Desulfitobacterium hafniense DCB 2 uid57749

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219666310|ref|YP_002456745.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MALKQLDSNSFEEIIYDNGEACLVLFSRKSCHVCKEVGPMVEDLAPKYSGKFGFYYVDVEENMTLFQRFSLKGVPQILFF
    KDGEYQGKLSGNVEEEVLEEKIAEIQA

    >gi|219666319|ref|YP_002456754.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MKVVIIGGVATGPKVAARLRRLSIDAEITVVEKGKIVSYGSCGLPLFLGNLVPKIEDLMKTSAGLIRDTQYFEDTKGINV
    LTQTEALAIDRQQKKVRVRNLATGEERDLDYDHLVLATGAKEVVPPIPGIQYQNVYTLHSLDDAVNIKALIKEKKIQHAT
    IIGAGLIGIEVADAIAGPRLKVTLFESQGSVVPKLLDPDMALLVEHKMRSRGIDLRLNCPVKELTGDEDGKVNGVILENE
    SITTGLVIVAVGVRPEVTLARQAGLTLGITGAIQVNQYMQTDDTYIYAGGDCAEQVNMLSGRQVFVPLASTANKQGRVIA
    DNIAGRASEFPAICATSVFQAFELNVGRTGLGEPEARELGYDVITSLSTGLDAVHYYPVHGAVTIKLIAERTSGRLLGAQ
    VCGTGEAIKRLDVLITILRFNGTVKDISNLDLSYAPPFATAIDVLIHAANTLENKQLGIVDTVNPFELLERLKKDKSIIF
    VDVREGDETRANPVEGSQIIVIPLGELRKRYTEIPQGSPVVTF
    CELGIRGYDAACFLKGVGFQDVSFLEGGMSTWGALQP
    ALNM

    >gi|219666544|ref|YP_002456979.1| peroxiredoxin [Desulfitobacterium hafniense DCB-2]
    MSLIGKEVNEFKVQAFVEGAFKEVTKGDLLGKWSVFVFYPADFTFVCPTELGDLADQYDEFKKIGVEIYSVSTDTHFVHK
    AWHDASDTIRKIRYPMLADPTAKLAKDFEVYIEEEGLALRGSFVVNPEGKIVAYEVNSNNIGREASELLRKVQAAQFVAE
    HGDQVCPAKWRPGAETLKPSLDLVGKL

    >gi|219666545|ref|YP_002456980.1| alkyl hydroperoxide reductase F subunit [Desulfitobacterium hafniense DCB-2]
    MKELYDLIIIGSGSAGMAAGIYAGRSKLKTLVIDRDRAGGQIKITSEVENYPGILNISGEELSQAMRRQAEKFGVKFRQA
    AVESVDLAGDIKKIRTAEGDYEALAVIIATGSVPRKLGFIGEEEFRGRGIGY
    CATCDGEFFTGMDVFVIGGGLAAAEEGI
    FLTRYARKVTMIVRGDGFSCPQTISERVLAHPKIEVKFNTELREAGGDAVLRYAEFVNNRSGERWRYDVREQKQTFGVFV
    FVGYIPQSAEYAQEVRIDERGYIPTDESMGTNVEGVYAAGDIRPKELRQLVTAVADGAIAATSAEKYLVGKKERLGLGEL
    GELGESGERDELSDEEKTPVTRQGTSLLDDSLKEQLVPILERLENRIGLLAFLEGSSGFSEELRSFLSEFAGLTDKVEVE
    FLNRGEDAVREKEAKITLFPAVAVLGPDGVYTGVQFHGIPGGHEINSFILALYNAAGPGQAVGEETLAKIRRVSRKVNFK
    IGVSLS
    CTLCPDVVTLAQLMALKNPLIEAEMIDVAHYPDFKNKYGIMSVPAIVVNDEKVVFGKKNLEELLELAGG

    >gi|219666693|ref|YP_002457128.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MSLQRLNAKSFEEIIYDQGSPCLVIFSRKTCHVCKGVVPILEEMQPDYEGKFGFYYVDVEEEQALYQRFSLKGVPQILFF
    KDGEFQGKLVGAVDDEKVSDKIMEVGEGE

    >gi|219666914|ref|YP_002457349.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MSLIQLDGCGLEELIYDIGEGCLIFFYRNNCPVCEEMAPVLEELQPKYKGQFGFYYVNIDENKEVINCFKLDEIPQVLFF
    KDGEYQGKLSGEFNQAQVVEKIQENLVDLV

    >gi|219666915|ref|YP_002457350.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MSNSYDLIIIGGGPAGLAAGIYGGRAKLRTLIINKGTIGGMVDTTREIVNYPGYIHTSGPDLMSDFKKHAESFGVEFLKD
    EVVSTELSQDLKKVTTKKKKEFYGKAVIIAAGTQPRLLNIPGEKELRGSGVAY
    CATCDAEFFQDEDVVVVGSGDQAIEEG
    MFITKFARKVTVIVLHDEGILDCNKVSAEKAFQNEKMEFVWNSTLEAVLGEENVEGVQVKNLKTGGSSLLPCQGVFFFVG
    MIPATEFLQNSGIEMDRRGYIPVNDLMETNLPGIYAVGDNRVKYLRQVVSAAGDGATAAVAAERYIEELEAFQKNILHSE
    KKVLLAFFNAANTASLEFTVVMEELIQEHSDMYKLVKVDMATKKSLAEKYGVTNVPAVVMLDKGEKIKELECSLDKEILA
    EQLGKE

    >gi|219666923|ref|YP_002457358.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MSLTKLDSKSFEEKIYDNGERCLVIFSRKSCHVCKEVVPVLEELAPNYEGEFGFYYVDVEDNKELYQTFSLRGVPQILFF
    NEGEYCGKFAGEVEEEQVQAKISEILG

    >gi|219666924|ref|YP_002457359.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MDNYYDLIIIGGGPAGLTAGIYGGRAKLKTLIINKGTIGGMADNTREIVNYPGYVNTSGPELMEDFKRHAKSFGVEFLKD
    EVVSADLSQDLKKIMTKKKKEVYGKAVIVAVGTQPRLLNIPGEKELRGNGVAY
    CATCDAEFFEGEDVVVVGSGDQAIEEG
    MFITKFARKVTVIVLHDKGVLDCNKVSAEKAFQSEKMDFVWNSTLEAVLGDENVEGVKVKNLKTGTSSILPCQGVFFFVG
    MIPATEFLKDSGIEMDHRGYISVNDLMETNLSGVYAVGDNRIKYLRQVVSAAGDGATAAVAAERYIEELEAFQKNILNSE
    KKVLLVFFNAADTQSLEYSSLVEELHKEHSEEYTLVKVDMATKKSLAEKYGVINAPAVVVLDKGEKVKDMECSKDKATLA
    GQL

    >gi|219666947|ref|YP_002457382.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MNYIIIGNSAAGLFAAEGLRKVDSQGKITVLTADHYPPYSRCLTTYYLAGDIREEQLFLRTTEELARLNLNTHYRVRVTG
    LDPEGQRVSTASGEVFDYDRCLIATGASAVSLDIAGAALPEVFTLRHLENAKAIQKFIKKGRKAVIIGGGLVSLKSAYAL
    RKQGMEVHVIVSSGYILSQMLNSSAAERLEEHLKDHGIHISLNSDVAAIKGKEHVEAVELKCGRIIDTNLVIIGKGVQPN
    VEPFLNSGLKINHGILVNEYLETNLPHVYAAGDVAETWDFLRECPRINAVWPNATEQGRVAALNMAGRKTIYKGSMGMNS
    VDFFGLRIISGGVITPLAHKKDIENALPWKVTEGQESWSKPLAKASTYQSLIWKGNYLKGYVLIGYPERAGLLTAMIRTQ
    EPLAPEVQRNIEAGNRKIVKLK

    >gi|219666990|ref|YP_002457425.1| heavy metal translocating P-type ATPase [Desulfitobacterium hafniense DCB-2]
    MEAAIKKEFILEGLCCGNCAAKIERDVARLEGMASAAVDFVAGKASVQGR

    >gi|219666991|ref|YP_002457426.1| heavy metal translocating P-type ATPase [Desulfitobacterium hafniense DCB-2]
    MPDSSRSQSQERVKYCIEGEFCANCSAKMERALSATEGIGETSINYAMKTVFLPPGTMGRAQAIIEKIEPGVKLVAVKEK
    GAVNAPEKVQYRIEGEF
    CPNCSAKMEQALSATAGIGETTINYAMKTVLLPPGMMSKAQEIIERIEPGVKLMPVEKKAVKN
    SIHDAEEEAKETKQKLLKIFIAGIFLVIGLIFGSRWHNTSLEVLEYLVFLLAYGLVGYEVLAKAFRNIMRGSVFDENFLM
    SIATLGAIAIHELPEAVGVMLFYAVGEYFEDRAVNRSRRSIQAVLNIRPDYANLVNGLETKRVDPDDVHIGQLILIRPGE
    KVPLDGEIVHGSSYVDTSALTGESVPRSVKVGDSVLAGIINTSGVLTVRVTREFADSSVQKILDLVENASARKAKTEKFI
    TTFARYYTPAVVIIALGIALIPPLFMGGDFREWLYRAMTILVISCPCALVISVPLGYFGGIGGASRHGILVKGANYLEAL
    TSVKTVIFDKTGTLTQGVFEVNKIETSGHYTEAQLLEIAAAAEVHSSHPIAKSIRDKWGKEIDSVSLTHYEEISGKGIRS
    EFKGKVVLVGKKDLLLENSIAVPELEMSEVGTQVYIGVDGEYAGVLMISDRSKEGAKEVVAQLNQRGITTVMLTGDQRSV
    AEAVAEQLGIREYHGDLLPEDKVTWLEHYQQKLKGKGKVVFVGDGINDAPVLSRADIGVAMGGLGSDAAIEAADVVLMED
    RPGKLVSAMDIAQFTKKVIWQNIGFALVIKLGFIGLGMFGVANMWEAVFADVGVALLAILNATRVRRYTRPEKAAALPSL


    >gi|219667084|ref|YP_002457519.1| NADH:flavin oxidoreductase/NADH oxidase [Desulfitobacterium hafniense DCB-2]
    MSQFPLLSSPVKLGSMLLKNRMITTSMSPGHDYTNEEGQPTLRFYNYLEERAAGGTALICQTICFYPRLKSQLDHLHPLP
    LGYGEEHLSHLSKMAEVVHKHGGLIVGQPYAVHDWKPAPEDKEEYWGPSTLSVSKLIPKPMTKEHIRIFKENIVQCCVIL
    QKAGWDGVEVMAGVGGILNRFMSPATNDRTDEYGGSLENRCRLTVEVMAEIKKACGEDYPIIVRWSPVDFIKGSLTMEES
    LQIVKILEEAGAVLHNLAPGWHETSVPLTIKDVPEGYWSWISEEIKKVAKIPVATAYRNTDPFSMEEILAKDKADVIAGL
    RYNIADPEFANKVMEGRPEDINKCICCCRCLDDVISQGKPLNYCGVNPRLGEELETPLAQARQSKEVMVIGSGPGGLAAA
    VTAARRGHKVTIYERGPRLGG
    CLVMSAIFSPIYDRLNTYYKTLLKKHPEVKVHLNTAVTPALVTREKPDAVIVASGGHPI
    DLKVPGAEGGNVVKSHDFLELLNGNPPQKPGIINKVMYNCGSVFLKFFYTPDLARTFMGKFPWPLGKKIAIIGGGLPGCE
    LAKEMMHYDRELVIIEEKKKIGHDVGGSDRFHIVSAFKKSPRVTMETLTKVKAITRAGVKVVHEDGSEAFHQAKTVAVTL
    GFEKNMELAEALKGRVSEVYAVGDCSNPARMADATKAGYKAACQI

    >gi|219667254|ref|YP_002457689.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfitobacterium hafniense DCB-2]
    MGKRYAMVIDLRKCVGCHACQVACKSENNVPLGVFRNWVDELETGKFPNVSRQRLPRLCNHCENPSCVKVCPVKATTQKE
    DGTVVIDYDLCIGCKYCIAACPYDARFINPERRTAEKCDYCYARVEAGLQPACVNTCIGGARIFGDLNDPTSEVAKFVAT
    NPVKVSKPETNNGPQTYYIGADEKTLRPNFEIVGGNK

    >gi|219667260|ref|YP_002457695.1| Methyltransferase type 11 [Desulfitobacterium hafniense DCB-2]
    MDNIREGVRQKYAFAIANRGQGCCGSPGCCSDGLSDAVDPITGNLYDESDLQGLDPELIANSFGCGNPTALMNLNLGEVV
    LDLGSGSGLDVLLSAKRVGPTGKAYGLDMTDEMLAVAKENQRKSGIENAEFLKGHIEEIPLPDKSIDVIISNCVINLSGD
    KDGVLKEAYRVLKPQGRFAVSDIVIKRPLPEKIRDNILAWAG
    CIAGAMTEEEYRGKLSSAGFENIELQVTREYDLEDPSL
    RGMLGDLTEGEIKEFRWAIVSCFIRATKSE

    >gi|219667275|ref|YP_002457710.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MGENENRKSNRIVLKIVIPLLLLSIVAGIWAMKNSDSGLASESNINPDFALHVTQELELEKLKSYGVPVVIDFGADSCIP
    CKEMAPVLKELNEELQGRAIVKFVDVWKYEEFAKGYPINLIPTQIFIDAEGQPYKPKDPEATQMTLYSLRETGEHVFTTH
    EGGLTKNQLLEILKEMGLE

    >gi|219667279|ref|YP_002457714.1| redox-active disulfide protein 2 [Desulfitobacterium hafniense DCB-2]
    MVIKILGTGCANCKKLEANAKEAIKELGLDAVVEKVEDLQAIMAYGVMKTPALVVNEQVKVMGKVLSAEEIKKYLN

    >gi|219667283|ref|YP_002457718.1| Rhodanese domain protein [Desulfitobacterium hafniense DCB-2]
    MRSKAVLYLVYLILVTSLLAGCNSESTTQPSLSPAPSQSTISNTPTQDLFQTNLLEFDAWKAKMSGEINKDYYVIDLRTP
    AEIKLEKAIEGSINIDANETLAKGDMTIINEKLTAIPKDALILLH
    CKSGGRVKAHLAKFVEAGYTNVYGLNGWTAFDSKG
    YIGAAKINANTEHLKPNAWQAKMIGEIGKDYYIIDTRNKVDHETGNIKGAMNLGAAETFTVDHVATMAIVEQAIPNKDSV
    ILVH
    CNAGTKARVTQAHLKAEGYMNVFVLDNRMIIDKAGNYTFE

    >gi|219667390|ref|YP_002457825.1| methylated-DNA/protein-cysteine methyltransferase [Desulfitobacterium hafniense DCB-2]
    MGETMERMEKILLERNWQDLEKLVLVSSKKAIRTLVNRIYIKDGLGFWRAVEALGVASALAEEQKKDSSVELVRRYFWSL
    NEESGGNAWNAAEAIGSIMASNPKECGHFNWMLANLLEDESLQEGTLWGLLNLSINAPEVVDPLVERVYPFLEARDVNQR
    GLAVWIFSLMKACPSAKERWEIEEELHKTLIQDQEMAEIYWEGEYYHFPVSELLGKEIVTFYAREYKQADFTWNISVASS
    QKGLCWVGLGTPEKEEGELRTWVQKRVPGSLVIPRALPNQKVMEQLEDYFSGIRQEFNLPLDPRGTDFQLKVWEELCRIP
    YGETRSYGEIAQNIGNPKGQRAVGLANNKNPIAIIIP
    CHRVVGKKGDLVGYASGLDHKVRLLNWEAAHRHQ

    >gi|219667558|ref|YP_002457993.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MKKKVLIVGGVAGGASAAARLRRLDEDAEIILFERDDYISFANCGLPYYIGGTITKRERLMVQTPEDMQARFNIDVRIRS
    EVIRLDAANKKVLVRSQSRGTYEESYDALILSPGAKALRPNIPGIDSERILTLRNIPDTDAIKGLVDQKGVQSAIIIGGG
    FVGVEMAENLREQGLNVTLVEAAPHILAPFDTDMVVLAEKKLVAHGIRLILNDGVKSFQDLENQVEVTLASNRKLQGDLI
    ILAIGVIPDTGFLKESGLELGPKGHLIVNERMATNLPHVYAAGDAVEVLDYITKTKTAIPLAGPANKQGRIAADNIAGLN
    STYKGTQGTSIIKIFELTAASTGANERTLQRANLPYHVIHIHPVSHASYYPNAYPMTLKLIFGADGRIFGAQGIGRDGVD
    KRIDVISTVIRLGGTVEDLTELELAYAPPFSSAKDPVNMAGYVAQNVLTGQAHMLVWDDLNKIDEEYTFVDVRTKIEFAK
    GHVEGAINIPVDDLRQRIQELDPGKLIVVY
    CEVGLRGYFAERILTQKGYRVLNLTGGYTTYSVQGFDPNQALDDYKKDFN
    PYPCCADEDIIDPDTQRIKHQ

    >gi|219667566|ref|YP_002458001.1| Rhodanese domain protein [Desulfitobacterium hafniense DCB-2]
    MLKHLKQSKALTLVISLLLVLSLVTGCGSAPASTTPAQPPASQEPAKPETPAQPEQPAATAPTVESNTLGWDDWSAKMKG
    TINKDYYIVDLRTPDEIKLEKALEGSINIDANATLGTGNTDVIDEKLQGVAKDAVVLVH
    CKSGGRAKKNLQAFLDKGYVN
    AFALDGWTAFDAKGYFGATKITASSEQLKPDAWVAKMQGTIGKEYYVLDARDKSEYDAGHIEGALNFGVRDQFTVDHAAT
    IAKVKEAIPNKDALVLVH
    CAVGARAKVAQAHLKAEGYTNVITLDNKITIDASGNYKFE

    >gi|219667869|ref|YP_002458304.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MPIQQLDFDSFEEIIYDEGEPCLVVYSRKSCHVCKEVVPEIEELAPKYKGEFGFYYVDVEEDQALFQRFSLKGVPQILFF
    NDGEYKGKMAGKAEGDQIEEKIAEVMKG

    >gi|219667955|ref|YP_002458390.1| Methyltransferase type 11 [Desulfitobacterium hafniense DCB-2]
    MSYLKITHELYKEAALTPQASLCCISQPSRYLPGLTVPTAMSEMNYGCGTTVHLGELKPQDTILYVGVGGGLEALEFAYF
    TRRAASVIAVDRVPEMLAKARSNFKLAEEANSWFQSAFIDLREGDALDLPVADESVDVAAQNCLFNIFEGEDLNRALLEM
    HRVLKPGGRLYISDPIASQPIPEHLRQNERLRAM
    CLSGALSYEDYLQQISGAGFGTIEIRARRPYRLLDKERYSLTENIL
    LESLELVAYKQPVPEGGARIFAGETIIYFGKERLWDDEGSIVPRDIPHPVCQKTAAYFRRLERTDVVVTAPTYHYGGSGG
    GCCC

    >gi|219667965|ref|YP_002458400.1| alkylhydroperoxidase like protein, AhpD family [Desulfitobacterium hafniense DCB-2]
    MDTYYNSADLAKFATMGEEAPDLWQKFMAYYGSVFEEGALSPREKALIALAVATAVQCPYCIEAYTQSSLEKGANEEQMT
    EAIHVACAIRGGASLVHGVQMKNIVKKIGF

    >gi|219668140|ref|YP_002458575.1| methylated-DNA/protein-cysteine methyltransferase [Desulfitobacterium hafniense DCB-2]
    MIYTCTLSTPLGDITAAAEGEALTGLWFIGQKYYPAQTEAWVTEPEQRVFKSLQTWLDHYFSEREGSAPFPELAPKGTDF
    QKAVWEILLEIPRGRVTTYGEIARKLAASRGLSSMSAQAVGGAVGHNPISILIP
    CHRVVGAGGSLTGYAGGLEKKQALLR
    LEQADLNCRKLF

    >gi|219668159|ref|YP_002458594.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfitobacterium hafniense DCB-2]
    MGHITSKDAYKNLEERINWFTQGAPPSESLYKILQVLYTETEAKWVALLPVRPFTAKKAAKIWQISEGKAEALLENLCQK
    ALLVDSFYNGVRQFVMPPPMAGFIEFALMRTRGDIDQKYLSELYYQYMNVEEDFVKDLFFATETRLGRVYVQEPVLTNNN
    TIHILDYERASHIIEEATHIGLGTCYCRHKMSHTGQSCAIDAPWDVCLTLGNVARSLAEHGQHARLIDKQEAMDVLERSY
    AANLVQMGENVREDPAFICNCCGC
    CCEALQAARKFSPMQPVATTNYLPKIAQECIGCGKCEKVCPVLAISMSTNAEGKKV
    AQVDHEVCLGCGICVRSCPKKVIELVRREVQVITPVNSTHRFVLQAIEKGTLQNLIFDNQAFANHRAMAAVLGVILKLPP
    LKQMLASKQFKSIYLDKLLSK

    >gi|219668301|ref|YP_002458736.1| arsenate reductase and related [Desulfitobacterium hafniense DCB-2]
    MQFICYSRCTTCQKARKWLEEKEHSFEVRDIKGDNPTFAELQTWYKLSGLPLKRFFNTSGQQYKSLNLKDKLPKMTEEEQ
    LKLLATDGMLVKRPLLLGEDFVLTGFKEAEWEERLNKS

    >gi|219668315|ref|YP_002458750.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfitobacterium hafniense DCB-2]
    MNSKTKLILGIIAFVLFLGIAYTAYSSLSENYGPTQEPMTQGQDKPDAQSADPAAQEEKKTEAPNFTVYGTDGTEHRLSD
    FRGKPVVLNFWASW
    CPPCREEMPHFNEVYAQYKDDVAFLMVDLVDGQRETEESGQAFVDKEGYDFPIYLDKNHQAASVYG
    VSTIPTTLFIDGEGYIVTGYRGPLKKSTLETILKDMLKQ

    >gi|219668504|ref|YP_002458939.1| Thioredoxin-disulfide reductase [Desulfitobacterium hafniense DCB-2]
    MSEGFQLKSRYQLAIVGCGPAGMSAALNAKIRNKDFILLGSDFCSPKLAKAPQIDNYLGFHEIKGEDLRQNFLNHVKAMG
    IEVVPWKVLNIYPGPPFTLVGNNESFEADAVILATGVSPTKLLPGETELLGRGVGY
    CATCDGPLYKGKKVAIVSYSHEGE
    AEANFMAEICAEVYYLPFYKEVGQLDSRIIQKKARVKEISGTQKVEKLVLDNEEISVDGVFVLRESLPAEQIVPGLEMDK
    GAIKVNRELETGIPGLFAAGDCSGQPYQLNKAVGEGGTAALSAIKYLDEMKKG

    >gi|219668587|ref|YP_002459022.1| YdfQ [Desulfitobacterium hafniense DCB-2]
    MSIEPLLTIQNNEQLSQLLQEQKTSILYFSSPDCNVCHALLPKVLKVAQVYKIPVGQINTQEFKEGAGQLLVFTVPTLLV
    MCEGREILRESRFIDLQNTARILESVTEEMQVPSSIISLSNI

    >gi|219668673|ref|YP_002459108.1| methionine-R-sulfoxide reductase [Desulfitobacterium hafniense DCB-2]
    MTVDKTNLEIATFAGGCFWCMESVYSPLPGVLEVLSGYTGGHVENPTYNEVCSHTTGHREAIQIKFNPNIVSYKELLAFF
    WRQIDPTDPGGQFHDRGESYQTAIFYHSEEQRRLAEESKQALISSSHFDKPIVTEILPAAPFYPAEDYHQGYHQKNAFRY
    ALYRQGSGRDAFINKHWAKEKEQLKKRLTPLQFHVTQEKGTEPPFQNEFWNNKQEGIYVDVVSGEPLFSSKDKFDSGCGW
    PSFTRPVLKSNIVEKIDLSHNMTRTEVVSRNSESHLGHVFDDGPGPDGLRY
    CINSAALRFIPKEDLEREGYGDLLRLFRD


    >gi|219668961|ref|YP_002459396.1| arsenate reductase and related [Desulfitobacterium hafniense DCB-2]
    MNIQIYGTRKCFDTKKAERYFKERNIKFQFIDLNEKALSKGELQSVKSSVALNELINKEGKDYKALNLDQIRGLEMREEL
    LLTHPKLYRTPIVRNGRKATVGYQPEIWKEWE

    >gi|219669137|ref|YP_002459572.1| Methyltransferase type 11 [Desulfitobacterium hafniense DCB-2]
    MNEVIENVKEYYGKILHSTADLQSKACCCSPDSMPKEVKKALIFIADEVINRYYGCGSPLPPLLEGMTVLDLGCGSGRDV
    YVAAQLVGEHGRVIGVDMTQEQLDVAKKYEDEQRQRFGYAKSNVKFLSGYIEDLRAAGISDSSVDIVISNCVVNLSPDKE
    KVFAEIWRVLKPGGELYFSDVFADRRIPEYLAADPVLRGE
    CIGGALYYEDFRRIMQRVGFTDFRYKSIRNIDLDNEAIIE
    KVGFANFTERTVRAFKLDDLEDICEDYGQIAVYNGSIASSPHFFDLDDHHRFFTGKPLLV
    CGNTAAMLAKTRFASAFRVI
    GNRSTHYGVFGVCGGKSETNCFDTGSSCGC

    >gi|219669166|ref|YP_002459601.1| Methyltransferase type 11 [Desulfitobacterium hafniense DCB-2]
    MKNLYENDLLYRTTGPALRPGGFELTDWAVEHCRFQAGDRILDVGCGRGATVNRLRSHYHLEAYGIDPSATLLTLGQETY
    PDLPLSKGRGEDIPFTNSCFDGVFVECSLSLMTDPDQALSEIRRVLKVKGKLIIHDVYARNPQGTPDLRELNIGT
    CIRNA
    LVKEDLEHGLESKGLRTIHWQDHSPLLNRLMMELIMTHGSMSAFWLKSTDCSADPNRVQAALKKAKVGYFQLIAEKEAEK
    EAEHCPVR

    >gi|219669178|ref|YP_002459613.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfitobacterium hafniense DCB-2]
    MHYVIIGNSAAGVFAAEALRGLDSSGKITMISEENNRPYSRCLTSYYIGEEIDQDRIYIRDANFYAATGIDFIPQKVEQV
    NDTEKSITLQSGEIVGYDKLLIATGASPYSLPVEGLDLEGVCELRTLEDARRIMDFAPHVKEAVVMGAGLVGLKGAHALH
    ELGIKVSIIVNSRIMSRSVDPHTGQIITELLEQDGYEVIYNTKLSKILGQDKVEGVCLSSGKEIPCQLVLMAAGVSPNVD
    LVKNTGIEVNKGIIVDKHMQTTVSHIYAAGDVAEAYHAVWDEKRVISIWPVATAQGTVAGSNMAGVERIYEGSVGSNSAV
    FCGVGVVSAGIPYLPTGEGQELSTYDKATKRYRKFIVKDDILVGMIMVGDIDGAGILTAMIKQKTKVSLDTLNYWLNHPV
    RFQGYCTAEAKGGIVCGIC

    >gi|219669234|ref|YP_002459669.1| HesB/YadR/YfhF-family protein [Desulfitobacterium hafniense DCB-2]
    MVKISELAAQKVKEVQKTQNKEKCYLRLYLAGFGCGGPSFGMTLEDAKTELDVLDEEHGVSVITASSLSEYLEDAFIDFV
    ENEEGSGFEIRLAKDFGGQGCGSSCGGCGGSC

    >gi|219669354|ref|YP_002459789.1| protein of unknown function DUF255 [Desulfitobacterium hafniense DCB-2]
    MTNLNKVPNRLLQEKSPYLLQHAHNPVDWYPWGEEAFAKAKAEDKPIFLSIGYSTCHWCHVMERESFEDEEVAQLINRYF
    VPIKVDREERPDVDHIYMEFCQALTGSGGWPLTLFLTPDERKPFYAGTYFPKESRYGRPGILDLLSQLGELWAKDQPKIR
    GSADSIYKAVTSREEPSVSSLTPALQDDFIPWAKEILDTAFQTLQKSFDRQYGGFGRAPKFPTPHHLTFLLRYAHDHSDG
    LEAQQAALMVRTTLERMGQGGIFDHVGFGFARYSTDRHWLVPHFEKMLYDNALLAIAYLENYQAQHDPHDEQKAREIFSY
    VLRDMTAPEGGFYSAEDADSEGVEGKFYVWTPQEIHEILGSEEGRLYCQAYGVSPEGNFEGKSIPNLLDTDWEALGSERQ
    HSLEVLKRRLEKSREKLFAVRKERIPPHKDDKLLTSWNGLMIAALAKGAQVLGEPAYAEAVEQAVYFIRKNLYANQRLLA
    RYRDGDSAHLGYLDDYAFLIWGLIELYQASGKKEHLEFALQLQREQDELFWDGAKSGYFLTGRDAEELLIRPKEIYDGAT
    PSGNSISALNLIRLARLTGDGELEKRAYEQINAFKATLSTYPSGYSAFLQAIQFALQESREIILAGPLQHPELKNMKTAI
    FKKFHPYTTLLYEEGTLSELIPWLKDYPLDSEKMTAYLCQNYACHKPVHKAEELSALLT

    >gi|219669602|ref|YP_002460037.1| thioredoxin [Desulfitobacterium hafniense DCB-2]
    MAGENVKTFTTANWNEEVLGSDKAVLVDFWAAWCGPCRMVAPIIEELADEMAGRVIIGKLNVDEEPAIAGQYQVMSIPTL
    AVFKNGQVVDKSVGFRGKADLVKMIEKHA

    >gi|219669743|ref|YP_002460178.1| copper ion binding protein [Desulfitobacterium hafniense DCB-2]
    MNQTLKVTGMTCNHCKAHVEKALLKVGGVQQVDVNLEKGEAVVAGSAGREELIKAVEDAGYNAE

    >gi|219669744|ref|YP_002460179.1| heavy metal translocating P-type ATPase [Desulfitobacterium hafniense DCB-2]
    MSKKNTAIKVTGMTCEHCVGRVKKALESLPELENVNVSLENGEASFDWTGEGLSMARVKDVIEEAGYTVIEDQEAQQRVP
    VQAQGMLMKELNVYGMT
    CEHCVRRVKKALENLPEVADVEVSLAESKAAFRHNPAITTEAQIKEAIQEAGYSTEATESIEV
    TEASVPDIQESESPAQESVNEKKQLKITGMT
    CANCALTIEKGMAKLPGVKAATVNFASEKLSLDYDPALLDEKTILEKVK
    DLGYGAYMERDEGKAQFKVSGMT
    CANCALTIEKKLRNTPGIQTVAVNFATESVTAEYDPNLIDLETIYEQVRDAGYTPIE
    NKEESREDNHVKSQRNWVIFSAVLSAPLMPMMFMPMTHGIMYTMFILATIVQFTAGLTFYRGAYHALKNRSTNMDVLVAM
    GITAAYGYSVMTTFPHIFFEGDTFFDTSALLITFVRFGKYLEAKAKGRAGQALKRLLELQADRARLLINGEEKEVPASSV
    KIGDIVLVKPGEKIPVDGVIVEGQASIDESMITGESIPVDKGAGENVIGATINRSGSIKVSTTKTGKDSVLSGIIKMVED
    AQGVKPPIQRLADKISNVFVPVVVAISILTFIIWYVFLDSAFVFAFTAAIAVLVIACPCALGLATPTAIMVGSGVGLNRG
    ILFKSAAVLEGIAKVEAIGFDKTGTLTKGKPEVTHLMAYEGYAQKDLLRIAAAGENPSIHPLAQAIVQRAKDEGIEVEEV
    QDYHEESGHGTLCSYQGKKLLIGNKKLMLKENIPTEAVEKDFQELANEGKTTSFVAYDGKVIGIIALADVLKESTQEAIK
    RLHGLGIKTFMITGDNKKVATVIGNEVGIDEVVAEVLPQDKIEIIKRYQNDGLKVAMVGDGINDAPALAQADIGIAIGSG
    TDVAKETGDVVLVRNDLLDVERAIRLGRKTLTKIKQNLFWALIYNTLGIPIAAGVLFPITGELLPPEWAGLAMAFSSVSV
    VTSSLLLSRYSKELVD

    >gi|219669878|ref|YP_002460313.1| Radical SAM domain protein [Desulfitobacterium hafniense DCB-2]
    MGDARLERLDGIPAFETKFGDQALMDTAERLSVLQINVGKRCNLACKHCHVEAGPNRTEEMSREVMEACLRLLEENPFAT
    VDITGGAPELNPHFRWLVGECAKGCAHVIVRTNLVILLEEGYTDLPEFYRDHRVNVVCSLPHYTAKNTDRMRGEQVFRRS
    IEAMKRLNEVGYGQEPELVLDLVYNPGGAFLPPSQTAMEAEYKEHLLREYGVSFSHLFTITNNPIGRFGAFLERSGNLED
    YMYRLYGAFNASTLESMMCRFQVSVGWDGRLYNCDFNQAADLPMADGATIFDWTGKPMAKQRIRFGKHCYACTAGQGSS
    C
    GGATEGV

    >gi|219669879|ref|YP_002460314.1| alkylhydroperoxidase like protein, AhpD family [Desulfitobacterium hafniense DCB-2]
    MATYYEAKDLEKFATMGECASELWEKFMGYYGAVFAEGNLTAREKSLIALAVATAVQCPYCIDSYTQDCLSKGVTEEQMT
    EAIHVACAIRGGASLVHGVQMKNIVKKLEL

    >gi|219669883|ref|YP_002460318.1| Rhodanese domain protein [Desulfitobacterium hafniense DCB-2]
    MRKLLSLTMCLLLSVSVLAGCTQATPASGGSAAPAADRAEADISWQYKTADETKAMLDAQESVIILDSRPDDMYTKGHIP
    GAYHVPSYPMDTPELEQVLKDAVPNLQGDDPIVIV
    CKSGNKGAKRAISFLQDQGVAPERLFILEGGGDGWKIPEYTTTAN
    DSTIPN

    >gi|219670084|ref|YP_002460519.1| dihydrolipoamide dehydrogenase [Desulfitobacterium hafniense DCB-2]
    MEQYQVGILGGGPGGYVCALRAAQLGLSVVLVEKERLGGTCLNKGCIPTKTLVKSAELWREIKHAEEFGIQLGGALLHYP
    QIAARKKEVVNTLVSGIEQLMKAKKITVLKGWGEVKEANRIEVTTETGKVELHVENLVLATGSIPTKIPVPGVDLPGVVT
    SEELLEQETLPDSLVVIGGGVIGLEFASIYHEFGVKVSVVEMLPSLLPNIDEEIPKRLAPLLKRSGLEILTKAFVREIKP
    KEEGLVVIVEDGKGLKELPAQQVLLATGRRPSLSGIHGDALGLELDRGAIKVNSQMQTSVPKVYALGDVVGGAMLAHVAS
    MQGMVAAEHMAGQQVSMEGRAIPSAIFTYPEIAAVGETEQALKASGQNYKVSKFPFSANGKALALGEIMGLVKLLADEEG
    VVIGASIMGPQASSLIQECVLAVEKKIKAEDLAKIIHAHPTLPEAIMEAAHGISAKPLHLA

    >gi|219670119|ref|YP_002460554.1| UBA/THIF-type NAD/FAD binding protein [Desulfitobacterium hafniense DCB-2]
    MGFSDEQLERYSRHIILKEVGVKGQKKLLQSRVLIIGTGGLGAPAAMFLAAAGVGTIGLVDFDGVELSNLQRQIIHLTKD
    VGKPKVISGRETIGEMNPDVEVVPYQEWVSSGNIQDIIWDRDYDFIIDGTDNFPAKFLINDACVLSGKPFSHAGIIRFQG
    QTMTYVPGQGPCYRCIFKNPPPTDSVPT
    CKQAGVLGVMGGIIGTIQATEAIKYILGLGDLLTGALLTYDALKMEFRRVKL
    PHNKKCQVCGEEPSITELIDYEQAACDLN

    >gi|219670591|ref|YP_002461026.1| selenide, water dikinase [Desulfitobacterium hafniense DCB-2]
    MKSFLSSCTTGGCGAKIGPGELSKVLSGLPVFQDPQLLVGFDASDDAAVYQINEDTAIVSTVDFFTPMVEDPRTFGRIAA
    ANALSDVYAMGGSPLFALNLVCYPEREDIQDLGEILAGGAEKLQEAGAVLCGGHSIYDREPKYGLAVTGRLNPRQIWKNN
    TPQPGDRLILTKPLGVGIVMAALRGEMAEAAAVEAALASMQRLNKYAAEKARDFPIHACTDITGFGLLAHTREMAGGSTT
    IVLYPSALPYIAQAYTYAQGYLLTAAGQRNRNFMEGAVEFGDTPFPLQELMLDPQTSGGLLLSVPGDCAQEALRAIQETE
    PQAALIGEVLPRQDFPILLG

    >gi|219670594|ref|YP_002461029.1| methionine-R-sulfoxide reductase [Desulfitobacterium hafniense DCB-2]
    MKIKVSRIFLSVTMLIFLSIVGTGCSEAAVPAESAKRFPYNPNMGVSYEGKELQEIWIAGGCFWDVDAYLSRIYGVADVT
    VGYANGNTENPTYEDVCYRDSGHAETAYVRYDPERVDLETILEYFFKIIDPTSLNRQGNDVGTQYRTGIYYQNELDREII
    LKVITEEQNKYKKPIVTEVLPLAHFYEAEEYHQDYLVKNPHGYSHIDFSPLEEQKLVNIDPGLYNKPSDDVLRKTLTDLQ
    YAVTQKDATERSFANDYWDHHEQGLYVDVVTGEPLFASKDKFDSGTGWPSFTRPIAPEVIIEKEDSTLGMKRIEVRSRAG
    DSHLGHLFNDGPPEDGGLRY
    CINSAALRFIPLSELKEEGYGQYLSRIE

    >gi|219670616|ref|YP_002461051.1| Rhodanese domain protein [Desulfitobacterium hafniense DCB-2]
    MEQYLGLIVLGVLMGAWMLVRSHRDKKFKISPDEAKRLLDTTKGIILLDVRSEEEYRERHIPKSLLMPLNSLKAQAPKRL
    PDKNKEILVY
    CRSGNRSAAAVRILSKLGYVKVKNIGGIIHWPFATVSGK

    >gi|219670647|ref|YP_002461082.1| methylated-DNA/protein-cysteine methyltransferase [Desulfitobacterium hafniense DCB-2]
    MYYSTTYLSPICTITLACDGDNLIGLWMEGQRFHGGTLPESMIEKDDIPIFDAAKAWLDRYFAGERPATSELPLAPMGGE
    FRQGVWDILCQIPYGQVITYGDIAKQMAEKMNKKCMSSQAIGGAVGHNPISIIIP
    CHRVVGAKGNLTGFGGGISRKIQLL
    EHEGVDMSRMFVPKKGNAL

    >gi|219670684|ref|YP_002461119.1| methylated-DNA/protein-cysteine methyltransferase [Desulfitobacterium hafniense DCB-2]
    MNDFFEQVYAIVGKIPYGKVVSYGEISWMLGRPRSAREVGRAMRFCPEKLPCHRVVRADGSITGDSHAEVRKILLENEGI
    TFLPGGRVDMKTHRWSG

    >gi|219670884|ref|YP_002461319.1| Thioredoxin domain protein [Desulfitobacterium hafniense DCB-2]
    MSLEKLDTNTFEQLIYDEGKACLVMFSRKNCHVCQKVTPVLEELRLNYEESFGFYYVDVEEEKTLFQRFSLKGVPQILYF
    KDGEYKGKMAGDVEDDEVEQMIADVLED