Desulfatibacillum alkenivorans AK 01 uid58913

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218778057|ref|YP_002429375.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MNTPKIVIVGGVAGGASCAARSRRLSEEAEIIMIERGPFVSFANCGLPYHVGEVIKEEEDLLVASPELFRDRFNIDVRIQ
    CEVTKIDRENKTVTIRKMTTGETYDETYDYLVLSPGAAPLRPPLPGIDHPAVFTVRNIPDIRAIKEMTGNGEAKSAVVVG
    GGFIGLEMAENLHHIGMQVSVIEMAEHVMPVLDKEMATMVNEHLDSMRVDLYLGSAVQSFENGPDGKPLVNLASGEQIAA
    DIVIMAIGVRPETGLAKAAGLDLGPRGGIAVDGFMHTNDPNIFAVGDAVEVEGYVMGGKRLIPLAGPANRQGRLVADVIL
    NPDKPKPFRGVQGTAVCGVLGMTVACTGETEKSLGLMAKDGKVIEYEKVYSHPFSNATYYPGAQQISFKLIFAKEDGRVL
    GAQAVGLAGVEKRIDVVAMAIQMGATVYDLEEAELCYAPQYGSAKDPVNMAGMIAANVLKGVSKIVHWPDLENFDGILID
    VRDPEEYATGFAEGAINMPLDSLRKNLDSLPKDKEIWAY
    CYVSQRAYFAERILTQHGYNAKTVSGGILSYWAADADA

    >gi|218778074|ref|YP_002429392.1| Dihydropyrimidine dehydrogenase (NADP(+)) [Desulfatibacillum alkenivorans AK-01]
    MIGAFLFMLGLGGACAILLSVASRVFYVYEDPRIAEVEDRMAGANCGGCGYAGCNAAAVAVVAGKAPASVCIVGGMESAQ
    GVAEVMGMDVGGAEPILSYNPCKGGDRAEDKFIYQGVPTCAALTRLYEGKRFCSVGCLGLGDCVKACLFDAISIGPDGYP
    VVNADNCVGCGACERACPKGVLEVMTMSQRLLAMNETDDALAPCQQICPAQINIPLYIEQIKKGDYEGAVNTIRERNPLL
    LSCGRVCPHPCEDKCRRGVEDEPVSINQLKRFVADYELHSGKRFPISKAPATEKKVAVIGGGPAGLSCAFFLARLGHSVT
    IYEAMPKLGGMIRYGIPEYRLPKKILDWEIQGILDLGIEAKTDARFGFDFNLSDLMEEGFDAVFMGIGAWKDMKLRAEGE
    DMEG
    CFTGIDFLARVANGEKVKIGKNPIIVGGGNTAIDCVRTLIRMGSKVTLAYRRTRAEMPANEVEIVAAEHEGCDFVF
    LAAPTRVVGDENGKVIGLEYQKMELGEPDASGRRRPVPVEGSETILDADMIVSAIGQRPDISFMDNPEKALADLKTTRWD
    TMDHNEDTLQTDIPFIFVGGDSATGPDLVVSAIGGGRKAARSIHQFVMGEEVKAAPKDLKKPLIPESDFKTVPGIIQSPR
    APMPELPVQERIYSFIEVDQVLDEESALRESGRCLRCCRTCYDKDTERKTQKSAA

    >gi|218778087|ref|YP_002429405.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
    MSDNSVIISCSSCGAKNRVPVSRLEDRPVCGKCKTRLPAPSATNRPVDVTDASFQNEVLASPIPVLLDCWAPWCGPCKMV
    APVLDEIAREYAGTIKVAKLNVDNNPATASHFRTQSIPTMILFKNGREVDRLVGAAPKQQIINFVQNQL

    >gi|218778106|ref|YP_002429424.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MSNDVVGSVMVVGGGIAGIQASLDLAQSGYKVYMVEKTASIGGVMAMLDKTFPTNDCSMCIMSPKLVEVGRHPNIELITL
    AEIQGIEGAKGDFTVNIRQAPRYVDTEKCIACGQCAAKCPKKVTDEYNQGLIKRKAIYVPYPQAVPLKFAIDPEQCLKLT
    KDKCGNCEKVCPAGAILYDDKEKILDIHVGSVILAPGFSAFDPKGIDAYAMHQSKNVMTSLEFERILSASGPTGGHLVRP
    SDSKEPLKIAWLQCVGSRDINRCGNSYCSSVCCMYAIKQAIIAKEHAPYELDCSIFYMDMRTHGKGFEDCYNEAREKHGV
    AFKRARVHTIDPNPETGDLDLRYVDEDGNVLNEDYDLVVLSVGLEISDPLRELAGKMGVELTPGGFGQVDSFSPVASNVD
    GIYLCGAFAGPKDIPQSVVEAGSAALMAGSGLTASRDTLTVKTEMPPEVNIKGEPPRVGVFVCQCGINIGGVVDVPAVRD
    YAANLPYVEFSDDNLYSCSQDTQDAMTKLIKEKGLNRIVVAACSPKTHEPLFQETLSAAGLNKYLFEFVNIRNQDSWVHK
    DDPQKATEKAKDLLRMAVAKVALLSPLEESQLNINQHAMVIGGGISGIAAAQALSAQGYETSIVERDSSLGGQARSLFKT
    AKHEDIQEKLGQMIQEVEDDLNITVHLNAELADVTGFVGAFQSTIKNDQGEYVVDHGVTIIATGAYELEPTEYLYGQDPR
    ILTGQELDRKMMENDAVVKNAETAVFIQCVGSREPNRPYCSRLCCTHSVLSALHLKEMNPDMQVYVLYRDIRTYGERENL
    YKEAREKGVIFIRYNVDDKPKVSADDSGLTIEVRDPIAGLPLAIKADLLTLASAVVPYNDERLAQQFKLPLNDQGFFVEA
    HVKLAPSSFATDGVFLCGLAHYPKPIDEAVAQAQAAASAAVTLLSRKSINTSANVAKVDPRFCSSCMVCVSTCPYSAPSM
    VKEGPNAGKAEINPVLCKGCGQCVASCRSGALHLQGFDTDQIMAQIREMCAV

    >gi|218778158|ref|YP_002429476.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MDCNIVIVGGGPAGVITALTAKSVYPEKSVCIIKEIADGVIPCSIPYMIYTLADPAQSILGNKPLEDAGVKIIVDKAESL
    DTAASVLTLASSRTIDYERLVIATGSSPVVPPIPGVELPGVFSITKSLSAISLLREKARAAKRVVILGGGFIGAEFADEL
    TRNPDAEVHIVEILPRLLSQDFDDEFCDAATAELAGTGVQVHTGRRAISIGGEDKVKRVELDDGTSLQADIVIIGVGGRP
    NAELAAKAGLTVTEKGSIWVDSYMRTTVKSVFAVGDCALKRDFFTRKEAPVWLASTATSEARIAGTNLYGIRVLRQIQGT
    VSAFSTKIGGLCLASAGMTRRMCEEEGFRIVTGEAMAPDRHPGFLPGPSPMKVKLIFANRSGALLGGQVSGGPSVGELIN
    VISIGIQMQLNVRQLDMMQIATHPLLTSAPTVHPLINAAHNALAKLRLQK

    >gi|218778614|ref|YP_002429932.1| periplasmic binding protein [Desulfatibacillum alkenivorans AK-01]
    MIFPKKRLIPICLFFLFTLVLSAHAEQSGIGKYSRIISLGPSITESLFAIGCGDLIVGVSDYCIYPPEALEKPRVGGILN
    PNMERYAILRPDLVIFRGKLDKVKDY
    CLSRNIDVMETEMDSIASISETVNILGAKLGQEEKAGEVIENIRKELDEVSREV
    EGLSRPKVFLCVGRTPGGLSSIYTCSKTSFVSQVLKIAGGENVFSDIPTAYPEISKESLIRQAPDIILEMRPAETFSKEQ
    MDRMKEEWALLRTLPAVRNGRIHIMTQDYLLVPGPRVGRAARAIADVIHSNPAGGEK

    >gi|218778802|ref|YP_002430120.1| Methyltransferase type 11 [Desulfatibacillum alkenivorans AK-01]
    MDQVDRSQWFYGILYGVFYDPLEGGHRSMISALIPEGCTVLDVCCGTGRLALDLAPKCEKITGVDMSARMLRFGEFLKKG
    SKASNVEFVHGDATRLEDAVDHTYDYAVISLALHEMPAQDRLATIRSMTRVAKQLIISDHSVPQPKTIPGYLTTLAEL
    CF
    GGRSNFTLYNEFNASGGIVGALEQCGLTPENRMLDDKKIREVVTASGCSG

    >gi|218778933|ref|YP_002430251.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
    MEINETSFGKVTGKGVSLVDFYATWCGPCKAQEPIIKELEKNFSGRAVVTKMDVDQNRDTAAKLGISSIPTVVVFKDGKE
    VERFIGLQNQQTLSAALESALI

    >gi|218778936|ref|YP_002430254.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MKFLVIGGDAAGMSAASRAKRLSPDMEVIVLEKTEDVSYSACGMPYNIGDESRDLEDLVVRKAQAFRDKQGINLLTGHEA
    LELDPCSRAVRGKTLQGEEFEYYYDKLLIATGGSAIIPQVEGMDSPGVLPLKSLEHARKIKSLITNSKVKKAVILGMGYI
    GLEMCEALTERGVEVSMVKPNPMFLPWMDRELADRLQQEVESRGAKLYLGHELQKIEKTASGLKVVCNDVSLDADLLIPA
    IGITPNSEFASKAGLKTSVGNSIAVDKGLKTSDEHIYSAGDCADAYHVVSGQKTWIPLALYANRGGWAVADNVNGKGVEV
    PGVVGSAVFKVFDFEAARTGLNMREAEKAGFEPVSVTIKTRSRAHGHPGNTTLRVHMVGDKKTGRLLGMQMAGRDGCAHR
    INTGAAALHNRMTVADFSRMDLAYAPPFGPVWDPLLTAANQLVKKL

    >gi|218779323|ref|YP_002430641.1| Rhodanese domain protein [Desulfatibacillum alkenivorans AK-01]
    MKPLVYLLTIAALILGAQSGHCLSPEALDAMLKSGDPPTVVDVRPSFHYSKSHIPGAINIPASVCQEKNLPPLGQVVIYG
    DGIVIEWEDE
    CLDSLNAREGISAERLDGGFSRWTALGYAATGPSGLSEESFQYVTYNMLSRAVETNPDVLLVDLREESAR
    KEGGEALADLQELFPKARVVKTGRKSSGLVDNSNARDLLVLIDNGDGKAHEYARHLRAAGMHRFIILAGGEPTLQSKGKP
    VKKTITREIPQ

    >gi|218779416|ref|YP_002430734.1| heterodisulfide reductase, subunit A (HdrA) [Desulfatibacillum alkenivorans AK-01]
    MTTDTAARASGSILVVGGGISGLTTTLEAAEVGYEVFLVEKNPYLGGRVSQLNQYFPKLCPPTCGLEINFRRIKDNPSIK
    TFTLAEVVKVSGGPGDYDVEIKLNPRYVNENCTCCGECEKACQIEVDNDFNFGMDKTKGAFLPHEMAMPARYVISPKIIG
    TEDAKRCLEACKYDAVDLEMEPRTINLKVGAIVWATGWEPYDATKIDNLGFGQYDNIITNMMLERLAAPNGPTKGQIVRP
    SDNTAPESVAFVQCAGSRDENHLPYCSYICCMASLKHACYIREQYPDAKIYIFYIDLRAPGDRYEKFYKKVKEDENVFFI
    KGKVAEVSADASGDITVTAENAVTGEKVSQTVNMAVLATGMQPSAALNKLPADLKYTDDGFIINDYAAGGMFACGCAAQP
    ADVVSSNQNATGMALKAIQTLVKR

    >gi|218779472|ref|YP_002430790.1| methyl-viologen-reducing hydrogenase delta subunit [Desulfatibacillum alkenivorans AK-01]
    MEAHRFVAPAQPGQEVRIGVYVCKCGANIGKVVDCRKVADSVANMDGVVVAKDVGYACSEPGQQQIKDDIKDLNLDRIVV
    ASCSPRLHEPTFRQMLVSAGLNPYLLEMANLREQCSWVHMHEPEAATDKAIDLVKMSISRVSLLAPLQEETIPLTKKTLV
    LGGGVAGIQAALDLADNGFDVVLVEKQPSIGGVMAQLDKTFPTMDCSI
    CILGPKMTDAGRHPRITLYTMSEVTDVKGYVG
    NFEVNILKKARYVVEGECTACGECAKVCPVVRPDEFNLGLSSRKAIYSPFPQAVPSSYVININECLGDNPSVCAKCVQAC
    EKNCINFHMSDEQIMEKVGSIVVATGLSPYDPTEHDEYGYTRFQNVLTSLEFERLINAGGPSQGEVVRPTDRKTPKSVGF
    IQCVGSRSARKGAAYCSNICCMNTVKSTLMLKEHYPDIDVKVFYIDIRAFGKGFEDLYLRSRRLGTNYVRGLPGSVEENP
    DGGLSVAVENTVTGKLEIHDLDMLVLAVGLEPAPSTQRLQEMLGLQLTPDGFFLEAHPKLQPVDAATRGVFYAGCAEGPK
    DIKESVTQASAAAARAIRIMHKGEITTEPITSEVITEHCKACGKCAEVCPYNAISVDPKKKIPAVVNTAACAGCGTCGAE
    CPFGAITMNHYTDAQITNQVDTMLAEDPKAKILVFACNW
    CSYAGADYAGVSRLQYPANVRLIRTMCSGRVDEEFVWRGFE
    LGAPAVLVSG
    CHIGDCHYIDANHWTEKRVNKMWKKMEKMGIRKERLQLEWISAAEGIRFAQVMQRMEDLRDSVTQEEIYE
    TVEALKKRKKKKSH

    >gi|218779474|ref|YP_002430792.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MKRAKDRLHRVVVLGATPSGIAAANKLGELGVPVTLVDSEPDLHEKLSQDKWRLDSGMAFSYAHRSGLMRIMRNQSIKCI
    LPGEVTGIKHTAQGFAVKINTLPQYVDPERCTLCGKCVEACPVTSADGCRPIVFSGNRNLPGRPIIDKRQRPLCQDSCPL
    GVNAQGYVALAGAGRFSKALDLIRRDNVLPGICGRVCTHPCEDACRRGDVDGAVAIRDIKRFVADKGSDAAPQVAGKKDK
    KIAVIGSGPAGIAAAADFARQGVAVTVFEKEKEVGGLLRYGIGPHRLPRSILDKDLEYVKALGVEFVTGKEIDFSKDLED
    LTHQYDAVLITTGSWKDRKLGAKGEDCQGVTG
    CLDFLNDLYRNDAPAIKKGEKLAVIGDGNSAFDAARAARRLGADVTIV
    SWFAKDAIPADAEEVQGALAEGIGIVDEVRVVEFVQDNGKIKSLLCKPTEPGPADANGICWPVLKKDGEARELAFDKVIV
    AIGQVGPFPEGAKIALETTDYGFIKIYEAGQTSMPGVYAAGDAVNGPTTVVRSMASGRSTADAICENLLGYSFIAKSGRP
    VDKDFCAIPANMAHVKRCVMPEADAKDRIGSFVEVAQGLTETQVLNEAGRCLQCGVCSECLECMDACGPVIHAIRHDAVA
    KEDAEHAGVLIIADPDMAPGVRGEDVIRAYGPPSAKTNVYNMITRGFAAAGKAMAFLARTSQRPKGYGVPFAAPDPGLSP
    SVRTGVFVCRCNGSMGWDEQMDAYVESLTQRPDVVYAEILESACIPEGSEHIVRTVREKGISRVVLASCVCCPLDFVCTA
    CTDQRSRLKDALFKGTGISRSMVETCNLRGEVLPLLARGGDIAVEAFKGLLERSLKRAANLKPLPTPLRNYNFTTAVVGQ
    SESAINSALTLAEAGLEVLLMGGPSKPLEKIQDHPNIHSFAGSSVKAISGNLGNFRVLVQTGDGGTQALNVGSVILGQQA
    LRQTPYLAQEGMQGRPAVATMQKKGESGVPFLFPGATSIAGLFTSSPPGIHVSDRKKGAATAVLAASVMPRGPRQNKGYT
    SCVDADRCRGCGSCVAVCPYQAIGLKQNTVGGWYAFVDEALCKGCGNCISVCPNNAADSPYRNQKYLEQMLEEVL

    >gi|218779829|ref|YP_002431147.1| UBA/THIF-type NAD/FAD binding protein [Desulfatibacillum alkenivorans AK-01]
    MAELSRALFNASYQGSHPRTDPRRLIKDREIGRIAEEFGISRNEAEIAALEAEIAPARYVRNMAALDCKDQIRLLKSRAA
    IIGLGGLGGYVAQTLARSGVGSLVLVDGDVFEQTNLNRQAFSTIRTLGENKAEAALEKIRKMNPSVNLEWEGVFLDKDNA
    GPILKGADVIMDCLGGLDNRVLLQQAARDMEIPLISAALAGFTGHVTVVFPGDQGLFPLIGREDDSSGEGVETDLG
    CPCP
    PVMLAASIQCSEAVKVLTRKGQALQNKLLAFDLLDNTFQVFDLS

    >gi|218779877|ref|YP_002431195.1| Redoxin domain protein [Desulfatibacillum alkenivorans AK-01]
    MAQFTLQGNPFETVGELPGIGTTAPGFTLTKVDLSDLSLDEFKGKNVLLNIFPSIDTGVCAMSVRKFNAEASSLDNTVVL
    CVSMDLPFALGRFCGAEGLDDVVPVSAFRAGGFGDDYGIKIANGPLAGLFARSVVIIDTEGKVKYTQLVPETGEEPDYDA
    ALAALK

    >gi|218780047|ref|YP_002431365.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfatibacillum alkenivorans AK-01]
    MADDIIPQAGDKAPDFCLKDGNENEVCLKDFAGKWTVLYFYPRDNTSGCTTEALEFTALLPEFEKNNAAVIGVSKDSTAS
    HKKFTDKHSLGVTLLSDPDKEVLEKYGAWRLKKMYGKESMGVVRSTFLIDPKGKIHTAWGRVGKAAGHAQKVLDVLVKAV
    G

    >gi|218780189|ref|YP_002431507.1| beta-lactamase domain protein [Desulfatibacillum alkenivorans AK-01]
    MYFKQFVAEGLGCLSYLIGCPMARVACVVDPRRDMQVYLDVARENDMRITHVFETHVHADHVSGNQEIKSRTGAEICYME
    DTPVKFEHTVLTEGQEMTFGNAKLKFIKTPGHTPHAMSILVTDLSRGEDPWLVLTGDCMFVGDVGRPDLAGNEHIDEQVQ
    NLYNSLYNKLGMMPDSLEVFPAHGEGSLCGRGMSSKSSSTIGFEKRSNELLRMAEPDFKKEMSGTFPERPKSFSHIINTN
    MEGVPLLDRCPVVKDLSPAQVEHFMQQGALVLDARDTASFGGVHIPGSINIGLKKQTANWIGMVIDPKADLILVVPDEKA
    YHDMEIQLHRIGYDRIIGYLYGGITAWQEEGLPITQLWQISPEKLKNKLAKGQPKYFFDVRTPAEWASGHIQYADHLPIT
    QLLKSPPDIPKDEEVIVT
    CAVGYRGNIAASFLQSQGFEHVHSLAGGMKAWINSGYPVT

    >gi|218780248|ref|YP_002431566.1| thioredoxin reductase [Desulfatibacillum alkenivorans AK-01]
    MSDSHYDCLIIGGGPGGLTAGIYAARAGMKVLLLEKASVGGQILVTDFIENYPGFPKGLTGWELVEAMKAQAENFGVPIE
    SREVVSVDFTGDLKKVSLSDGAALTATTVILATGASPKKLGVPGEKQFMGKGIST
    CATCDAPFYRNKAVAAVGGGDTAVQ
    ESLYLTKFVDKVYLIHRRDQLRATKILQDRVFANDKVEILWDSIVTKVDGLFGLDKVLVENVKTGETRELAVEGCFIWVG
    ILPNTDFLSGAVEVDDGGFIVTDARMQTSVPGVFAVGDVRNTPLRQVATAVGDAAIAAVSAEHYVEQVKS

    >gi|218780249|ref|YP_002431567.1| thioredoxin [Desulfatibacillum alkenivorans AK-01]
    MAEGILEVNDSSFDSDVMQSDKPVLVDFWAPWCGPCRAIAPVVEELAAQMGDKVAFAKCNVDDNPATPSKFGIRAIPTLI
    VFKGGEVVEQITGNVPRAKIEEALNKAL

    >gi|218780528|ref|YP_002431846.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfatibacillum alkenivorans AK-01]
    MDSGEILQVGRPAPFVRALNQSGKAMSFRDLLGEKQHVVLCFCRGHWCPAGVARLGEINGCVEDLRGLEASVYAVSTDSM
    EQSAAMHREMGLKFNILSDPDCNMVKAWGLFNPYESGGVAKPALAVLDKNGVVRYLAFDGVVCHVPFSKVKEFLKQRLAE
    GAHQGMDAPSSLAKIKASTVIQTGRNVLQRGSRANWKHYVLAPLEVGMLLHDSVYGAQRVFLSREYPAPPEEVFPHFSTP
    ELMNRFLDAVLTRIKASPTDEDNPNGVGSVRKVKIGPSTLEETITRLEPPYLCQYVISKGSPLKDYTGTILVSRTQTGSR
    VVWTMTFKARAPYTGRLIAKAMEAGFSKGLKTLSGQLN

    >gi|218780620|ref|YP_002431938.1| 4Fe-4S ferredoxin, iron-sulfur binding [Desulfatibacillum alkenivorans AK-01]
    MTDKPKKALVIGGGIAGLTAAWELAQSQVDVELVEKSPFLGGHSISYCCKATDECVKCGACSVDKMLAQVVSEPRINVTL
    GAAVAKVDKGGKFTASLDVAPAYIDAEKCDNCGECFQEFRNTGAVVRGYSKNNTPLYAICADAAKDVDAAKLAGVCPKGA
    INLDAKATKKKINADTVVVATGFTPFDATKKPTYGYGVRDNVITGMELEALIRQKGQVVRPSDLNPPAKTAFIQCVGSRD
    ARLGNLWCSQVCCAYGLRMARKIKYANPEAEVKVFYMDIQSIGKNFPAFYTQCKEELGFVRNIPVDVYPEEEGRMRLSYA
    DEDTGERKDEIFDLLVLSIGITPGEDNAQVAELFSLDQDQDGFLVEKGEGVFLAGTAAGPKNIPASMAQAGFAASEALKY
    IGVTK

    >gi|218780669|ref|YP_002431987.1| protein of unknown function DUF255 [Desulfatibacillum alkenivorans AK-01]
    MDSQAKRTHAYFPTPEEMRTLPPDGGANYNRLIFEKSPYLLQHAANPVDWRPWGDEAFEQAKKEDKPVFLSIGYSTCHWC
    HVMERESFEDPEAAALLNRHFICIKVDREERPDIDHVYMSVTQAMTGAGGWPMSVFLTPDKEPFYAGTYFPKEDHMGRPG
    LMRLATLLGELWKNERSKALNAAQQVVQALSQAQPKKGREELGPHTLGKAFAGLKASYDVQQGGFGRGNKFPTPHNLTFL
    LRYWKRTGDAEALAMVEKTLTAMRMGGIYDHVGFGIHRYATDPNWLLPHFEKMLYDQALTANALLEAYQATGKEEYATNA
    REIFTYVLRDMTSPEGGFYSAEDADSEGEEGKFYVWTTKEITEILGKEDGALFISAFNLVKGGNFFDQATGQKTGDSIPH
    LQKDPGRLAADLGMEKAELESRLEKIRAALFAEREKRIHPYKDDKILTDWNGLMIAALAKGGRILGDEKYTLAAVRAADF
    ILDALQDGEGHLQKRFREGEAALPGLLDDYAFMVWGLLELYESTFGVKWLKKAVTLNETMLDLFWDRKNGGLFMSPVYGE
    KLFMRGKDLHDGAQPSGNSVAAVNLLRLAGITANEECREKAEAILQAFSGQIEAQPYVYTHLLGALDFIIGPALEIVICG
    DQGARDSTVMLDGVNQRFVPNKVLVFRPNTEDCKELDELAPYTREQACVQGKATAYVCQGYTCQRPTTDPEALFRILS

    >gi|218780763|ref|YP_002432081.1| glutaredoxin [Desulfatibacillum alkenivorans AK-01]
    MADIMLYTLSTCGHCKRTKALLKECDVEYKSTDVDLLEGEEREETIAEVKKCNPRLSFPTLVIGDTVIVGFKENEIREAL
    GK

    >gi|218780841|ref|YP_002432159.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Desulfatibacillum alkenivorans AK-01]
    MADYDIGIIGGGAGGLTAASGAAQLGAKTLLVEKEPLLGGDCLHFGCVPSKTLIKSAKVYHYMKIAQDFGLPAVDLPPVD
    FSQIAARIAGVIQTIQRHDSEERFCSLGAKVLFGEPFFSDEHTIDLDGKKITADHWVIATGSSAMIPPIPGLDQ
    CPHLTN
    RDIFSLQELPESMIVLGGGPIGIEMSQAFARLGCQVTVVERNTQILGPEDADMAAIVREVLEKEGVAFRLGCTAQEVKDL
    GSGRQLVIQTEGGRSETIEAKEILVALGRKANVEGLNLDALAIKHSPRGMPVDKRCRTKHKHIYAVGDCNGGLQFTHVAG
    YEGGIALSNAILHLPRKADYTWVPWCTYTDPEIGSIGMNEKRARAAGIEPKVIIEEFSGNDRALAEGQSKGCFKLVLDEK
    EKPIGVQVVGPEAGNIINQWVGIMNGKVKLSTVAGAIHPYPTLAEISKRAAGNVFAPKLYSEKVKKTLKFFFNLKGRACS
    LDSLDE

    >gi|218780843|ref|YP_002432161.1| heavy metal translocating P-type ATPase [Desulfatibacillum alkenivorans AK-01]
    MKPTRITLPVTGMTCANCAMNIERGIKKLPGVAEASVNFANEEASFDLDASQTKPQDVINKIESLGFGVPTAKIELPITG
    MT
    CANCAANLERSLNKKVPGVVSASVNFASERASVEYVQALTNLDKIVEAVSKAGFEAIRPQEGEEPMDVEAAAREAEIK
    DQTRKFWVGVVFALPLFIISMSRDFGLIGAWSHQPWVNWFFLALATPVQFYTGWDYYVGGIKSLKNKSANMDVLVAMGSS
    TAYIYSLALLFFPVLGQHVYFETSAVIITLIKLGKLLEARSKGKTGAAIKELMSLTPDTAVIVDGDEEREVPVSQVKVGD
    IVLVRPGARLPVDGKVVWGDSAVDESMLTGEPLPLDKTDGDSVAGGTVNGQGLLKIEATRVGSETALAHIIRMVREAQGS
    KAPIQALADRVAAVFVPAVIGLAVLTFVLWWTIGGEFVPAMIRFVAVLVIACPCALGLATPTAIMAGTGRGAKHGILFKD
    STALQMATDLDVVVLDKTGTITMGKPVVSDVAAFGGLDQEKVLQLAASVESGSEHPLGRAIVEHAKEQGSKLLALAGFEA
    HGGNGVSADIEGANIIVGKPAWTAAQGVDLQDAQAGIGRLANEGKTVMVVARDKALIGLVAVSDALKPESAEAIKQLHSQ
    GLEVIMLTGDNPQTAKAIASQIGVDNIFAEVLPEQKGDKVKELQGQGKIVAMVGDGINDAPALAIADLGIALGTGTDVAM
    ETADVVLASGKLTGVVSAIGLGRATMRTIKQNLVWAFGYNVVLIPLAAGALAGFAFLPEFLRHLHPILAALAMAMSSISV
    VTNSLTLYRAKA

    >gi|218780855|ref|YP_002432173.1| DSBA oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MPESSQVLEVFSDYTCPFCYFNMENAEKLAKEFNIPIRWRYYPLHSDVPDEGIALTELLDVPLSEVEKWDREFSKTAAHL
    GLPFCSLDKTYNSRLAQELGLWAADQGKGHAFHKAAFEAFFGQGLNLASKDVLLNIAEKAGLPLDEAEKIITDRTYQEAV
    DKEWEAAEAKAITAVPTMIFGENRLIGAKSWEQMTALVEAGLTGQ

    >gi|218780904|ref|YP_002432222.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MLTEGDVTMEGQTVIGSTLVVGGGVAGVKAALDLADSGYYVYLLEKEPAIGGIMSQLDKTFPTIDCSMCILAPYLVETAR
    HPNIELVTYSQIEKVEGKEGAFRVSVKNKARSIKLEDCTGCRACVDACPVENIVN

    >gi|218781106|ref|YP_002432424.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MTGSRPDKKEATGSVMVVGAGIAGMQSALDLANSGYYVYLVEKSSAIGGLMARLDKTFPTNDCTMCVISPKLVEVGRHLN
    IELITGAELQELEGESGNFTAKVHQRARFIDLDKCTSCGECAKACPISLPDEFNESLMDRKAAFKRYAQAIPGAYAITKM
    GTAPCKATCPAHVSIQGYIALINAGKYEEALKLFKQEHPFPGVCGRVCHHPCEGECTRGGTDQALAIQYLHRFLADHDFE
    LKDRYVPQVEEARDEKVAIVGAGPAGLTTAYFLAQRGYKVTIYEKLPVVGGMMAVGIPEYRLPREVIAAEVKTVTDMGVE
    IKTGVSFGTDVTLDSLKADGFQAVFLATGLHGGRALNIPGEDADGIIQGVDFLRDTALGKDVELGKRVVVIGGGNVAIDV
    ALVAKRLGAESVRQVCLESREEMPAWDYEVQEALESEIDIVNCFGPKEFKVENGRVTGLEFMACTCVFDEQGRFNPQYDS
    EDCTAMGADTIIVAIGQSADLSYTDGQAISVTPRGGLEADPATLQTPLDWVFSGGDAFYGPKSVVDAVASGKKAAESIHR
    FINGLDMLEGREEDWDFYKPEVIDEPLKERVEMTCLLPEARSGNFDEVHCGYNEQEALEEAQRCLKCGVCSECYQCVEAC
    LAGAVQHDEKDKDLEIQVGSVILAPGSEPFDPTPFREFYQYGINPNVMTSLEFERILSASGPTMGHLARPSDHKEPKKIA
    WLQCVGSRDNNRCGNTYCSSVCCMYACKDAMIAKEHSEEDLDCAIFYMDMRTYGKDYEQYLNRARDKEGVRFIKARVHTI
    EDLKDSRDLEIRYADENGDVQQEVFDMVVLSVGLQVQKDVGELAERLGVEVDKHNFAVTTPFAPVATTREGVFACGVFQG
    PKDIPTSVTEASAAACAAGTALAESRDTLTKSVEMPAEKDISQEEPRIGVFVCKCGINIAGIVDVPAVQEYAATLPHVVY
    AGDNLFTCSQDAQDSMKDLIEEHNINRVVVASCTPKTHEPIFMDTLQKAGLNKYLFEMANIRNQNSWCHSNSPEQATAKA
    KDLVRMSVARAATLDPLEEKKLSVNRRCLVVGGGVAGMTAALALGDQGFEVVLLEKEAQLGGMALKLTKTIEGVTIADSL
    EPLVEKVLDHEKVQVLTDSLVVGFSGFKGNFTTEVLVGPGMYERKIDHGAVILATGAKEYQPKEFLYGEDDRVMTQVELA
    RLLADSPDAAMDMGVVAMIQCVGSRNEENPNCSRICCQSAVKNALHIKKSNPDAEVYVFYRDIRTYGTMEEYFQEARRLG
    VMFFRFHQDEPPLVEASEEGVLITFRDLVLGKRLQLAADNLILSAGMVPEETEELSTIMKAARNADGYFMEAHVKLRPVD
    MTTEGIFVCGTAHSPKLLSESVAQALAAASRATTFLSQDSLTLSAVKAVVDQDKCASCLICVRSCPFGVPRIDETGKSII
    DPALCQGCGVCASECPAKAIRLNWYEDEQILSKVEALLEGVL

    >gi|218781302|ref|YP_002432620.1| hypothetical protein Dalk_3464 [Desulfatibacillum alkenivorans AK-01]
    MKPVKIAILALALCLTIVASGWCEPSINWISLKEAQSSLKNSRKTADESAKGGDESSEAVDENAKDESEIAKVEDNDAKD
    EEVSSEEVVASAKGGDESSKAADENAKDENEIAKVEDNDAKDEEVSSEEVDESAKGDDESSEAVGKNAKDENEIAKVEGA
    DAKDKDVSSEEADESGEVADDGDKIVYLYFYTDW
    CTYCKQMESNTFKNPEVIKYLNDNFLPVRLNPEKSAEARKTALNFY
    VRSFPSSAFSTDGVAPIDTKHGLTVVPGAMPPEMFLTILEYLKTRSYEKMALHEFVNSKNK

    >gi|218781505|ref|YP_002432823.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Desulfatibacillum alkenivorans AK-01]
    MGDIAGDFTLPDQNGAAVTLSQVLETHNGAVIAFYPKDDSKNCTPEFVEFQQNIGQFESRGVKVLGISKDSVASHQKFIK
    KHDLKNLTLLSDAEAKVIKAYAAKHSVLPVASRVYIVVDKGRKIVFRKNSGLGLMENQTETLLKAIDEFIP

    >gi|218781536|ref|YP_002432854.1| protein of unknown function DUF1573 [Desulfatibacillum alkenivorans AK-01]
    MKAAGLFTKTIVCAAMVFFLCGAPLLAAEEGVDVPQEAPAITFASTEYKFESVLEGDLITHQYIFKNTGTQNLEIKQVKV
    G
    CGCTATSFTRSTSPGGEGKVEIRVNTKGYAGRTLHKTMRVITNDPKNPEVVLKVSGPVAAFADIKPATISLRGDAGEPI
    SGQAVIKSLDKYPFDIVRTTATANARFTYELEKMDKEGETGWILKVTDPDPQGRYTGTVYLHTDNKIRPQLEVRVYGNFF
    KKKLSQAQSPAPPPKN

    >gi|218781537|ref|YP_002432855.1| protein of unknown function DUF1573 [Desulfatibacillum alkenivorans AK-01]
    MEVNRVFFRIGVFVALLTLVCIHPASAADAPRPAADGPAIAFDATSFDFEKALDNDLVTHNFFFTNTGSSVLEINQVKVT
    CGCTTTSYTRRTAPGEKGSVEIRVNTRGYGGSTMRKVVYVMSNAPANPKVALRISGKVIRFAKISPLSVSLNKESIQDSG
    AVGSVKIVPIEEYPFKITDLSASKNARFSYKLEDYAHGSRKGWILTVTDPKPQGRYMGSVYVHTDSPVRPKLEVRVYGNF
    TDKKPSVIKRMEPKEQT

    >gi|218781704|ref|YP_002433022.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MKSYDVVVIGSGTAGQTAAYALEEQGFIVAVIEKSPTPGGTCALYGCQAKKWFYETAEAVSKAKHLQGLGITQPPEWSWE
    DVLAQKNAFTSKIPDNAVNGLQGVDIDFIPGEARFQDKETLVVNGGTVHAKWFIIASGAEPMPLPIDGAENMITSTGFLG
    LKELPEKILFVGGGFISFECAHFCAGLGPKDGTVTILEAGPRPLGPFDSEMVELLTEASRDAGIDIRTGVKITSIVKQGD
    GFKVLTENQGDFQADLVVHGAGRTPDISGLDLEKAGVEFERRGIKVDASMRTSNPRIFAVGDCAATIQLARVADKEAAVC
    ADNIIADRKGAGKAQAMVYDNVPFLLFTYPQYGMVGKTEDALKKEGLKYYKSFGKHVGWPTYRRVGMKHAAYKILVDENN
    MILGAHILSDNASGLLNLLRTAMMHGVSAGDLHAESLMTPYPSRESDVVYMLKPLIE

    >gi|218781734|ref|YP_002433052.1| OsmC family protein [Desulfatibacillum alkenivorans AK-01]
    MQEDSQEMTVEVIQVETLVRPGENRRIIAQGRGHEIVMDMKKEMMGDDSGPTPPELLAMALGGCMVNIARIMMEQKGVKL
    NGLQVGVSGPIDPSKAMGLESSNPTGFVGLAIHVKLDADLPEVERQSFEQELCKR
    CALCDTIANPAPLDIQFGWNS

    >gi|218781849|ref|YP_002433167.1| Rhodanese domain protein [Desulfatibacillum alkenivorans AK-01]
    MTKTLKVVLAIALVGLLAASPAWAFKNKFEKEVDAEAQAVKLVREVQRGGYDLVTTDELKKWMDEGKDMVIIDTMPYEGS
    YVKNHVPGAVQFLFPIPDMNEWDVKETDGKTQADFAALLGPDKDKTIVIYCGFVK
    CTRSHNGAAWAEKMGYKNVYRYSGG
    IFAWKGADYEVGKVEK

    >gi|218781867|ref|YP_002433185.1| hypothetical protein Dalk_4032 [Desulfatibacillum alkenivorans AK-01]
    MSYFQVDEGALKAMHEFLSEQGLDPWVRVEIQFTGCCDATLGLAADKAREGDFSEEHGGVTMVMDPDVYKTVGAVSVAHA
    DEANRQGFVVKSERPLNEWAGFAPVGIVVR

    >gi|218782065|ref|YP_002433383.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Desulfatibacillum alkenivorans AK-01]
    MGQKVLIIGAVALGPKVACRLRRLDPSAHVTLIDRDNLISYGGCGIPYYVGGDVADLEGLYSTSSHAIRDDRFFETVKGV
    NVLSQTEVTDIDRKGKTVSVRNRATGEEKTLEYDKLVLATGANPVVPPIPGADLPGVSVVANLHNAKEIKEKISKGQVES
    AVVIGGGAIGVEMAEALADLWGVETTLVEMMEHLLPTAIGPDMGLIVKNHMEEHDVRILLGESVTQIVGTPETGVEGVKT
    NKRDIPCQLVVLAVGVRPNAVLAAKAGLAIGPHGGILVDNTLRTSDPNIFAGGDCIELTHFISGQKVPMAFGSLANREGR
    VIGTNIAGGNAQFKGSVGAFCLKAFEMGVASAGLTVAQAKDAGFDPVHAVVVQADRAHFYPTNQLMYMKLIADKTTRKVL
    GVEAVGHNGDAVKARVDAVSAVLPFGPDVSDITALEVTYAPPFASAMDIVNNAGNALDNILKGKNKPIDVADFLKLFDEA
    KAHVLDVRGKPESQPFVERFGDRWVNIPQDQLAARISEINGNGNGSGQLCLICDTGPRSYEAQCLLASHGITDTVNIQGG
    YGMLKKSAPDFNNPA

    >gi|218782066|ref|YP_002433384.1| DsrE family protein [Desulfatibacillum alkenivorans AK-01]
    MTNKVLIALSCGTNNTNRSTRGFHLATVAHKEGKEVTMFLLDEAVYLAKEGLIEHVRAATGDVADDLLTYLQAHEVPILV
    CTPCAKARRIAEEDLIEGAKMAPATELIRLSCESAVISL

    >gi|218782186|ref|YP_002433504.1| electron transport complex RsxE subunit [Desulfatibacillum alkenivorans AK-01]
    MAKTLTQEFTKGLWQEIPPFRLVLGLCPTLGVTTTVQNGVGMGLATTFVLVCANLLVSALRKVIPPKVRIACFIVVIATF
    VTLVEMLMQAFTYPLYGMLGIFIPLIVVN
    CIVLGRAEAFAYKNPILPSLADGLGIGLGFTMALGALGAVREVIGTGCFTV
    PFGPTLTILSADWYTPFSFMVQAPGAFIGLGLMLCLMNLVPSK

    >gi|218782187|ref|YP_002433505.1| electron transport complex, RnfABCDGE type, A subunit [Desulfatibacillum alkenivorans AK-01]
    MEDIIVLIISCIFVNNILLAQFLGNCPFLGTSKKLETALGMAMAVIFVLVMAGAITWIVQYFVLEKFNLQYLQTIAFILV
    IASLVQFVEMFLKKSIPGLYAGLGIFLPLITTN
    CAVFGVCIINMKEGYGFLETLVSSFAYAAGFGLALVLFAGVRERIIL
    ARVPKPLQDTSIGLIAAGVLALAFMGFKGMV

    >gi|218782207|ref|YP_002433525.1| methylated-DNA/protein-cysteine methyltransferase [Desulfatibacillum alkenivorans AK-01]
    MKNKDAVFFMEVETSHGIAGFVYQNAPFALLKTYLPKPQKAQLPKEVHAMKVESSPAREARELAQKIQDYFTGSPLDPHL
    DILDFEGLTELQIKVLHTVAAIPYGQVCSYGEVARRAGCPRAARFVGSVMAGNPFPMFVP
    CHRVVRSDGKLGGFGGGLPL
    KETMLAVESGKHLAGKQGV

    >gi|218782529|ref|YP_002433847.1| Thioredoxin domain protein [Desulfatibacillum alkenivorans AK-01]
    MKRYIAILALAALVALAACTEKADVGPLSIDFVHDYQKGLSMAKEQGKPIMLVFEADWCGACQELKSTVFTDKSVGEASK
    RLINISVNVDKDKESPNQYQVRYIPAVFFLDPSGANVMPYQGPRTPEHFIKMMNAFGDRFSS

    >gi|218782530|ref|YP_002433848.1| methionine-R-sulfoxide reductase [Desulfatibacillum alkenivorans AK-01]
    MNTLMTIILAGAMLLAFGAGGAAARENLQKATFAGGCFWCMEKPFEQIEGVEAVISGYTGGDVTNPTYEQVSSGATGHLE
    SVEIHFDPDKVSYDQLLEVFWRQVNPTDEGGQFVDRGEQYGTAIFYHSEEQRLAAERSRKALDESGRYDKPVITPIREAG
    EFYPAEDYHQDYYKRNPFRYKIYRSNSGRDKYLEKVWDKDAAPPENKTSGKYSKPGDGVLKKRLTPLQYKVTQKEGTEPP
    FKNEYWDNKKPGIYVDIVSGEPLFSSAEKYNSGTGWPSYYKPLEAENIVEVQDKSLFMTRTEVRSKYGDSHLGHVFDDGP
    PPTGLRY
    CINSAALRFIPVTDLKKEGYGEYLKHFGVSEE

    >gi|218782557|ref|YP_002433875.1| Rhodanese domain protein [Desulfatibacillum alkenivorans AK-01]
    MEQVLKKLTLEFFGKGKHKITPQKFFEMENAFLLDVRSKEEADSIPIAMKAHPNIEAKNIPVHEIPDRLDEAPKNKPIGV
    F
    CPANVRSAIAYAYLLSKGFSDVRIIEGGYSDLTDALKPGPLLKSLQGGK

    >gi|218782559|ref|YP_002433877.1| Thioredoxin domain protein [Desulfatibacillum alkenivorans AK-01]
    MKRLVFVNLLFLFMLLLQNPAASQDAAEEPVPQVPTPGMVTMLDLGAHKCIPCKMMAPVIQELQKEYQGRASVIFIDVWQ
    NREEGAKYNLRAIPTQIFYDKTGKEVSRHVGYMDKNSIVAIFDKLGVPKTKASDNAQ

    >gi|218782560|ref|YP_002433878.1| redox-active disulfide protein 2 [Desulfatibacillum alkenivorans AK-01]
    MDIKVLGPGCKKCEQTAKIVKEALAEAGVEANVEKVTDMMEIAGYGVMATPSVVVDGQMKIAGKVPKKKDVLSWLK

    >gi|218782788|ref|YP_002434106.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MEKTTPAGSVLVVGGGIAGIQATLDLADSGYRVHLVEKSAGIGGRMAQLDKTFPTNDCAMCIISPKLVECGRHLNVNLMT
    LSQVLSVAGNAGNYTVKVQRSPRYVDMDKCIACGLCAEKCPRPVADEFNEGVNNRKAIYIKYGQSVPLKYAIDPNACIYL
    TRGKCRACEKFCPTGAINFEDKAEIVELKVGAVVLAPGYQPYDPSGEDYYGYDSIADVVTSLEYERLLSASGPCMGHLMR
    PSDNREPKRIAWLQCVGSRNTNRCSNGYCSSVCCMYAVKQALVTAEHTEGDELSQTIFFMDLRSHGKEFERYYEDAKAKG
    VRFIRARPHTIDPLRGGSGVRMRYTTEDGRQLEEDFDLAVLSVGMEASQDNKALADIFDFSLDSYGFAKTAASNPVRVND
    GVFVAGALHAPKAIPHAVTEASAAANEAARMLSEAKGALAVEKTYPDERDVADEEPRVGVFVCSCGINIAGVIDVNAVVE
    YAKGLDHVAFVENNLFTCSADTQELIRQKAEEMNLNRIVVAACTPRTHEPLFQETLKEAGLNAYLVEMANIRNQNSWVHQ
    KEPEKATEKAKDQVRMAVAKAVRNKALTRLKVDVNQKALVIGGGVAGMTSALSLAEQGFPVALLEREDRLGGNARHVSAT
    DFGDSVPPMLKDMIKKVEGHPDIRVHTNARLKTAVGSVGNFVSKFESNGETRAVTYGAAVIATGAKESIPDEYGFGSDPR
    IHTHLSFDKLMQEEVSTVQKADTVAFIQCVGSRDSRRPYCSRICCTHTMKAAIKLKTLNRAMQVVVFYRDIRTYGLREEL
    YRKARELGVLFVRYSPDDKPQVRTTPEGVMVRGLDPISRFTLELEADYLVLAAAVEPHGNEELVELYKCGANADGFLNEA
    HPKLRPVDMSVDGLFVAGLCNYPKPMDEAISQAQAAAARAAVVLSRKEMLLDAIKSYVTEHCDGCALCVDVCPYRAIRLQ
    ESTGEDGRMHRMIQVDPALCKGCGVCAATCPKDGVRVHGFTKDQIKAQVASALESLSEGRA

    >gi|218782792|ref|YP_002434110.1| HesB/YadR/YfhF-family protein [Desulfatibacillum alkenivorans AK-01]
    MLECTQAAADKIKEYFESQPKVVPVRVFLNQGGCAGPSLALALDESRENDESYEVDGLTFVVDKAFLAQASPIKIDYSML
    GFEINSAYELPKGGDCGGCSGGTCG

    >gi|218782889|ref|YP_002434207.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Desulfatibacillum alkenivorans AK-01]
    MADQTVGSVLVVGGGISGMQTALDLADSGYYVYLLEKSPSIGGVMSQLDKTFPTNDCAMCIISPKLVEVGRHLNIELITY
    SDLESVEGAPGKFKVKVRKRARSISTELCTGCGACLDACPVTNIVNAPA

    >gi|218782911|ref|YP_002434229.1| ferredoxin [Desulfatibacillum alkenivorans AK-01]
    MITFKLNGKKVQGEDGQTVLQVAEKYGVEIPTLCHHKALDPAGMCRMCTVEMFDGRRTKFVTACNYPIWEGMEIFTDTET
    VHEGRKLIVEMLLSR
    CTSVPEIQNLAKKYGIEKSRFGEDNENDCILCGLCVRVCEKMGNSAITLTGRGLEMKVDTPFSVQ
    SDICKGCGACEFICPTGHIKLENINKGEIKKIPSEYELGLKGRKPVYVPYAQAVPNTPAIDRRYCMHFKTGGCQICTEVC
    GVNAIDHTMQDEIVELEVGSIVLAPGAKVYNPGKHDTYNYNTNPNVVTSLEFERILSASGPYGGHLVRPSDHVEPKKIAW
    IQCVGSRDEHLDGKGYCSGVCCTYAVKEAMLAKDHCPEGPDGLDAAIFYIDIRTNGKDFERFYNRAKDGGVRFVKSKVTK
    VDHNDETGMEILRYVDAAGKLQEEEFDIVVLSVGFEVAEETKEMAKKLGLEVDKNGFAVSSSFNPVQTSRDGVFVCGAFS
    APKDIPTSVIDSSAAAGVTGGLLADSRFTLTKTAEIPPERAIKGDPTRIGVFLCCCGSNIAGVVDMPKLEAFAKTLPDVA
    HVEVNMYSCSQDTQEKMSEVIRDQNLNRVVVAACTPKTHEPLFQETLIAASLNKYLFEMANIRNHCSWVHKDAPDKATLK
    AMETVRMSVQKAALAQPLTEPKLSIVEKGLVIGGGVAGMEAAKNLAAQGYETHILERTDQLGGQARSLHKTWKGEDVQKY
    LAQLISDIESNELITVHKNAEITNVEGFVGDFKTTFKVGEEETTYNHGVTIFACGATEYKPTEYLYGQDPRVVTNLELEK
    KLIQGDAGLKSAGAAVFIQCVGSRIPSRPYCSKLCCTQSIKNALALKKANPKKPVFVLYRDMRPYGLRENLYREAREKGV
    TFIRYNDDKPLDVTGGDKLTVSFTDYVLGKKLQISPELLVLAAAIVPEERNPLAQAFKVSQNQDGFFAEAHVKLRPNDFA
    TDGVFLCGLTHGPKPIDEAIAQAQAAAARAVTLLSRKEISVAGTVASVDSQFCSGCKVCVSICPYSAPLFNEKTGKAEIQ
    STLCKGCGLCVASCRSGAIHLAGFDTSQIFSMIDAL