Desulfitobacterium hafniense Y51 uid58605

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|89893045|ref|YP_516532.1| hypothetical protein DSY0299 [Desulfitobacterium hafniense Y51]
    MILIVRGVKIPMALKQLDSNSFEEIIYDNGEACLVLFSRKSCHVCKEVGPMVEDLAPKYSGKFGFYYVDVEENMTLFQRF
    SLKGVPQILFFKDGEYQGKLSGNVEEEVLEEKIAEIQA

    >gi|89893053|ref|YP_516540.1| hypothetical protein DSY0307 [Desulfitobacterium hafniense Y51]
    MKVVIIGGVATGPKVAARLRRLSIDAEITVVEKGKIVSYGSCGLPLFLGNLVPKIEDLMKTSAGLIRDTQYFEDTKGINV
    LTQTEALAIDRQQKKVRVRNLATGEERDLDYDHLVLATGAKEVVPPIPGIQYQNVYTLHSLDDAVNIKALIKEKKIQHAT
    IIGAGLIGIEVADAIAGPRLKVTLFESQGSVVPKLLDPDMALLVEHKMRSRGIDLRLNCPVKELTGDEDGKVNGVILENE
    SITTGLVIVAVGVRPEVTLARQAGLTLGITGAIQVNQYMQTDDTYIYAGGDCAEQVNMLSGRQVFVPLASTANKQGRVIA
    DNIAGRASEFPAICATSVFQAFELNVGRTGLGEPEARELGYDVITSLSTGLDAVHYYPVHGAVTIKLIAERTSGRLLGAQ
    VCGTGEAIKRLDVLITILRFNGTVKDISNLDLSYAPPFATAIDVLIHAANTLENKQLGIVDTVNPFELLERLKKDKSIIF
    VDVREGDETRANPVEGSQIIVIPLGELRKRYTEIPQGSPVVTF
    CELGIRGYDAACFLKGVGFQDVSFLEGGMSTWGALQP
    ALNM

    >gi|89893149|ref|YP_516636.1| hypothetical protein DSY0403 [Desulfitobacterium hafniense Y51]
    MLLQKLNASQFEEIIYTDGNPSLVIFSRKSCHVCKEVMPVLEDLQSKYEGKFGFYYVDVEENKAVFQRFSLKGVPQILFF
    NFGEYQGKLSGKVEDEQIEEKISQVLKA

    >gi|89893270|ref|YP_516757.1| hypothetical protein DSY0524 [Desulfitobacterium hafniense Y51]
    MSLIGKEVNEFKVQAFVEGAFKEVTKGDLLGKWSVFVFYPADFTFVCPTELGDLADQYDEFKKIGVEIYSVSTDTHFVHK
    AWHDASDTIRKIRYPMLADPTAKLAKDFEVYIEEEGLALRGSFVVNPEGKIVAYEVNSNNIGREASELLRKVQAAQFVAE
    HGDQVCPAKWRPGAETLKPSLDLVGKL

    >gi|89893271|ref|YP_516758.1| hypothetical protein DSY0525 [Desulfitobacterium hafniense Y51]
    MAARSGDAQTQPGSGREAVSSMKELYDLIIIGSGSAGMAAGIYAGRSKLKTLVIDRDRAGGQIKITSEVENYPGILNISG
    EELSQAMRRQAEKFGVKFRQAAVESVDLAGDIKKIRTAEGDYEALAVIIATGSVPRKLGFIGEEEFRGRGIGY
    CATCDGE
    FFTGMDVFVIGGGLAAAEEGIFLTRYARKVTMIVRGDGFSCPQTISERVLAHPKIEVKFNTELREAGGDAVLRYAEFVNN
    RSGERWRYDVREQKQTFGVFVFVGYIPQSAEYAQEVRIDERGYIPTDESMGTNVEGVYAAGDIRPKELRQLVTAVADGTI
    AATSAEKYLVGKKERLGLGELGELGESGERDELSDEEKTPVTRQGTSLLDDSLKEQLVPILERLENRIGLLAFLEGSSGF
    SEELRSFLSEFAGLTDKVEVEFLNRGEDAVREKEAKITLFPAVAVLGPDGVYTGVQFHGIPGGHEINSFILALYNAAGPG
    QAVGEETLAKIRRVSRKVNFKIGVSLS
    CTLCPDVVTLAQLMALKNPLIEAEMIDVAHYPDFKNKYGIMSVPAIVVNDEKV
    VFGKKNLEELLELAGG

    >gi|89893405|ref|YP_516892.1| hypothetical protein DSY0659 [Desulfitobacterium hafniense Y51]
    MSLQRLNAKSFEEIVYDQGSPCLVIFSRKTCHVCKEVVPILEEMQPDYEGKFGFYYVDVEDEQALYQRFSLKGVPQILFF
    KDGEFQGKLVGAVDEEKVSDKIMEVGEG

    >gi|89893575|ref|YP_517062.1| hypothetical protein DSY0829 [Desulfitobacterium hafniense Y51]
    MLKKDVILEGLDCANCAAKIEQEVNALNSVKSYMNFMNKTLTIEIESDMDFVSVLDQIKAIVHKHEPDVIVKVKSMDKGA
    KKVVILEGLG
    CANCASKMETGIKSLEGITNASIDFVSKKLTLEINNNANLSRIYEDIESIVKRIEPDVKLIIEENALQDT
    RKENIEDKGNQKKEITKLIIGGAIFATGMLFDFQNWLELAIFLISYIIVGGTVVLRAIKGISRGQVFSEHFLMSIATIGA
    FFVGEYPEGVAVMLFYLVGELFQDRAVNHSRKSISALMDIRPDYANLKVGEELKKVSPEDVTIGDIIVVKPGEKVPLDGK
    VIEGTSMVDTSALTGESVPRELEPGNDALSGFINKNGLLTIKVSKDYGESTVSKILDLVQNASSRKAPTENFITKFARYY
    TPVVVFGALALAVIPPLLIPGATFSDWIYRALVFLVVSCPCALVISIPLGFFGGIGGASKRGILVKGSNYLEALNNVETV
    IFDKTGTLTKGVFKVTETNPQDGFTDQELIEYAAYAEGYSNHPIALSIRSAYIAEIDKNRIENYQEIAGHGIKVNINGKE
    VLAGNTRLMISENIKYNDIETIGTVIHVAIDKAYAGNIVISDEVKEDSAQAIKELKSLGVKKTVMLTGDLKTVGDKIGTQ
    LGLDEVYSELLPADKVEKLELLDRGKSPKGKLVFVGDGINDAPVLARADIGMAMGGLGSDAAIEAADIVIMTDEPSKIAS
    AIKIAKRTRSIVYQNIVFALGVKLIFLVLGAIGVATMWEAVFGDMGVAILAILNAMRVMNTKNL

    >gi|89893765|ref|YP_517252.1| hypothetical protein DSY1019 [Desulfitobacterium hafniense Y51]
    MIYTCTLSTPLGDITAAAEGEALTGLWFIGQKYYPAQTEAWVTEPEQRVFKSLQTWLDHYFSEREGSAPFPELAPKGTDF
    QKAVWEILLEIPRGRVTTYGEIARKLAASRGLSSMSAQAVGGAVGHNPISILIP
    CHRVVGAGGSLTGYAGGLEKKQALLR
    LEQADLNCRKLF

    >gi|89893786|ref|YP_517273.1| hypothetical protein DSY1040 [Desulfitobacterium hafniense Y51]
    MMGHITSKDAYKNLEERINWFTQGAPPSESLYKILQVLYTETEAKWVALLPVRPFTAKKAAKIWQISEGKAEALLENLCQ
    KALLVDSFYNGVRQFVMPPPMAGFIEFALMRTRGDIDQKYLSELYYQYMNVEEDFVKDLFFATETRLGRVYVQEPVLTNN
    NTIHILDYERASHIIEEATHIGLGTCYCRHKMSHTGQSCAIDAPWDVCLTLGNVARSLAEHGQHARLIDKQEAMDVLERS
    YAANLVQMGENVREDPAFICNCCGC
    CCEALQAARKFSPMQPVATTNYLPKIAQECIGCGKCEKVCPVLAISMSTNAEGKK
    IAQVDHEVCLGCGICVRSCPKKVIELVRREVQVITPVNSTHRFVLQAIEKGTLQNLIFDNQAFANHRAMAAVLGVILKLP
    PLKQMLASKQFKSIYLDKLLSK

    >gi|89893803|ref|YP_517290.1| putative fumarate reductase flavoprotein subunit [Desulfitobacterium hafniense Y51]
    MGAIGATVVATGLTACAPSSGDSGGNAGAPATDSGSATTGYDWKAQSKNELAWLPPEPADPTDISEEKRADVVVIGSGVA
    GTCAARKAAEAGASVILIEKAKTAGV
    CRSGEYAVPGKSKVFATWKRGEGFDDYVDPELIVDREMEEMCYYPKRAIYSRWA
    HNVGPVFDWFCDAMGDRLYIAPNSTDPVPTDKEQVLWPFYVPLPEHFDWRKEAAPTYPVSVKFSNPDQHAIVKANVDKAI
    ENGTEVLTSHFAEKLIKEGDRITGVFVRDAASGTHKKITANKGVILATGDYSSNKDILAYYNPDFVVNNGPLMWPDVDVE
    GNRTNQGDGLILGSYVNAAIQQKHAPMTHYMGHFGTSKGGIGTAPFLRLNLNGERFMNEDQGGQAVQNQLEAQPERKCWT
    IFDSTWAESVPYFQAMHGCPSYVVDKPTPENLTIDGISPYIMPDAVEDAVAQKNATMFKAETIDELLALTDIRDKEKAKA
    SIERYNELARNGEDVDFGKVATRLHTIEKGPFYTFESGMSMTLIVAGGLVSDEDCHVYDKEGKIIPGLYVAGNIQGNRYH
    VAYPIACKGISHSLCMFYGYIAGENAVKQI

    >gi|89893927|ref|YP_517414.1| hypothetical protein DSY1181 [Desulfitobacterium hafniense Y51]
    MQFICYSRCTTCQKARKWLEEKEHSFEVRDIKGDNPTFAELQTWYKLSGLPLKRFFNTSGQQYKSLNLKDKLPKMTEEEQ
    LKLLATDGMLVKRPLLLGEDFVLTGFKEAEWEERLNKS

    >gi|89893941|ref|YP_517428.1| hypothetical protein DSY1195 [Desulfitobacterium hafniense Y51]
    MNSKTKLILGIIAFVLFLGIAYTAYSSLSENYGPTQEPMTQGQDKPDAQSADPAAQEEKKTEAPNFTVYGTDGTEHRLSD
    FRGKPVVLNFWASW
    CPPCREEMPHFNEVYAQYKDDVAFLMVDLVDGQRETEESGQAFVDKEGYDFPIYLDKNHQAASVYG
    VSTIPTTLFIDGEGYIVTGYRGPLKKSTLETILKDMLKQ

    >gi|89894105|ref|YP_517592.1| hypothetical protein DSY1359 [Desulfitobacterium hafniense Y51]
    MSEGFQLKSRYQLAIVGCGPAGMSAALNAKIRNKDFILLGSDFCSPKLAKAPQIDNYLGFHEIKGEDLRQNFLNHVKAMG
    IEVVPWKVLNIYPGPPFTLVGNNESFEADAVILATGVSPTKLLPGETELLGRGVGY
    CATCDGPLYKGKKVAIVSYSHEGE
    AEANFMAEICAEVYYLPFYKEVGQLDSRIIQKKARVKEISGTQKVEKLVLDNEEISVDGVFVLRESLPAEQIVPGLEMDK
    GAIKVNRELETGIPGLFAAGDCSGQPYQLNKAVGEGGTAALSAIKYLDEMKKG

    >gi|89894189|ref|YP_517676.1| hypothetical protein DSY1443 [Desulfitobacterium hafniense Y51]
    MSIEPLLTIQNNEQLSQLLQEQKTSILYFSSPDCNVCHALLPKVLKVAQVYKIPVGQINTQEFKEGAGQLLVFTVPTLLV
    MCEGREILRESRFIDLQNTARILESVTEEMQVPSSIISLSNI

    >gi|89894202|ref|YP_517689.1| hypothetical protein DSY1456 [Desulfitobacterium hafniense Y51]
    MEKMPLAKLDENRFNEVVYDTGEPCLVIFSRKACHVCQNVLPILEELQPNYSGKFSFYYIDVETNKSLFQGFSLKGVPQI
    LFFKDGEYQGKLTGSVEEEQLIERIADILES

    >gi|89894260|ref|YP_517747.1| hypothetical protein DSY1514 [Desulfitobacterium hafniense Y51]
    MIFLIIDEKSYDLDKDNFRLASPSYALRREDSMTVDKTNLGIATFAGGCFWCMESVYSPLPGVLEVLSGYTGGHVENPTY
    NEVCSHTTGHREAIQIKFNPNIVSYKELLALFWRQIDPTDPGGQFHDRGESYQTAIFYHSEEQRRLAEESKQALISSSHF
    DKPIVTEILPAAPFYPAEDYHQGYHQKNAFRYALYRQGSGRDAFINKHWAKEKEQLKKRLTPLQFHVTQEKGTEPPFQNE
    FWNNKQEGIYVDVVSGEPLFSSRDKFDSGCGWPSFTRPVLKSNILEKIDLSHNMTRTEVISRNSESHLGHVFDDGPGPDG
    LRY
    CINSAALRFIPKEDLEREGYGDLLRLFRD

    >gi|89894529|ref|YP_518016.1| hypothetical protein DSY1783 [Desulfitobacterium hafniense Y51]
    MNIQIYGTRKCFDTKKAERYFKERNIKFQFIDLNEKALSKGELQSVKSSVALNELINKEGKDYKALNLDQIRGLEMREEL
    LLTHPKLYRTPIVRNGRKATVGYQPEIWKEWE

    >gi|89894696|ref|YP_518183.1| hypothetical protein DSY1950 [Desulfitobacterium hafniense Y51]
    MNEVIENVKEYYGKILHSTADLQSKACCCSPDSMPKEVKKALTFIADEVISRYYGCGSPLPPLLEGMTVLDLGCGSGRDV
    YVAAQLVGEHGQVIGVDMTQEQLDVARKYEDEQRQRFGYAKSNVKFLSGYIEDLRAAGISDSSVDIVISNCVVNLSPDKE
    KVFAEIWRVLKPGGELYFSDVFADRRIPEYLAADPVLRGE
    CIGGALYYEDFRRIMQRVGFTDFRYKSIRNIDLDNEAIIE
    KVGFANFTERTVRAFKLDDLEDICEDYGQIAVYNGSIAGSPHFFDLDDHHRFFTGKPLLV
    CGNTAAMLAKTRFASAFRVT
    GNRSTHYGVFGGCGGESGTDCFDAGGSCGC

    >gi|89894730|ref|YP_518217.1| hypothetical protein DSY1984 [Desulfitobacterium hafniense Y51]
    MYRTTGPALRPGGFELTDWAVEHCRFQAGDRILDVGCGRGATVDRLRSHYHLEAYGIDPSATLLTLGQETYPDLPLSKAR
    GEDIPFTNSCFDGVFVECSLSLMTDPDQALSEIRRVLKVKGKLIIHDVYARNPQGTPDLRELSIGT
    CIRNALVKEDLEHG
    LESKGLRTIHWQDHSPLLNRLMMELIMTHGSMSAFWLKSTHCSADSNRVQAALKKAKVGYFQLIAEKEAEKEAEHCPVR

    >gi|89894737|ref|YP_518224.1| hypothetical protein DSY1991 [Desulfitobacterium hafniense Y51]
    MHYVIIGNSAAGVFAAEAIRGLDSSGKITIISEENNRPYSRCLTSYYIGEEIDQDRIYIRDANFYAATGIDFIPQKVEQV
    NDTEKSVTLQSGEIVGYDKLLIATGASPYSLPVEGLDLEGVCELRTLEDARRIMDFAPHVKEAVVMGAGLVGLKGAHALH
    ELGIKVSIIVNSRIMSRSVDPHTGQIITELLEQDGYEVIYNTKLSKILGQDKVEGVCLSSGKEIPCQLVLMAAGVSPNVD
    LVKNTGIEVNKGIIVDKHMQTTVPHIYAAGDVAEAYHAVWDEKRVISIWPVATAQGTVAGSNMAGVERIYEGSVGSNSAV
    FCGVGVVSAGIPYLPTGEGQELSTYDKVTKRYRKFIVKDDILVGMIMVGDIDGAGILTAMIKQKTKVSLDTLNYWLNHPV
    RFQGYCTAEAKGGIVCGIC

    >gi|89894797|ref|YP_518284.1| hypothetical protein DSY2051 [Desulfitobacterium hafniense Y51]
    MNMVKISELAAQKVKEVQKTQNKEKCYLRLYLAGFGCGGPSFGMTLEDAKTELDVLDEEHGVSVITASSLSEYLEDAFID
    FVENEEGSGFEIRLAKDFGGQGCGSSCGGCGGSC

    >gi|89894906|ref|YP_518393.1| hypothetical protein DSY2160 [Desulfitobacterium hafniense Y51]
    MTNLNKVPNRLLQEKSPYLLQHAHNPVDWYPWGEEAFAKAKAEDKPIFLSIGYSTCHWCHVMERESFEDEEVAQLINRYF
    VPIKVDREERPDVDHIYMEFCQALTGSGGWPLTLFLTPDERKPFYAGTYFPKESRYGRPGILDLLSQLGELWAKDQPKIR
    GSADSIYKAVTSREEPSVSSLTPALQDDFIPWAKEILDTAFQTLQKSFDRQYGGFGRAPKFPTPHHLTFLLRYAHDHSDG
    LEAQQAALMVRTTLERMGQGGIFDHVGFGFARYSTDRHWLVPHFEKMLYDNALLAIAYLENYQAQHDPHDEQKAREIFSY
    VLRDMTAPEGGFYSAEDADSEGVEGKFYVWTPQEIHEILGSEEGRLYCQAYGVSPEGNFEGKSIPNLLDTDWEALGSERQ
    HSLEVLKRRLEKSREKLFAVRKERIPPHKDDKILTSWNGLMISALAKGAQVLGEPAYAEAAEQAVYFIRKNLYANQRLLA
    RYRDGDSAHLGYLDDYAFLIWGLIELYQASGQKEHLEFALQLQREQDELFWDGAKSGYFLTGRDAEELLIRPKEIYDGAT
    PSGNSISALNLIRLARLTGDGMLEERAYEQINAFKATLATYPSGYSAFLQAIQFALQESREIILAGSLQHPELKNMKTTI
    FKKFHPYTTLLYEEGTLSELIPWLKDYPLDSEKMTAYLCQNYACHKPVHKAEELSALLT

    >gi|89895175|ref|YP_518662.1| hypothetical protein DSY2429 [Desulfitobacterium hafniense Y51]
    MAGENVKTFTTANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGKVIIGKLNVDEEPAIAGQYQVMSIPTL
    AVFKNGQVVDKSVGFRGKADLVKMIEKHA

    >gi|89895309|ref|YP_518796.1| hypothetical protein DSY2563 [Desulfitobacterium hafniense Y51]
    MIKHCYALLLQDGGINKGRLRTMNQTLKITGMTCNHCKAHVEKALLKVGGVQQVDVNLEKGEAVVAGSAGREELIKAVED
    AGYNAE

    >gi|89895310|ref|YP_518797.1| hypothetical protein DSY2564 [Desulfitobacterium hafniense Y51]
    MSKKNTAIKVTGMTCEHCVGRVKKALESLPELENVNVSLENGEASFDWTGEGLSMTRVKDVIEEAGYTVIEDQEAQQRVQ
    AQGMLMKELNVYGMT
    CEHCVRRVKKALENLPEVTDVEVSLAESKAAFRHNPAITTEAQIKEAIQEAGYSTEATEATESIE
    SIEVTEASVPDIQESESPAQESVNEKKQLKITGMT
    CANCALTIEKGMAKLPGVKAATVNFASEKLSLDYDPALLDEKTIL
    EKVKDLGYGAYMERDEGKAQFKVSGMT
    CANCALTIEKKLRNTPGIQTVAVNFATESVTTDYDPNLIDLETIYKQVRDAGY
    TPIENKEESHEDNHVKSQRNWVIFSAVLSVPLMPMMFMPMTHGIMYTMFILATIVQFTAGLTFYRGAYHALKNRSTNMDV
    LVAMGITAAYGYSVMTTFPHIFFAGDTFFDTSALLITFVRFGKYLEAKAKGRAGQALKRLLELQADRARLLINGEEKEVP
    ASSVKIGDIVLVKPGEKIPVDGVIVEGQASIDESMITGESIPVDKGAGENVIGATINRSGSIKVSTTKTGKDSVLSGIIK
    MVEDAQGVKPPIQRLADKISNVFVPVVVAISILTFIIWYVFLDSAFVFAFTAAIAVLVIACPCALGLATPTAIMVGSGVG
    LNRGILFKSAAVLEGIAKVEAIGFDKTGTLTKGKPEVTHLMAYEGYAQKDLLRIAAAGENPSIHPLAQAIVQRAKDEGIE
    VEEVQDYHEESGHGTLCSYQGKKLLIGNKKLMIKENIPTEAVEKDFQELANEGKTTSFVAYDGKVIGIIALADVLKESTQ
    EAIKRLHGLGIKTFMITGDNKKVATVIGNEVGIDEVVAEVLPQDKIEIIKRYQNNGLKVAMVGDGINDAPALAQADIGIA
    IGSGTDVAKETGDVVLVRNDLLDVERAIRLGRKTLTKIKQNLFWALIYNTLGIPIAAGVLFPITGELLPPEWAGLAMAFS
    SVSVVTSSLLLSRYSKELVD

    >gi|89895448|ref|YP_518935.1| hypothetical protein DSY2702 [Desulfitobacterium hafniense Y51]
    MDTAERLSVLQINVGKRCNLACKHCHVEAGPNRTEEMSREVMEACLRLLEENPFATVDITGGAPELNPHFRWLVGECAKG
    CAHVIVRTNLVILLEEGYTDLPEFYRDHRVNVVCSLPHYTAKNTDRMRGEQVFRRSIEAMKRLNEVGYGQEPELVLDLVY
    NPGGAFLPPSQTAMEAEYKEHLLREYGVSFSHLFTITNNPIGRFGAFLERSGNLEDYMGRLYGAFNASTLESMMCRFQVS
    VGWDGRLYNCDFNQAADLPMADGATIFDWTGKPMAKQRIRFGKHCYACTAGQGSS
    CGGATEGV

    >gi|89895449|ref|YP_518936.1| hypothetical protein DSY2703 [Desulfitobacterium hafniense Y51]
    MGECASELWEKFMGYYGAVFAEGNLTAREKSLIALAVATAVQCPYCIDSYTQDCLSKGVTEEQMTEAIHVACAIRGGASL
    VHGVQMKNIVKKLEL

    >gi|89895453|ref|YP_518940.1| hypothetical protein DSY2707 [Desulfitobacterium hafniense Y51]
    MKIVAEIRRRRGLTMRKLLSLTMCLLLSVSVLAGCTQATPASGGSAAPAADRAEADISWQYKTADETKAMLDAQESVIIL
    DSRPDDMYTKGHIPGAYHVPSYPMDTPELEQVLKDAVPNLQGDDPIVIV
    CKSGNKGAKRAISFLQDQGVAPERLFILEGG
    GDGWKIPEYTTTANDSTIPN

    >gi|89895664|ref|YP_519151.1| hypothetical protein DSY2918 [Desulfitobacterium hafniense Y51]
    MEQYQVGILGGGPGGYVCALRAAQLGLSVVLVEKERLGGTCLNKGCIPTKTLVKSAELWREIKHAEEFGIQLGGALLHYP
    QIAARKKEVVNTLVSGIEQLMKAKKITVLKGWGEVKEANRIEVTTETGKVELHVENLVLATGSIPTKIPVPGVDLPGVVT
    SEELLEQETLPDSLVVIGGGVIGLEFASIYHEFGVKVSVVEMLPSLLPNIDEEIPKRLAPLLKRSGLEILTKAFVREIKP
    KEEGLVVIVEDGKGLKELPAQQVLLATGRRPSLSGIHGDALGLELDRGAIKVNSQMQTSVPKVYALGDVVGGAMLAHVAS
    MQGMVAAEHMAGQQVSMEGRAIPSAIFTYPEIAAVGETEQALKASGQNYKVSKFPFSANGKALALGEIMGLVKLLADEEG
    VVIGASIMGPQASSLIQECVLAVEKKIKAEDLAKIIHAHPTLPEAIMEAAHGISAKPLHLA

    >gi|89895696|ref|YP_519183.1| hypothetical protein DSY2950 [Desulfitobacterium hafniense Y51]
    MGFSDEQLERYSRHIILKEVGVKGQKKLLQSRVLIIGTGGLGAPAAMFLAAAGVGTIGLVDFDGVELSNLQRQIIHLTKD
    VGKPKVISGRETIGEMNPDVEVVPYQEWVSSGNIQDIIWDRDYDFIIDGTDNFPAKFLINDACVLSGKPFSHAGIIRFQG
    QTMTYVPGQGPCYRCIFKNPPPADSVPT
    CKQAGVLGVMGGIIGTIQATEAIKYILGLGDLLTGALLTYDALKMEFRRVKL
    PHNKKCQVCGEEPSITELIDYEQAACDLN

    >gi|89896240|ref|YP_519727.1| hypothetical protein DSY3494 [Desulfitobacterium hafniense Y51]
    MDTYYNPADLAKFATMGEEAPDLWQKFMAYYGSVFEEGALSPREKALIALAVATAVQCPYCIEAYTQSSLEKGANEEQMT
    EAIHVACAIRGGASLVHGVQMKNIVKKIGF

    >gi|89896638|ref|YP_520125.1| hypothetical protein DSY3892 [Desulfitobacterium hafniense Y51]
    MLKHLKQSKALTLVISLLLVLSLVTGCGSAPASTTPAQPPASQEPAKPETPAQPEQPAATAPTVESNTLGWDDWSAKMKG
    TINKDYYIVDLRTPDEIKLEKALEGSINIDANATLGTGNTDVIDEKLQGVAKDAVVLVH
    CKSGGRAKKNLQAFLDKGYVN
    AFALDGWTAFDAKGYFGATKITASSEQLKPDAWVAKMQGTIGKEYYVLDARDKSEYDAGHIEGALNFGVRDQFTVDHAAT
    IAKVKEAIPNKDTLVLVH
    CAVGARAKVAQAHLKAEGYTNVITLDNKITIDASGNYKFE

    >gi|89896646|ref|YP_520133.1| hypothetical protein DSY3900 [Desulfitobacterium hafniense Y51]
    MVQTPEDMQARFNIDVRIRSEVIRLDAANKKVLVRSQSRGTYEESYDALILSPGAKALRPNIPGIDSERILTLRNIPDTD
    AIKGLVDQKGVQSAIIIGGGFVGVEMAENLREQGLNVTLVEAAPHILAPFDTDMVVLAEKKLVAHGIRLILNDGVKSFQD
    LENQVEVTLASNRKLQGDLIILAIGVIPDTGFLKESGLELGPKGHLIVNEHMATNLPHVYAAGDAVEVLDYITKTKTAIP
    LAGPANKQGRIAADNIAGLNSTYKGTQGTSIIKIFELTAASTGANERTLQRANLPYHVIHIHPVSHASYYPNAYPMTLKL
    IFGADGRIFGAQGIGRDGVDKRIDVISTVIRLGGTVEDLTELELAYAPPFSSAKDPVNMAGYVAQNVLTGQAHMLVWDDL
    NKIDEEYTFVDVRTKIEFAKGHVEGAINIPVDDLRQRIQELDPGKLIVVY
    CEVGLRGYFAERILTQKGYRVLNLTGGYTT
    YSVQGFDPNQALDDYKKDFNPYPCCADEDIIDPDTQRIKHQ

    >gi|89896778|ref|YP_520265.1| hypothetical protein DSY4032 [Desulfitobacterium hafniense Y51]
    MEKILLERNWQDLEKLVLVSSKKAIRTLVNRIYIKDGLGFWRAVEALGVASALAEEQKKDSSVELVRRYFWSLNEESGGN
    AWNAAEAIGSIMASNPKECGHFNWMLANLLEDESLQEGTLWGLLNLSINAPEVVDPLVERVYPFLEARDVNQRGLAVWIF
    SLMKACPSAKERWEIEEELHKTLIQDQEMAEIYWEGEYYHFPVSELLGKEIVTFYAREYKQADFTWNISVASSQKGLCWV
    GLGTPEKEEGELRTWVQKRVPGSLVIPRALPNQKVMEQLEDYFSGIRQEFNLPLDPRGTDFQLKVWEELCRIPYGETRSY
    GEIAQNIGNPKGQRAVGLANNKNPIAIIIP
    CHRVVGKKGDLVGYASGLDHKVRLLNWEAAHRHQ

    >gi|89896885|ref|YP_520372.1| hypothetical protein DSY4139 [Desulfitobacterium hafniense Y51]
    MKELIKSIAVLGSGPAGYVAAIRASQLGAEVVVIEEEDLGGVCLNRGCIPTKALLKTAEIAVMAKRSKEFGIESQLEAKN
    WGVAVDRKNRIVKNLNSGLDNLLRARGITVLKGKGTVLSERKILVQTTEEVIEVNCEKMILTTGAVPLILPIKGIDSAGV
    ITSDEALNLKALPESIVIIGAGVIGLEFAAMLGHAGVKVTIIELQDRILPNEDREIAAELQKIMKRQGIIFKLSASVTEI
    HKIEDGLIVTYSMGEKEFRHPCEKVLVAAGRKTNSDIFEKLPLTIEKGAVVVDEFMETNVKGVYAAGDLVGGKQLAHLAF
    MEGKVAAENALGITSKVNYSAVPTCIYTNPEMASVGMTEEQAKRAGLSVKVGRFDFRNNGRALTLGEREGFVKVIADQDN
    TIIGGQILGVDASEMISELTLAITLKAKADDIADMIHPHPALSEAIWEACGEILGKPIHKL

    >gi|89896888|ref|YP_520375.1| hypothetical protein DSY4142 [Desulfitobacterium hafniense Y51]
    MEGNLDSDFALHVTQELDLEKLKSYGVPIIIDFGADSCIPCKEMAPVLKELNEELQGRAIVKFVDVWKYKKLAKGYPVNL
    IPTQIFIDAEGKPYQPQAPEAIQMNLYTLRETEEHVFTTHEGSLSKEQLLNILEEMGLA

    >gi|89896890|ref|YP_520377.1| hypothetical protein DSY4144 [Desulfitobacterium hafniense Y51]
    MYIYHRLYFIERDTIKLLIKQSQRERKMLRKYNPVLAFILLMLVTSLVLGCSSQSTSQPSLAPAPVTETPTLDPFQTNLL
    EFDAWKEKMVGKINSDYYVIDLRSPAEIKLEKAIDGSINIDAKETLANSNVNIIREILGAIPEDALILLH
    CKSGGRVKAN
    LAKFIEAGYTNVYGLNSWTAFDAKGYIGAAKINANTEHIKPDAWVAKMRGEIGKDYYIIDTRDQVDHETGYLKGAINLGV
    AETFTVNHSATMAVVGKAIPNKDSIILVH
    CNAGTKARVAQAHLKAEGYTNVFVLDNRMIIDKDGNYTFE

    >gi|89896894|ref|YP_520381.1| arsenite S-adenosylmethyltransferase [Desulfitobacterium hafniense Y51]
    MDNIREGVRQKYAFAIANRGQGCCGSPGCCSDGLSDAADPITGNLYDESDLQGLDPELIANSFGCGNPTALMNLNLGEVV
    LDLGSGSGLDVLLSAKRVGPTGKAYGLDMTDEMLAVAKENQRKSGIENAEFLKGHIEEIPLAAKSIDVIISNCVINLSGD
    KDKVLKEAYRVLKPQGRFAVSDIVIKRPLPEKIRDNILAWAG
    CIAGAMTEEEYRGKLSRAGFENISLQVTREYNLEDPSL
    RGMLEDLTDGEIKEFQGAMVSCFIRAAKPA

    >gi|89897027|ref|YP_520514.1| hypothetical protein DSY4281 [Desulfitobacterium hafniense Y51]
    MEQYQVGILGGGPGGYVCALRAAQLGLSVVLVEGDRLGGTCLNRGCIPTKALIKSADFWRELQQVEEFGIRAGESSFDFA
    KMIERKDRIVHNLVLGVEQLFRTAKIPVIKGWGEITEAGRINVETETGQVRLKVENLVVATGSTPFRIPVPGANLDGVMT
    SDHILDEKTLPEKLVIIGGGVIGLEFASAFQALGVKVTVVEMLPSLLANSDDEIPRRLTSVLKKRGIDIFTKTMVKEIKS
    AENRLITVVENAKGIQEIFSDRVLLATGRKTNLCGVNAQRLGLQLEGGSIVVDSQMRTSVPNIYAIGDVTGKAMLAHVAS
    AQGMVAAEHIAGHQVEMSYRAVPSVIFTHPEIAAVGATEQELRTAGVKYKVSKFPFSANGKALVLGETMGTVKILANEEG
    VILGSSIMGPQASSLIQELVLGVEKGLNAEVLAKTIHAHPTLPEAIMESAHGILGKPLHLA

    >gi|89897029|ref|YP_520516.1| hypothetical protein DSY4283 [Desulfitobacterium hafniense Y51]
    MAKVVVKWEENMNFRGYDSGQRDVLMDASAIYGGSDKGIRPMELLLITLGGCASIEIGNVLNKMRISYEQFDVEVEGERA
    DTVPQVFTSISLRFIVKCNNLFKEKLEKALRLGEDYCSVANMIKESCPIKMSYNLNGIDYSL

    >gi|89897046|ref|YP_520533.1| hypothetical protein DSY4300 [Desulfitobacterium hafniense Y51]
    MSQFPLLSSPVKLGSMLLKNRMMTTSMSPGHDYTNEEGQPTLRFYNYLEERAAGGTALICQTICFYPRLKSQLDHLHPLP
    LGYGEEHLSHLSKMAEVVHKHGGLIVGQPYAVHDWKPAPEDKEEYWGPSTLSVSKLIPKPMTKEHIRIFKENIVQCCVIL
    QKAGWDGVEVMAGVGGILNRFMSPATNDRTDEYGGSLENRCRLTVEVMAEIKKACGEDYPIIVRWSPVDFIKGSLTMEES
    LKIVKILEEAGAVLHNLAPGWHETSVPLTIKDVPEGYWSWISEEIKKVAKIPVATAYRNTDPFSMEEILAKDKADVIAGL
    RYNIADPEFANKVMEGRPEDINKCICCCRCLDDVISQGKPLNYCGVNPRLGEELETPLAQARQSKEVMVIGSGPGGLAAA
    VTAARRGHKVTIYERGPRLGG
    CLVMSAIFSPIYDRLNTYYKTLLKKHPEVKVHLNTAVTPALVTREKPDAVIVAIGGHPI
    DLKVPGAEGGNVVKSHDFLELLNGNPPQKPGIINKVMYNCGSVFLKFFYTPDLARTFMGKFPWPLGRKIAIIGGGLPGCE
    LAKEMMHYDRELVIIEEKKKIGHDVGGSDRFHIVSAFKKSPRVTMEMLTKVKAITRAGVKVVHEDGSEAFHQAKTVAVTL
    GFEKNMELAEALKGRVSEVYAVGDCSNPARMADATKAGYKAACQI

    >gi|89897147|ref|YP_520634.1| hypothetical protein DSY4401 [Desulfitobacterium hafniense Y51]
    MPDSSRSQSQERVKYCIEGEFCANCSAKMERALSATEGIGETSINYAMKTVFLPPGTMGRAQAIIEKIEPGVKLVAVKEK
    GAVNAPEKVQYRIEGEF
    CPNCSAKMEQALCATEGIGETSINYAMKTVLLPPGMMSKAQEIIERIEPGVKLMPVEKKAVKN
    SVHDAEEEAKETKQKLLKIFIAGIFLVIGLIFGSRWHNTSLEVLEYLVFLLAYGLVGYEVLAKAFRNIMRGSVFDENFLM
    SIATLGAIAIHELPEAVGVMLFYAVGEYFEDRAVNRSRRSIQAVLNIRPDYANLVNGLETKKVDPDDVHIGQLILIRPGE
    KVPLDGEIVHGSSYVDTSALTGESVPRSVKVGDSVLAGIINTSGVLTVRVTREFADSSVQKILDLVENASARKAKTEKFI
    TTFARYYTPAVVVIALGIALIPPLFMGGDFREWLYRAMTILVISCPCALVISVPLGYFGGIGGASRHGILVKGANYLEAL
    TSVKTVIFDKTGTLTQGVFEVNKIETSGHYTEAQLLEIAAAAEVHSSHPIAKSIRDKWGKEIDSVSLTHYEEISGKGIRS
    EFKGKVVLVGKRDLLLENSIAVPELEMSEVGTQVYIGVDGEYAGVLMISDRSKEGAKEVVAQLNQGGITTVMLTGDQRSV
    AEAVAEQLGIREYHGDLLPEDKVTWLEHYQQKLKGKGKVVFVGDGINDAPVLSRADIGVAMGGLGSDAAIEAADVVLMED
    RPGKLVSAMDIAQFTKKVIWQNIGFALVIKLGFIGLGMFGVANMWEAVFADVGVALLAILNATRVRRYTRPEKAAALPSL


    >gi|89897148|ref|YP_520635.1| hypothetical protein DSY4402 [Desulfitobacterium hafniense Y51]
    MEAAIKKEFILEGLCCGNCAAKIERDVARLEGMASAAVDFVAGKASVQGR

    >gi|89897187|ref|YP_520674.1| hypothetical protein DSY4441 [Desulfitobacterium hafniense Y51]
    MNYIIIGNSAAGLFAAEGLRKVDSQGKITVLTADHYPPYSRCLTTYYLAGDIREEQLFLRTTEELARLNLNTHYRVRVTG
    LDPEGQRVSTASGEVFDYDRCLIATGASAVSLDIAGAALPEVFTLRHLENAKAIQKFIKKGRKAVIIGGGLVSLKSAYAL
    RKQGMEVHVIVSSGYILSQMLNSSAAERLEEHLKDHGIHISLNSDVAAIKGKEHVEAVELKCGRIIDTNLVIIGKGVQPN
    VEPFLNSGLKINHGILVNEYLETNLPHVYAAGDVAETWDFLRECPRINAVWPNATEQGRVAALNMAGRKTIYKGSMGMNS
    VDFFGLRIISGGVITPLAHKKDIENALPWKVTEGQESWSKPLAKASTYQSLIWKGNYLKGYVLIGYPERAGLLTAMIRTQ
    EPLAPEVQRNIEAGNRKIVKLK

    >gi|89897209|ref|YP_520696.1| hypothetical protein DSY4463 [Desulfitobacterium hafniense Y51]
    MADNTREIVNYPGYVNTSGPELMEDFKRHAKSFGVEFLKDEVVSADLSQDLKKIMTKKKKEVYGKAVIVAVGTQPRLLNI
    PGEKELRGNGVAY
    CATCDAEFFEGEDVVVVGSGDQAIEEGMFITKFARKVTVIVLHDKGVLDCNKVSAEKAFQSEKMDFV
    WNSTLEAVLGDENVEGVKVKNLKTGTSSILPCQGVFFFVGMIPATEFLKDSGIEMDHRGYISVNDLMETNLSGVYAVGDN
    RIKYLRQVVSAAGDGATAAVAAERYIEELEAFQKNILNSEKKVLLVFFNAADTQSLEYSSLVEELHKEHSEEYTLVKVDM
    ATKKSLAEKYGVINAPAVVVLDKGEKVKDMECSKDKATLAGQL

    >gi|89897210|ref|YP_520697.1| hypothetical protein DSY4464 [Desulfitobacterium hafniense Y51]
    MSLTKLDSKSFEEKIYDNGERCLVIFSRKSCHVCKEVVPVLEELAPNYEGEFGFYYVDVEDNKELYQTFSLRGVPQILFF
    NEGEYCGKFAGEVEEEQVQAKISEILG

    >gi|89897217|ref|YP_520704.1| hypothetical protein DSY4471 [Desulfitobacterium hafniense Y51]
    MSNSYDLIIIGGGPAGLAAGIYGGRAKLRTLIINKGTIGGMVDTTREIVNYPGYIHTSGPDLMSDFKKHAESFGVEFLKD
    EVVSTELSQDLKKVTTKKKKEFYGKAVIIAAGTQPRLLNIPGEKELRGSGVAY
    CATCDAEFFQDEDVVVVGSGDQAIEEG
    MFITKFARKVTVIVLHDEGILDCNKVSAEKAFQNEKMEFVWNSTLEAVLGEENVEGVQVKNLKTGGSSLLPCQGVFFFVG
    MIPATEFLQNSGIEMDRRGYIPVNDLMETNLPGIYAVGDNRVKYLRQVVSAAGDGATAAVAAERYIEELEAFQKNILHSE
    KKVLLAFFNAANTASLEFTVVMEELIQEHSDMYKLVKVDMATKKSLAEKYGVTNVPAVVMLDKGEKIKELECSLDKEILA
    EQLGKE

    >gi|89897218|ref|YP_520705.1| hypothetical protein DSY4472 [Desulfitobacterium hafniense Y51]
    MDGCGLEELIYDIGEGCLIFFYRNNCPVCEEMAPVLEELQPKYKGQFGFYYVNIDENKEVINCFKLDEIPQVLFFKDGEY
    QGKLSGEFNQAQVVEKIQENLVDLV

    >gi|89897255|ref|YP_520742.1| hypothetical protein DSY4509 [Desulfitobacterium hafniense Y51]
    MKKKVSIEGMSCGHCVNHVREALGELKGVTNVEVSLEGKYATLEASENVSDEAIKAAVDEVGYEVVDVQEA

    >gi|89897256|ref|YP_520743.1| hypothetical protein DSY4510 [Desulfitobacterium hafniense Y51]
    MASKTLKIEGMTCAACAKTVERVTKKLEGVTESNVNLATEKLNISFDEGKLTVGDIQVAVEKAGYKALTDAVSKTMKIEG
    MT
    CAACAKTVERVTRKLEGVNEANVNLATEKLMISYEPSLVGISDIRKAIEKAGYKAIEEETTVDTDKERKDEERKQLWR
    RFVLSAIFTVPLLYMAMGHMFGGVIGLRLPMFIDPMMNPLNFALVQLFLTIPVVIAGKKFFTIGFNSLFRGSPNMDSLIA
    IGTSAAVLYGLYAIAQIYGGNTAYVNQLYFEAAGTIITLISLGKYLEAVTKGKTSEAIKKLMGLAPKTALVVRDGKEVII
    NIDEVEVGDVIIVKPGEKMPVDGEVIEGNTAVDESMLTGESIPVEKNIGDTIIGASINKNGTIKYRATRVGKDTALAQII
    KLVEDAQGSKAPIAKLADVISGYFVPIVIGIATLTALAWYFIGGQSTVFALTIFISVLVIACPCALGLATPTAIMVGTGK
    GAEHGVLIKSGVALETTHKIKTIVFDKTGTITEGKPKVTDVVVTNGITQSDLLQLAASAEKGSEHPLGEAIVKDAEEQGM
    EFKKLDSFKAIPGHGIEVDIEGKRLLLGNRKLMVESHVSLGNMEGISDRLAQEGKTPMYIAMDNKLAGIIAVADTVKENS
    KKAIERLHEMGIEVVMITGDNKRTAEAIAKHVGIDRVLAEVLPQDKANEVKKLQTEGKKVAMVGDGINDAPALAQADIGI
    AIGSGTDVAMESADIVLMRSDLMDVPTAIHLSKSTIRNIKQNLFWAFGYNTLGIPVAMGVLYIFGGPLLNPMFAAAAMSF
    SSVSVLLNALRLKGFKPVR

    >gi|89897377|ref|YP_520864.1| hypothetical protein DSY4631 [Desulfitobacterium hafniense Y51]
    MSEATSNQSVERIKYRIEGEFCANCSAKMERALSSTKGFGETSINYSMKTVFLPPSMVSQAQAIMDKIEPGVKLVAANEK
    RPANSSDKIQYRIEGEF
    CPNCAAKMERVLSATEGIGETTINYATKTVYLPSSMLNQAQEIMEKIEPGVKLVPVEKNKAKG
    NVHDGENEAKETKQKLTTILIAGVLLAVGLIFGSRWHNTSFEVLEYFVFLTAYVLVGREVIEKAFRNILRGSVFDENFLM
    VLATIGAIAIHELPEAVGVMLFYSVGEYFEDRAVNRSRRSIQAVLNIRPDYANLVNQLDVKKVDPEEVHIGQVILIRPGE
    KVPLDGEIVHGASFVDTSALTGESVPRSVKVGDSVLAGMINTSGVLTVRVTREFADSSVQKILDLVENASTRKAKTEKFI
    TTFARYYTPAVVVVALGIALIPPIFMGGDFREWLYRAMTILVISCPCALVISVPLGYFGGIGGASRHGILVKGANYLEAL
    TAVKTVIFDKTGTLTQGVFEVNKIETTKLYTEEQLLEIAATAEVHSSHPIAKSIRDRWSKAIDSASISNYEEMSGQGIRA
    VFDGRVVLVGKKDLLIQNSVTVPELELKQVGTQVYIAVDGAFAGHLVISDREKVGAKEAVTQLNQAGITTVMLTGDHETV
    AKAVSEELGIKEYHADLLPEDKVTWLEKYLQKLNGKGKVVFVGDGINDAPVLTRADIGVAMGGLGSDAAIEAADVVLMED
    RPGKLVSAMDIAQFTKKVIWQNIGFALVIKLGFIVLGMFGVANMWEAVFADVGVALLAILNATRVRQYSNPTNVEVESHA
    RMNEVAAR

    >gi|89897420|ref|YP_520907.1| hypothetical protein DSY4674 [Desulfitobacterium hafniense Y51]
    MEKAENAKSEGAGVKVLGSGCAKCNQLEEATKAALEQLGMDTSIDHVTDFSQIAAYGVMTTPALVVDGKVVSYGKVLKTE
    EVVKILQKVRE

    >gi|89897422|ref|YP_520909.1| hypothetical protein DSY4676 [Desulfitobacterium hafniense Y51]
    MKEYSLPIIIDYGADSCIPCKEMAPVLKTLNAEMQGKAIIKFVDVWKNGEAAKDFPIQVIPTQVFINADGKPYVPSDDLQ
    IKFDMYSYKNTGEHAFTVHQGGLTEDQMRAILTDMGVDE

    >gi|89897440|ref|YP_520927.1| hypothetical protein DSY4694 [Desulfitobacterium hafniense Y51]
    MKSFLSSCTTGGCGAKIGPGELSKVLSGLPVFQDPQLLVGFDASDDAAVYQINEDTAIVSTVDFFTPMVEDPRIFGRIAA
    ANALSDVYAMGGSPLFALNLVCYPEREDIQDLGEILAGGAEKLQEAGAVLCGGHSIYDREPKYGLAVTGRLNPRQIWKNN
    TPQPGDRLILTKPLGVGIVMAALRGEMAEAAAVEAALASMQRLNKYAAEKARDFPIHACTDITGFGLLAHTREMAGGSTT
    IVLYPSALPYIAQAYTYAQGYLLTAAGQRNRNFMEGAVEFGDTPFPLQELMLDPQTSGGLLLSVPGDCAQEALRAIQEAE
    PQAALIGEVVSRQALPILLR

    >gi|89897443|ref|YP_520930.1| hypothetical protein DSY4697 [Desulfitobacterium hafniense Y51]
    MKIKVSRIFLSVTMLIFLSIVGTGCSEAAVPAESSKRFPDNPNLGVSYEGKELQEIWMAGGCFWDVDAYLSRIYGVADVT
    VGYANGNSENPTYEDVCYRNSGHAETAYVRYDPERVDLETILEYFFKIIDPTSLNRQGNDVGTQYRTGIYYQNEADREII
    LKVITEEQSKYEKPMVTEVIPLAHFYEAEEYHQDYLVKNPDGYSHIDFSPLEEQKLVNIDPGPYNKPSDDLLRKTLTDLQ
    YAVTQKDATERAFANDYWDHHEQGLYVDVVTGEPLFTSRDKFDSGTGWPSFTRPIASEVIIEKEDSTLGMKRIEVRSRAG
    DSHLGHLFNDGPPEDGGLRY
    CINSAALRFIPLSELQAEGYGQYLSRIE

    >gi|89897451|ref|YP_520938.1| hypothetical protein DSY4705 [Desulfitobacterium hafniense Y51]
    MHVRSHRAKKFKISPDEAKRLLDTTKGIILLDVRSEEEYRERHIPKSLLMPLNSLKAQAPKRLPDKNKEILVYCRSGNRS
    AAAVRILSKLGYVKVKNIGGIIHWPFATVSGK

    >gi|89897507|ref|YP_520994.1| hypothetical protein DSY4761 [Desulfitobacterium hafniense Y51]
    MYYSTTYLSPICTITLACDGDNLIGLWMEGQRFHGGTLPESMIEKDDIPIFDAAKAWLDRYFAGERPATSELPLAPMGGE
    FRQGVWDILCQIPYGQVITYGDIAKQMAEKMNKKCMSSQAIGGAVGHNPISIIIP
    CHRVVGAKGNLTGFGGGISRKIQLL
    EHEGVDMSRMFVPKKGNAL

    >gi|89897561|ref|YP_521048.1| hypothetical protein DSY4815 [Desulfitobacterium hafniense Y51]
    MNDFFEQVYAIVGKIPYGKVVSYGEISWMLGRPRSAREVGRAMRFCPEKLPCHRVVRADGSITGDSHAEVRKILLENEGI
    TFLPGGRVDMKTHRWSG

    >gi|89897736|ref|YP_521223.1| hypothetical protein DSY4990 [Desulfitobacterium hafniense Y51]
    MSLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYF
    KDGEYKGKMAGDVEDDEVEQMIADVLED

    >gi|89893612|ref|YP_517099.1| hypothetical protein DSY0866 [Desulfitobacterium hafniense Y51]
    MKMKDFKLINAASLEEAVSGLQQSGAVAKAGGTDLLGAMKKNILPHYPKVVVNIDSIQGLDYIKEEDGMLKIGALAKLAE
    VAENSVVKEKYTALAEAAKKTASPNLRNMGTIGGNICQYNRCWYLRASGNYFDCLRKGGSTCYAISGDNRFHSIFGGIRI
    EGGLPCADDCPSGIAIPDYLGKVKAGDMAGAAAILLESNPLPAMTGRVCPHFCEDHCNRGDLDEAVSIRDLERKVGDYIL
    EHASELIKAPEKESGKKAAVIGAGPAGLAAAFYLRLMGHSVTIIDAKEEAGGMLTYAIPAYRLPKEIVKKQVNALKATGI
    EFNMGVRIGQDIQLDKLMADYDAVFVACGAWKEKPTGIKGEELLLSGLNFLNDVAGGMSKLPKPEKTIV
    CADRGGCSLIG
    GVQHVAVLGGGNTAIDVARTLQRMGAVPVIVYRRTIEEMPAIKHDIEKAIEEGIEIRFLTQPVEAAQKGAKVVLTCSKME
    LGEPDASGRRRPVAVLNSEFNLEFDAVITAFGEDADTSFVPSKYLDGKWLKADGAYVGDNLFSGGDYLSGPSTVTQAMAS
    GKKAAKAINAYLGGEEQECGCTSECSGLLDLSNPCMEQACRAVAPEMAVAERIKNLTGEDVASLDDAAFGTEANRCLNCG
    CVAVNCSDTAPALIALDAQIITTKRTIPADKFWSSKAPGSTILENDELVTEIRIPVAVAGSKSAFLKLATRATIDFPIVN
    CAVVISGKDARVCLNAVHPNPYRACKAEDLIKGKVIDEALAEAAGEAAVSDAIAMPNNAYKIQMAKVIVKRTILACK