVIVPEFYVGSQWCVRCHGEIVDSWKKTSHANAIESLVKKGEAENPECLACHATGVEEAKKQGLGELSSILAASKML
    NVQCEACHGPAGIHVRNPKLTSHFKKVDKNTCIRCHNDKYDPGFDFEKKSKIVMHVGGGQK

    >gi|224370161|ref|YP_002604325.1| putative fusion protein, heterodisulfide reductase (HdrA) / ferredoxin (iron-sulfur-binding protein) [Desulfobacterium autotrophicum HRM2]
    MNSQTGKVMVVGGGIAGLTAAWELARQNIGVELVEKSCFLGGHSIGYTCKATDMCQKCGACSVEKMLKDVVGEPLINVHL
    RTEVDALDRSKGYRVTLKKSAQDQAAGKVLKGFSRHNSPLYVVGENVTEAVPEGAMKIQEMGSECALDVDAVILATGFTP
    FDASIKGTYGYGKWENVITGLEFEHIERENAGIVRPSDGLPPKRVAFIQCVGSRDERLGHLWCSEVCCAYGLRMAGTIRH
    QDPEAEVSVFYIDVQNVGKEFPVFYERIKENVRFVRTIPVDIYPVENDCLKLRHMAEDQGTPTFEEFDLVVLSIGIMPGA
    DSKLISETFGVPMTVDGFLDDSVGDGIFVAGTAAGPGTIAASMAKAGKAAFDAAKYVGGAK

    >gi|224370172|ref|YP_002604336.1| HdrL3 [Desulfobacterium autotrophicum HRM2]
    MVEKLIANNSTSGAVMVLGGGISGIQSAIDLANSGYYVYLVEQSSAIGGMMAMLDKTFPTNDCTMCVISPKLVEVGRHLN
    IELLTNTELLALSGEKGAFTAHIQENPRYVDLEKCTSCGDCAKVCPVDFPSEHNQGLNTRKATFKQYEQAIPWAFSITKK
    DRSPCTNACPNSVNAHAYVALAGEKKYKEALEVILRNLPLPGTIGRICPHPCEEACRRQLVESPLSICSLKRFIADQVNI
    KALPVPEILPRKERVAIVGAGPAGLTAGAFLARKGVKVTIFEALPVAGGMLKVGIPDYRLPPRVLEDEVFYITGHLGVDI
    QYNKALGRDFTVDSLFEDGFASVYLALGCHKGMELGIPGEASDGVISGVKFLKAVALGT
    CKRLTGKVVIIGGGDVAIDAA
    RTALRMGADKVSVLYRRTKIEMPAWDEEIEDALEEGVDIQFLTAPKEVVATDGKTIGIRCLRMELGEPDNSGRRRPVPVE
    GSDFVIDTDYIITAIGQRTDTSCMDEKQGVTINRWGNIEVDPITFETRRKGVFAGGDAETGASIAINAVAAGNEAGVSIL
    RFLDDQDLAQGRGPVEYAQKEFNSIPDTMKKAERQTMAKIPMERRLAGFDEVALGFTEDQAVAEANRCLDCMVCCECLEC
    VKACEAGALTLETHLERQITRSIDVGAVIMALGSRPFDPKTLDDTYMYLRSPNVMTSLEFERILSAGGPTMGHLVRPSDG
    RAPEKIAWLQCIGSRDTNRCNNGYCSSVCCMYAIKDAMIAKEHSKMGLDCAIFNMDMRTFGKDYEQYYLRARDQDGVRFI
    KSRIHSVDEVRETGNLILNYVDEKGAMIKEEFDMVILSVGLEIPMESRSLARRIGVETDPHGFALTSPFNPLESSRPGVY
    VAGVFQGPKDIPASVTDASGAACVAGMALADARNTQVRTVEQPAERDVTDEPPRIGVFVCKCGINIAGVVDVDKVDAYAK
    TLPNVVYSEMNLFTCSQDAQVGIKEKIEEHRLNRVVVASCTPKTHEDIFMETLEKSGLNRYLFEMANIRNQDAWMHSETP
    EKATKKAEDLVRMAVARVATLTPLHEKQIPVTRRALVIGGGVAGMTAAKALGDQGFETVLVEKEKRLGGLGNRLVSTIEG
    GDIRAYVTQLAERIENHENVQVLKESLIVGFTGYKGNFTTEVLVGPGMYERKIHHGVVVVATGADEYTPVEYLYPETDRV
    TTQVELAQRLHDQGAGDLEHVVMIQCVGSRNDENPNCSRVCCQSAVKNAIAIKQGNPEATVFILYRDMRMYALLEEYYTE
    ARQLGVLFFRFDRNDPPVVEQTDNGLTVTFTDHVLGVKLSVETDLVALSAGVQAADTQELASLLKIGRNPQGFFIEAHVK
    LKPVDATTEGVFICGTAHGPKLISETIAQALAAASRAVTFLSRDYLTLSAVTAEVDPENCAACLICVRSCPYNVPVINAE
    GVSYIDPALCQGCGVCAAECPAKTIKLNWYEDQQLLSKVEALLEEVS

    >gi|224370290|ref|YP_002604454.1| electron transport complex RsxE subunit [Desulfobacterium autotrophicum HRM2]
    MAQSMAKEFTKGLWAELPPFRLVLGLCPVLAVTQSVENGIGMGLATTFVLICSNFLVSLLRTIIPAKVRIACYIVIIATF
    VTIVELLMQAFTYELFLKLGIFIPLIVVN
    CIVLGRAEAFAGKNAPHLAIADGLGMGVGFTLSLGALGLVRESLGAGTILG
    HPVFGPDFQPFTFMVQAPGAFVCLGLMLCIMNLIGKK

    >gi|224370291|ref|YP_002604455.1| RnfA2 [Desulfobacterium autotrophicum HRM2]
    MTDYFVLAISCIFVNNILLAQYLGNCPFLGTSKKMETATGMGMAVVFVLVLAGLITWVTNNYLLKPLNIEYLRTLSFILV
    IASLVQFVEMFLKKSIPALYAGLGIFLPLITTN
    CAVMGVCLINIKEDYSFLQAAVASFSYAVGFGLALVLFAGLRERINI
    ARVPQPLQDTSLGLVTAGMIALSFYAFKGMV

    >gi|224370292|ref|YP_002604456.1| putative NADPH-dependent glutamate synthase [Desulfobacterium autotrophicum HRM2]
    MTEALLFMLALGSVCGIVLSFASKIFYVYEDPRIALVEENLAGANCGGCGYAGCSAAAEAVVIGRAAPSVCVISGPEAVL
    KVAAVMGLDPGTAESQLSYNLCEGGDRATNKYHYMGVNSCKAMAVIFGGKRDCHVGCIGLGDCIKACKFGALSMGPKGHP
    IVDDDKCVGCGACQKACPKDIIEVKSLSEKLLKFNQKNDPLAPCAQTCPAEINIPRYIAQIRNNDYLGAVRTIRLRNPLL
    LSCGRVCPHPCESECRRGIEDEPVSINQLKRFVADYEMFSGSRIPIKCAPDTGKKVAVIGSGPSGLSCAYFLRRIGHEVS
    IIESMPKLGGMIRYGIPEYRLPDKVLDWEIEGILNLGIKSYNHVKFGVDFGLGSLMAAGYNAVFLGVGAWKDYELGIPGE
    ELKG
    CYTGINMLSRRAGGETLELGRTAAVIGGGNTAVDCARTMLRLGLEKVYMVYRRTRKEMPANEVEIVASEEEGVEFV
    FLAAPTKVIGNDDGHVTHLEYLQMKLGEPDASGRRRPEPIEGSETRLQVDTIVTAIGQSPEASFKQDPHPRMAELELTRW
    NTIENNPETLQTTIPYVFTAGDAATGPSLVVDAIGGGRRAARSIDLFLKGKPVVPVVDSLQHRRIKESIFTTVKGITPKK
    RAKMPELSVDRRMDSFVEVDLVLPEDEAIREANRCLNCCRLCYDPDIKSA

    >gi|224370351|ref|YP_002604515.1| Nox1 [Desulfobacterium autotrophicum HRM2]
    MSKRVIIIGAVALGPKVACRLRRIDPDATITLIDRDNLISYGGCGIPYYVGGDVADLEGLYSTIAHAIRDKAFFEMVKGI
    NVITRAEAISIDRKKKSLTIRHLDENRDEDLPYDKLVIATGATPVQPPFPGVTLPQVFPVSNLHQAKAIKDMISKGEVEN
    AVVIGAGAIGIEMAEALTDLWAVDTTIVEMAERVLPQALGRNIATIAQKQLTDHGVKMLIGERVLRINGTEETGVESVET
    TAGTLPCQLVILATGIRPNSELAANAGLAIGKNRGIIVDQCMRTTDPDIYAGGDCIEVMNLVNGQTLLMPLGSLANRQGR
    IIASNINGRCEQFKGTVGTFCIKVFEMAFATAGLTFDQAKAAGFDPAYSTVAQSDRAHFYPDSEFMYMELIADRRTRRVL
    GVEAAGPQGDAVKSRVDAIAPLFQYRADVSDICTLEAGYSPPYASAMDIINNVANSLDNILEGTHNPIDAIEFIKKFEAK
    ETRVLDVRSKVQADPFVEKYGDRWINIPQDELRQRTDEIPTDEELCIL
    CGSGPRSYEAQLVLAAKGKNRTLNIQGGYGMI
    IAVHPPLI

    >gi|224370362|ref|YP_002604526.1| PrxU [Desulfobacterium autotrophicum HRM2]
    MGEELKAGCARPTGGPVGETVPEKKSEIETEKKEVSSMIKVGRKAPDFTAPGYQNGKFTNVKLSDHLGKWVVLCFYPGDF
    TFV
    CATEISAVAEKYSEFKDLGVEVLSMSIDSIFVHKMWNDHELSKMVEGGVPFPMLSDAGGKVGTVYGVYDEDAGVEAR
    GRFLIDPDGIVQGFEVLTPPVGRNVSETFRQIQAFQLVRASKGTEATPSGWRPGKAVLKPGPDLVGNVWKEWKTEMAFD

    >gi|224370550|ref|YP_002604714.1| putative peroxiredoxin family protein [Desulfobacterium autotrophicum HRM2]
    MSLKEQLTTLKSKSQSQIPEDIQKTMFDDLKKLGESGIIEGAPKTGEKLKDFTLSNHLGENKSLSELRKKGPVVVTFYRG
    GW
    CPYCNLELHAYQAVLQDIKDAGATLVAITPELPDESLTTSERHGLKFEVLTDTNSDYAREIGIVFTLSEELRSIYESF
    GIKVEKHNGKGQFDLPLAATFVVDTDGTIACAFVEADYKLRAEPSDVVNVLKTLVK

    >gi|224370558|ref|YP_002604722.1| SelD2 [Desulfobacterium autotrophicum HRM2]
    MKDSKKIRLTESVAGAGCASKLSPGDLDKALCGMVFPTNEHVMVGLERADDAGVYKVSDDLALIQTVDFFTPIVDDPYWF
    GQIAAANALSDVYAMGGTPKTAMNLVAFPVKEMDISVLRQIIQGGIDKLVEAEVVLLGGHSIEDKELKYGLSVTGFVHPQ
    KVLIKGNLNPGNQLILTKPLGTGIINTAIKAAMASQALTDTVTRLMATLNRQAADIMSGFDVTACTDVTGFGLIGHLAEM
    ILGSGMTVRLFSKNVPVIQEALTFASMGLIPAGAYKNREFRETMTQFSGNVDQSLQAVLVDPQTSGGLLISVKASQASQL
    LSALKNAGISDAALIGEVIDGLGEKILIE

    >gi|224370648|ref|YP_002604812.1| putative metallo-beta-lactamase superfamily protein [Desulfobacterium autotrophicum HRM2]
    MYFKQIAVEGMGCLSYIIGCPGAGVACVVDPKREVKEYIDLARNNGMKITHIFETHIHADHVSGNMELRSRTGADIYLLE
    GTPATYKFKPVKDGDSFMMGSVKLDILRTPGHTPHGLSILVTDTLRSQEPWLVLTGDCMFVGDVGRPDLAGEELIDEQVE
    NLYNSLYNRLGNLADSLEVFPAHGEGSLCGKGMSSKPSSTIGFEQHNNPLLNLSRKDFIESFKQSFPERPKSFTHIIETN
    IKGAPLLERCPMMMDMSPLQVKNHMEQGAVVLDTRDTAAFGGAHIPGSINIGLTKQTANWIGMVIDPNADLILLVDNEAS
    YDDMCTQLHRIGYDNILGYLYGGIKNWQEEGYPLGQLWQLSAERLRQKLDKGSVTHFFDVRTQAERNDGYIAGAEHFALP
    LLLKQVPDIPRDEEIIVY
    CGVGYRGNIAASYLQSQGFKHVHSLAGGNKAWRNAGFPVERA

    >gi|224370844|ref|YP_002605008.1| DraG2 [Desulfobacterium autotrophicum HRM2]
    MNPNIKDAILAAFVADALSLGVHWVYNTSEIDAKYGRLENMVKPELAPYHTSKDKGEFTHYGDQMMVLLESLVHGSGFDF
    DLNRFSQAWRNLFSAYDGYMDQASKETLANFKAGSQPETSGAISMDLGGAARIVPLILCYGDDIDAFVKAARAQTAMTHN
    SAQAIECAELFARVSAMVLNGAKPIKAFERALEKMPEAQKIQALVQTGLESRSQDTRKAIARMGQM
    CAIEGALPATIHLI
    AKYENNLKEALIENIMAGGDSSARGILTGFVLGCYKGIDTLPKQWLADMTAHEKILGLIH

    >gi|224370967|ref|YP_002605131.1| AhpC [Desulfobacterium autotrophicum HRM2]
    MEETKVNMPLLGDALPELKVQSTHGPMNIPGDMKGKWFVLFSHPADFTPVCTTEFVAFQKRYEEFEKLGCKLIGMSIDQV
    FSHIKWVQWIKAELDVDIKFPIVAANDSVAMKLGMLHPGKGTNTVRAVFIVDPDSKVRLIMYYPQEVGRNMDEIVRSVKA
    LQISDQQGAVAAGWPDNELIGDRIIMPPSTNQADAEKRMEKSDAFECFDWWFCHKPLEK

    >gi|224370969|ref|YP_002605133.1| ThiF [Desulfobacterium autotrophicum HRM2]
    MKTMKTLTFLVVISLMAVAGVVASDYNYVSPEKVKTWIETQEPVTIVDIQVKEEFEAHHLPGSLATYSYPVKSDLEKAKI
    DDAVDASIDTETPVVVV
    CPRGAGGAQRCYDYMKSRNISEDRLLILKGGIAGWPYKELMESAK

    >gi|224371016|ref|YP_002605180.1| hypothetical protein HRM2_39580 [Desulfobacterium autotrophicum HRM2]
    MKTQFFTLSTIAALLISASAAYAQNDVNQSPKVYQIETRLDEYTRPTTFTPTKAIPVNGAISENIVTTTQNILNKEAHFL
    KKGLVKPVGEKQFSAWELVSDEGGSGHSQTAPNPLTYYAAGASSSLLTQVERLIKILALDVEEVKVESKIFFRWLDPMSD
    NWSGYTDKVISNILIKSSESPEKIKQLEEKAIKAWAVGEGLANKTTIDVGILINGDDWAGLKARPGKVASPISIDNGRTI
    TNVTPDLNLQTVEIEKDLGLDMGHFPNPFTFSEISLAESAHDATRPYLHKIRAKSLTENYQTWELFTDDSRGYEGMDKAP
    TSRDYFTVGTSF
    CLMSQLTANKMYFQKQGINIDDFRVEHQFNYQQDNFMTPTMTGHLDHVITRVIVKSDAAKEALTDYAK
    QALRMCFAGEGVQNETEMESNVYLNGTIVK

    >gi|224371152|ref|YP_002605316.1| peroxiredoxin (AhpC/TSA family protein) [Desulfobacterium autotrophicum HRM2]
    MRFFIVLLLLLAPASGHCLSSAFESSVFDPGHLTPRDSVLKVKVGDPVPDFMLPAISGGQVGPSQFRGKKNLVISFIPAA
    WTPV
    CSDQWPGYNIARPLFDAHDAVLFGISVDSRATLYSWTRAMKDLWFPVLSDFWPHGQVAQSFGVLRSDGMAERAIII
    VDKRGIIRFLHVSDINVRPELGMIIQALDAITP

    >gi|224371153|ref|YP_002605317.1| ResA [Desulfobacterium autotrophicum HRM2]
    MKWIIPVVLLVMVLPAMAMDPVQTGEKLLGVSLETPESRETQAYLGLSAKPAFTMDDIDADVVIVEIFSMYCPHCQREAP
    MINQFHDLLLTRKTSKPSIKLMGIGAGNSSFEVDYFRKTYKVAFPLFADGDFVVHKALGEVRTPYFIALSREPDRSWKVV
    LSRPGGIESPEAFLSTILELARGGK

    >gi|224371164|ref|YP_002605328.1| ferredoxin-thioredoxin reductase (glutaredoxin family protein) [Desulfobacterium autotrophicum HRM2]
    MGYDKAKIYSLSTCSHCKAAKRFLGECKVKYEFVDVDSLTGEERKAIIADIKELNPRCSFPTIVIGDAVIVGFHEDKIKE
    ALGIKDGD

    >gi|224371234|ref|YP_002605398.1| ABC-type Fe(3+) transport system, periplasmic substrate binding component [Desulfobacterium autotrophicum HRM2]
    MAVGIMLFNPPSGACTDTRTAVDQVGRTVTFPAHPERVISLAPSITEIVFAIDRGECLKGATVYSDYPESARRIPRVGSY
    VHLDLEKIVALEPDL
    CIAVKDGNPKQTADRLSDLGIPVYAVNPVDLDSVITTVTLIGSLLNAETRAAQVVNDMETRVRRV
    EALVATTTVRPRVFFQIGISPIVSAGRDTFIHGLIERAGGINLAAAAVAYPRFSREQFLGLAPDIIIITSMARAEVFERV
    KKEWESWSGLPAVKNNQVHIVDSNLLDRPTPRMVEGLELLVRLIHPELF

    >gi|224371272|ref|YP_002605436.1| NADH/FAD-dependent oxidoreductase [Desulfobacterium autotrophicum HRM2]
    MRFLIIGGDAAGMSAASKAKRRAPDLDVVVLEQGMDVSYSACGMPYNIADSETGIDALVVRDADTFIHKNHIDLKLGHCA
    ESIDPGAKIVRGMGPDDRPFTLAYDKLLIATGAGPVMPDIPGFDLQGVFPLKSLDHGRRIKHFIGVKNVQKAVIIGMGYV
    GLEMCEALRARGIEVAMVKPRPRLLPWMNPELVQAVSLELTKNRVAMHPGHAIDAITSHNGALRIECDTMALDADMVIVA
    SGVRPNSRLARDAGLETGISDSISVDDQLRTSDPDIYSAGDCADAIHVVTGQRCWIPLALRANRAGWAVADNVCGVETRL
    DGVVGTAVFKLFALEIARTGLSPKEAVAAGFDPVEVVVKNNSKAHAQRGATTIYTAMTGDRNTGRLLGVQMVGEQGVAHR
    INAPAVALHNRMDVQGFFQTDFAYAPPFGPVWDPLLTAANQLLKKL

    >gi|224371278|ref|YP_002605442.1| putative thioredoxin [Desulfobacterium autotrophicum HRM2]
    MKQKILNTLLAVVFFAIFLPAAVSAQEISWQKFDRGMAMAKEQDKNVFLYFHAEWCSYCKKMERTTFKKSKVIDYINENF
    IAIKVDSDREQKISETYNVRGLPTLWFLKSDHTRISNLPGYIDAKTFGNILRFINTDSYEQMSYNDFKKTL

    >gi|224371314|ref|YP_002605478.1| putative HAD family hydrolase [Desulfobacterium autotrophicum HRM2]
    MEANELRSGITRLGDRLNGTLKITLALTGRQNDNRFVDFCQELEALLPGLTVVRKMDKEKILPGIMITDNLIYSAIPQAR
    AIAPFLETLALVNGPLPHLPETLQKSLSCIDIPTRLTLYTAVH
    CPHCPGMVRAMTPLAAACKNIILTVIDGTLFPEAAAS
    DRVMSVPCLILNQEMRWTGNAPPAEVVEMIINQDPSMLSIPSLQTILEDGRASWIAAKMMGANAVFPSFIGLLLHPTWSV
    RLGAMVVLEEMAETTPDLAARIAPHLWKAFGEADTTVKGDILYALGEVGDQSMGTRIKALIPTLENKDLREAALDALAAL
    ASRS

    >gi|224371376|ref|YP_002605540.1| CopA [Desulfobacterium autotrophicum HRM2]
    MVCVKNIHVSGMSCGHCVNSVTQTLEAIQGVSSARVSLEDSTAEVTFDQEAVDLETLKAAIREKGFGTEAPSPINNKPFT
    IIAPKNVEPPFARQRQPVETSFKIEGMS
    CANCSNTIEKTLKKSKGIEKVSINFSMEKGFVTYDPSLVDEQGIFEIVQRAG
    YTAFSQEEKRTEDSPIAQKERFRFIFAASLTIPLVFLMYTMPFGHANTNYSMGLLATLVMVVSGRTFYEGAFHSLKNRSA
    NMDVLIALGISAAYFYSLFSLLVLDPAAHTFFDSAAMLITFILLGKMIEAKAKGQTGEALEKLISLGADRARILVNGSEH
    MVKASEIKKGDFFSVRPGETIPVDGEIVEGTTTIDESMITGEAIPADKIKGDPVTGATINQTGAITARAVRVGKETMLAR
    IVKMVEEAQADKAPIQRLADTVSNYFVPVVVIAAILTFIVWNFVVEYPPPLGITRFLFAFQLMIAVLVVACPCALGLATP
    TAIMVASGVGLKRGILFKRASVLENISQLDVILFDKTGTLTKGSPRVSAIYPMDHGSEHQVLKIAASLGAASIHPLAHAI
    VKKAEQAGVSMEKISNQREIPGHGSTGELDGRPVMLGNLKLQPQGSFLSEEAAAAGQQISDTGDSSVYVWQDNTMKGIIS
    LADEIKADSKEAMARLHALGIKTALVSGDNKKAAKRVAQIVGIDEVEAEVLPGDKSRIVKKWQERGYRVAMAGDGINDAP
    ALAQADIGIAVGSGTDIAKETGDVILVNNSLLDVERAIGLGRKTLKTIRINFFWAFFYNLLMIPVAAGLAYPALGLVLKP
    EWACIAMWLSSLTVVGNSLLLKRYRF

    >gi|224371394|ref|YP_002605558.1| dehydrogenase [Desulfobacterium autotrophicum HRM2]
    MTREVDVAIIGAGTAGLTAQEIVVEKTDNYVIIDDGPLGTTCARVGCMPSKALIAVADDFHKRLFFDEYGISGAKALRPV
    YSRIMARVRMLRDEFSGGVIHEMSPFMDKLIRKRARFIDPNTLDLGDERIRARRIIIATGSKPWIPERWQPYRDLIIDTD
    QFFELEDLPGKMAVFGLGPLGIELGQALHRLGVEIIAFSRRKTAGGLTDPDLQTYAFDHFSKEMNIKLGTADIRCKSESG
    VVVGCESGEWTVDRILLATGRRPNVQGLGLENLGVKLDDRGLPAFDPGTLQIKGLPVFLAGDVNGQKPILHEAADDGNIA
    GYNATADTTSCFKKRIPLTITFSSPDIAIAGLSHRELTDLGVEFVTGNASWEKLGRARMILGKASGIARIYADKKDGRLL
    GAELMAPAGEHMAHLLSWAIGAGLTAADALAMPFYHPVPEEALRSALGQILKQTDDPPPDTPLEFCRKSSS

    >gi|224371590|ref|YP_002605754.1| hypothetical protein HRM2_45340 [Desulfobacterium autotrophicum HRM2]
    MGTKEKTNGQNGLESLIFDNSFINHLPGDPEIENHRRQVRNASYSIVQPARVHNPRLGAASREAAGLIDLSMDTVNSPEF
    LEIFSGNRLLPDMVPFATCYGGHQFGTWAGQLGDGRAINLGEIINREGQRWAIQLKGAGPTPYSRSADGLAVLRSSVREF
    LCSEAMFHLGVPTTRALSLITTGEEVLRDMFYDGHPKMEPGAIVTRLAPSFTRFGSFQIHSSREETDLLKKLVDYTIKTD
    FPELGTPSPRVYLEWFNTVCTTTVDMIVHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWLENYDPNWTPNTTDAQGRRYS
    FGKQPDIALWNLTQLAKAISPIINDVDALAQSLEVYRNRFQDGSQNMMALKLGLTHFKPETDPALMAALLDLLQLVETDM
    TLFFRQLAMVDPSKTVSPMEFSAAYYQPEQLTKPYVDRFDDWFKRYGQRLTLDSSDPGTRQQRMNQVNPKYVLRNYLAQL
    AIDQAEQGDFSGVTELLQVMRHPYDDQPGNQRFAEKRPEWARNRPG
    CSMLSCSS

    >gi|224371738|ref|YP_002605902.1| rhodanese-like domain protein [Desulfobacterium autotrophicum HRM2]
    MASGHNEYGNSANVNALVSVSYKKTLGENTMKWKQFFTSVDSLDAVQAETYITQHPGDEITILDVRQPSEYKESHIPGAQ
    LIPLGQLTDRLSELDPEKPTLVY
    CAIGGRSRVAAQMLSGKEFKKVINVSGGIKAWHSKTAIGAPDLGMELFTGKESPRDV
    LTTAYSLEQGLREFYLTMEKKAVLKEVKDLFGKLAEIELHHQTSILDAYNRLGDASMDQEGFERLVETDALEGGLSTQEY
    LDLFKPDLNSPVEVISLAMSIEAQALDLYQRASLSFKDPESKAIVQKIANEEKTHIASLGKLLDRL

    >gi|224371787|ref|YP_002605951.1| UroD [Desulfobacterium autotrophicum HRM2]
    MQKMTGRERIMTVLNRKKADSLPWVPFAGVHSGFLTGYDADEVYQDSDKCFESLKKVNQLYKPDGQPIIFDLQLEAEILG
    CELLWAKDSPPTVITHPLADTKEIPTKIPSPAEGRLPMELDVMRRMKAEFGETTALYGLITGPFTLALHLRGTNIFMDMM
    TDAGYMHRLLNYCAEVAVTIAGYTLDTGMDVVALVDPMISQISPAHFEEYMALPFKRVFDYIRERGAKSSFFVCGNATQK
    LDAMCRTGCDSISVDENVDLAKAKRICDIHDVVLGGNIPLTTAMLFGTQQDNMKAVVDLIDSVETKHNLIIAPGCDMPYA
    TPIENVLAAEQAVHNTASVREMVKNYEVTEAEFTGELPDYDNLDKPLVEVFTLDSVA
    CAACTYMLAVGMDAQAEFGEEID
    VVEHKYTLPENIARCRIMGVKQLPSIYINGELKHSSIIPSQQELFTEIREVL

    >gi|224371807|ref|YP_002605971.1| putative DNA-binding protein [Desulfobacterium autotrophicum HRM2]
    MNTAEKTAEAMNYLQKYAPREYGKYLEFTQTLGGKGGLSPITLELILVALAVMSQCDMCITLHIENAASLGASREDILQA
    AFMSVAMGGSPKLMYMSYVFEALEDLFD

    >gi|224371871|ref|YP_002606037.1| hypothetical protein HRM2_48250 [Desulfobacterium autotrophicum HRM2]
    MDIKVLGPGCAKCKKTEKLVQEVIKEIGVDATVEKVSDMMQIASYGVFGTPSVIVDGKVKCTGKVPKKDDIKNWLLNK

    >gi|224371873|ref|YP_002606039.1| TrxA3 [Desulfobacterium autotrophicum HRM2]
    MQQVLKKLSVWIVILMLFFATGAAADEFLNIPAKGMVTMIDLGAKKCIPCKMMAPIMVKMKKAYEGKAEIIFIDVWENKK
    PAQRFKIKAIPTQIFFNAQGQEVYRHVGFLDEKSIVEQLTKIGVAAPDLTAKDS

    >gi|224371981|ref|YP_002606147.1| Ogt [Desulfobacterium autotrophicum HRM2]
    MVEMIYDIIDSPMGPILVAMDQRGVRHLSFEGGTHPLGIDPGWTRDPKKVKPVMDQLVAYFAGKLTQFEVDLAPLGTAFQ
    QKVWAALCRIPYGRTASYLDVAVAVGNEKACRAVGGANGKNPIPIIIP
    CHRVIGKSGKLVGFSSGLDIKTRLLQLESRAY
    SNGE